[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81342.1

[Show Plain Result]


## Summary of Sequence Search
    1::236
    1::236     9e-49  41%  242 aa  LUTA2_BACCZ RecName: Full=Lactate utilization protein A 2;
    1::236     9e-49  41%  242 aa  LUTA2_BACCQ RecName: Full=Lactate utilization protein A 2;
    1::236     9e-49  41%  242 aa  LUTA2_BACC3 RecName: Full=Lactate utilization protein A 2;
    1::236     3e-48  41%  242 aa  LUTA2_BACC0 RecName: Full=Lactate utilization protein A 2;
    1::236     3e-48  41%  242 aa  LUTA2_BACAN RecName: Full=Lactate utilization protein A 2;
    1::236     3e-48  41%  242 aa  LUTA2_BACAA RecName: Full=Lactate utilization protein A 2;
    1::236     3e-48  41%  242 aa  LUTA1_BACAC RecName: Full=Lactate utilization protein A 1;
    1::235     3e-48  44%  238 aa  LUTA_GEOSW RecName: Full=Lactate utilization protein A;
    1::235     2e-47  43%  239 aa  LUTA_GEOKA RecName: Full=Lactate utilization protein A;
    1::235     5e-47  43%  239 aa  LUTA_GEOTN RecName: Full=Lactate utilization protein A;
    1::235     3e-46  42%  238 aa  LUTA_ANOFW RecName: Full=Lactate utilization protein A;
    1::235     5e-46  43%  238 aa  LUTA_BACA2 RecName: Full=Lactate utilization protein A;
    1::235     3e-45  42%  238 aa  LUTA_BACLD RecName: Full=Lactate utilization protein A;
    1::235     1e-43  41%  239 aa  LUTA_BACSK RecName: Full=Lactate utilization protein A;
    1::235     3e-43  39%  244 aa  LUTA_OCEIH RecName: Full=Lactate utilization protein A;
    1::235     6e-42  39%  238 aa  LUTA_BACSU RecName: Full=Lactate utilization protein A;
    1::235     6e-42  41%  244 aa  LUTA_BACHD RecName: Full=Lactate utilization protein A;
    4::240     1e-41  42%  245 aa  LUTA_EXISA RecName: Full=Lactate utilization protein A;
    1::235     2e-40  39%  239 aa  LUTA_BACCN RecName: Full=Lactate utilization protein A;
    1::235     6e-40  38%  239 aa  LUTA_BACCR RecName: Full=Lactate utilization protein A;
    1::235     6e-40  38%  239 aa  LUTA_BACC4 RecName: Full=Lactate utilization protein A;
    1::235     6e-40  38%  239 aa  LUTA_BACC2 RecName: Full=Lactate utilization protein A;
    1::235     1e-39  44%  238 aa  LUTA_BACP2 RecName: Full=Lactate utilization protein A;
    1::235     2e-39  38%  239 aa  LUTA_BACHK RecName: Full=Lactate utilization protein A;
    1::235     2e-39  38%  239 aa  LUTA_BACC7 RecName: Full=Lactate utilization protein A;
    1::235     2e-39  38%  239 aa  LUTA_BACC1 RecName: Full=Lactate utilization protein A;
    1::235     2e-39  38%  239 aa  LUTA_BACAH RecName: Full=Lactate utilization protein A;
    1::235     2e-39  38%  239 aa  LUTA2_BACAC RecName: Full=Lactate utilization protein A 2;
    1::238     2e-39  39%  245 aa  LUTA1_BACWK RecName: Full=Lactate utilization protein A 1;
    1::235     2e-39  38%  239 aa  LUTA1_BACCZ RecName: Full=Lactate utilization protein A 1;
    1::235     2e-39  38%  239 aa  LUTA1_BACCQ RecName: Full=Lactate utilization protein A 1;
    1::235     2e-39  38%  239 aa  LUTA1_BACC3 RecName: Full=Lactate utilization protein A 1;
    1::235     2e-39  38%  239 aa  LUTA1_BACC0 RecName: Full=Lactate utilization protein A 1;
    1::235     2e-39  38%  239 aa  LUTA1_BACAN RecName: Full=Lactate utilization protein A 1;
    1::235     2e-39  38%  239 aa  LUTA1_BACAA RecName: Full=Lactate utilization protein A 1;
    1::235     5e-39  37%  239 aa  LUTA2_BACWK RecName: Full=Lactate utilization protein A 2;
   24::225     2e-34  39%  228 aa  LUTA_LYSSC RecName: Full=Lactate utilization protein A;
    1::235     8e-34  35%  245 aa  LUTA_MACCJ RecName: Full=Lactate utilization protein A;
    1::236     1e-33  36%  239 aa  YKGE_ECOLI RecName: Full=Uncharacterized protein ykgE;
  197::438     5e-17  29%  444 aa  GLCF_BACSU RecName: Full=Probable glycolate oxidase iron-sulfur
  263::454     2e-14  30%  494 aa  Y1067_METMP RecName: Full=Uncharacterized iron-sulfur protein
  260::429     4e-12  28%  489 aa  Y092_METJA RecName: Full=Uncharacterized iron-sulfur protein
  204::403     2e-08  26%  409 aa  HDRD_METBF RecName: Full=CoB--CoM heterodisulfide reductase
  200::403     1e-07  26%  409 aa  HDRD_METAC RecName: Full=CoB--CoM heterodisulfide reductase 2
  204::380     3e-07  28%  409 aa  HDRD_METMA RecName: Full=CoB--CoM heterodisulfide reductase 2
  199::339     8e-07  37%  396 aa  GLPC_ECOLI RecName: Full=Anaerobic glycerol-3-phosphate
  199::339     8e-07  37%  396 aa  GLPC_ECO57 RecName: Full=Anaerobic glycerol-3-phosphate
  147::237     5e-06  36%  300 aa  HDRB_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1
  147::247     9e-06  34%  300 aa  HDRB_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1
  208::386     2e-05  24%  407 aa  GLCF_ECOLI RecName: Full=Glycolate oxidase iron-sulfur subunit;
  147::236     1e-04  32%  294 aa  HDRB1_METJA RecName: Full=CoB--CoM heterodisulfide reductase
    1::223     1e-04  26%  295 aa  HDRB2_METJA RecName: Full=CoB--CoM heterodisulfide reductase
   40::245     2e-04  39%  305 aa  HDRB_METKA RecName: Full=CoB--CoM heterodisulfide reductase subunit
  147::242     9e-04  31%  302 aa  HDRB_METTM RecName: Full=CoB--CoM heterodisulfide reductase subunit
    1::236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVALFITCLADQFYXXXXXXXXXXXXXXXXXXDFPQGQTCCGQPAFNAGYWDEARPLAKRTLEVFEEAE
LUTA2_BACCZ     MKVSLFITCLSDVFFPQVGRSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA2_BACCQ     MKVSLFITCLSDVFFPEVGKSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA2_BACC3     MKVSLFITCLSDVFFPQVGKSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA2_BACC0     MKVSLFITCLSDVFFPQVGKSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA2_BACAN     MKVSLFITCLSDVFFPQVGKSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA2_BACAA     MKVSLFITCLSDVFFPQVGKSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA1_BACAC     MKVSLFITCLSDVFFPQVGKSVVEIMNQCGVELDFPEGQTCCGQPAYNSGYQEDAKLAAKQMIKAFEHSE
LUTA_GEOSW      MKVSLFATCLIDLFYTNAGKATVELLERLGCEIDFPEAQTCCGQPAYNSGYVKEAKEAMKHMIRTFEHAD
LUTA_GEOKA      MKVSLFVTCLIDLFYTEVGKATVELLERLGCKVDFPEAQTCCGQPAYNSGYVKEAKEAMKQMMRAFADAD
LUTA_GEOTN      MKVSLFVTCLIDLFYTNVGKATVELLERLGCEIDFPEAQTCCGQPAYNSGYIKDAKEAMKQMMRAFADAD
LUTA_ANOFW      MNVTLFVTCLVDLFHVNVGKATVELLERLGCTIHFPEAQTCCGQPAYNSGYVKEAKEAMKHMIRTFEHAE
LUTA_BACA2      MKVSLFVTCLVDMFQTNVGKATVEVLERLGCEVDFPEGQICCGQPAYNSGYVTDAKKAMKRMIAAFEEAE
LUTA_BACLD      MKVSLFITCLVDMFQSNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVKDSKKAMRRMIETFESAE
LUTA_BACSK      MNVSLFVTCLADIFYPGVGKDTVEVLERHGCNVKFPENQICCGQPAFNSGYHEDTKKAAKHTIETFADAD
LUTA_OCEIH      MKVSLFITCVSDIVFADVGKHTVEILERVGCEVDFPAAQTCCGQPAYNSGYLQEAKKSMKQMIKAFKNSE
LUTA_BACSU      MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMKRMIETFQDSE
LUTA_BACHD      MKVSLFITCLADVFYPDVGRHTVELLERYGCEVEFPEQQTCCGQPAYNSGYHRDTKKVAKHMIETFARAE
LUTA_EXISA      --VALFVTCLSDTLFPSVGQATVELLEHLGCEVTFPFEQTCCGQPAYNSGYHEETKKIAKHMIETFEDAE
LUTA_BACCN      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVESAKEAMKHMIETFEDAE
LUTA_BACCR      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_BACC4      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_BACC2      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_BACP2      MKVHLFVTCLIDTMQPNVGKATXXXXXXXXXXXXFPESQVCCGQPAFNSGYTKETIKAAKNMIKAFETAE
LUTA_BACHK      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_BACC7      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_BACC1      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_BACAH      MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA2_BACAC     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA1_BACWK     MKVSIFITCVADVFYPEVGKDVVEILEDLGCEVDFPKTQTCCGQPAYNSGYVKETKTAAKHMIEAFASSE
LUTA1_BACCZ     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA1_BACCQ     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA1_BACC3     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA1_BACC0     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA1_BACAN     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA1_BACAA     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA2_BACWK     MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAE
LUTA_LYSSC      ---------------------------------DSPEQQICCGQPAYNSGYVKESKNAMKRMITAFEHAD
LUTA_MACCJ      MKVSLFSTCLVDVFEKRVGIATVELLEKLGCEVDFPAAQVCCGQPAYNSGYHEETKKAAKNMIKAFEQSE
YKGE_ECOLI      MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQPAINSGYIKEAIPGMKNLIAALEDDD
GLCF_BACSU      -RVAFFSGCLMDTMFLPTNNATLKLLQLAGCDIVIPPEQACCGALHGHSGEKNTGKELAKQNIAAFEDVD
Y1067_METMP     MRVAFFTGCLVDFRLQEIGKSAIRVLNAHGVSVIIPKNQVCCGSPFIRTGQTDISESLKKQNLEIFNKVD
Y092_METJA      LRVAFFTGCLVDFRLQNVGKDAIKVLNAHGVSVVIPKNQVCCGSPFFRTGQRDVAEMLKRKNLEIFNDVD
HDRD_METBF      ----------------------------------------CCGSALIRTGQVDVARELARHNVEALQKAK
HDRD_METAC      ------------------------------------EDEWCCGSALIRTGQVDVAKELAKHNVEAIKAAT
HDRD_METMA      ----------------------------------------CCGSALIRTGQVDVPRELARHNVEALKKAK
GLPC_ECOLI      --------------------------------------EKCCGVPLIANGFTDKARKQAITNVESIREAV
GLPC_ECO57      --------------------------------------EKCCGVPLIANGFTDKARKQAITNVESIREAV
HDRB_METMA      ----------------------------------------------------------------------
HDRB_METAC      ----------------------------------------------------------------------
GLCF_ECOLI      ----------------------------------------CCGAVDYHLNAQEKGLARARNNIDAWAGAE
HDRB1_METJA     ----------------------------------------------------------------------
HDRB2_METJA     MKYAFFLGCIMPHRYPGVEKATKIVMEELGVELEYMPGASCCPAPGV-FGSFDQKTTLAARNLCIAEEMD
HDRB_METKA      -------------------------------------GASCCPAPSFDLKTWVT---IAARNLSIAEEKG
HDRB_METTM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YVVLPSGSCASMVKNHYPELLPGNREALAMAEKTYELSQFXXXXXXXXXXXXXXXXXRVAYHHGCHALRE
LUTA2_BACCZ     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-LVNVLGKNDWKSKLVEKAVFHQSCHMSRA
LUTA2_BACCQ     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-LVNVLGKNNWKSKLVEKAVFHQSCHMSRA
LUTA2_BACC3     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-LVNVLGKNDWKSKLVEKAVFHQSCHMSRA
LUTA2_BACC0     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-LVNILGKNDWKSKLVEKAVFHQSCHMSRA
LUTA2_BACAN     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-VVNILGKNDWKSKLVEKAVFHQSCHMSRA
LUTA2_BACAA     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-VVNILGKNDWKSKLVEKAVFHQSCHMSRA
LUTA1_BACAC     YIVTPSGSCASMVHHYYKEMFKGDSEAVHLADRTYELTDF-VVNILGKNDWKSKLVEKAVFHQSCHMSRA
LUTA_GEOSW      YVVTPSGSCATMLK-EYPRVFQGDREAKALADKTYELTQF-IVDVLKMEDVGAKLQGRATYHTSCHMTRL
LUTA_GEOKA      YVVTPSGSCAAMLK-EYPHIFHGDAEAKRLAAKTYELTQF-LVDVLKVEDVGASLHGRATYHTSCHMTRL
LUTA_GEOTN      YVVTPSGSCAAMLK-EYPHIFRGDEEAKRLAAKTYELTQF-LVNVLRVEDVGASLPGRATYHTSCHMTRL
LUTA_ANOFW      YIVTPSGSCATMFK-EYPHIFKGDGEAKRVADKTYELTQF-IVDVLQVEDVGARLEGKATYHTSCHMTRL
LUTA_BACA2      YVVSPSGSCTTMFR-EYPHLFQDDAKAQQLADKTYELTDF-IVNVLGVEDVGAVLHKKATVHTSCHMTRL
LUTA_BACLD      YVVSPSGSCAFMFK-EYPHLFRDEEKAQRLADKTYELTDF-IVNVLKIEDVGATLEKKATYHTSCHMTRL
LUTA_BACSK      YVVLPSGSCAAMLL-EYKELFADDPEAEELASKTYELTQF-LVRVLKVEDIGAVCHKKATYHTSCHMSRL
LUTA_OCEIH      YVVGPSGSCVGMLK-EYPHIFKGDQPAIDLANKSYEITQF-LVDVLGVTDLGSTFKGRVTYHPSCHMTRV
LUTA_BACSU      YVVSPSGSCTTMFR-EYPHLFXXXXXXXXXXXXTYELTDF-IVNVLGVEDVGATLHTKATLHTSCHMTRL
LUTA_BACHD      YVVSPSGSCVAMF-HEYEELLKDQERAKKLVAKTYELSQF-LVNVLKVKEVHSSLQAKATYHTSCHMTRL
LUTA_EXISA      YIVGPSGSCVMMMRD-YPHLFQDDPRAEAHAAKTFELTQF-IVDVLEVTDVGAKFPAKATYHASCHMTRL
LUTA_BACCN      YIVTPSGSCATMF-HEYPHVFKDDARAQKVADKTYELTQF-IVDVLKVTDVGASLKGTATMHKSCHMTRM
LUTA_BACCR      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA_BACC4      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA_BACC2      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLSGI-ATIHKSCHMTRM
LUTA_BACP2      YVVTPSGSCKAMFL-EYPQLLKWSTQAEALAEKTYELTEF-IVDILHVTDVGASLKGNATYHTSCHMTRL
LUTA_BACHK      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA_BACC7      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA_BACC1      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA_BACAH      YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA2_BACAC     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA1_BACWK     YVVAPSGSCAMMV-HEFSSLFSESKKATELGNKTYEFTQF-LVEVLGKEDLGAELHKKATVHTSCHMSRL
LUTA1_BACCZ     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA1_BACCQ     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA1_BACC3     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA1_BACC0     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLNVTDVGASLPGI-ATIHKSCHMTRM
LUTA1_BACAN     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA1_BACAA     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRM
LUTA2_BACWK     YIVTPSGSCATMF-HEYPHVFKDDKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGI-ATIHKSCHMTRL
LUTA_LYSSC      YVVSPSGSCVYMFK-EYPEIFKGDXXXXXXXXXTYEFTEF-IVHVLKIEDVGAHLEGKATYHTSCHMTRL
LUTA_MACCJ      VVVAPSGSCVTMFK-HYPDLFKNDAKAQELADKTYEVTQFIVEVLGITNVGAKLDGV-ATIHPSCHMTRL
YKGE_ECOLI      PIISPAGSCTYAVKS-YPTYLADEPEAAKVAARMQDLTSF-IVNKLGVVDVGASLQGRAVYHPSCSLARK
GLCF_BACSU      AVITNAGGCGAFL-TEYDHLLKDDPEAAAFVQKLKDFSSVLVELDFHQMDLALETPQVVTYQDSCHLRNV
Y1067_METMP     SVVTLCAGCGSTLKNDY-------------KEKKFKVMDITEVLVKVGLIDYKPLDITVTYHDPCHLRRG
Y092_METJA      CVVTICAGCGSTLKNDY-------------KERKFEVKDITEVLTEVGLLKYKPLKMRITYHDPCHLRRG
HDRD_METBF      KVLFACAGCFRAAKIDWPRLL-----GKELPFEVIHITQFLADLIQADKIKWEKPINKITYHDPCHLGRH
HDRD_METAC      KVLYACAGCFRASKVDWPRLLGEE-----LPFEVVHITEFLEDLIKKDKIKWEKSLDKVTYHDPCHLGRH
HDRD_METMA      KVLYACAGCFRASKVDWPRLLGEELEVVHVAEFLADLIK------QDKIKWEKSINKTVTYHDPCHLGRH
GLPC_ECOLI      PVIATSSTCTFALRDEYPEVLKGLRDHIELATR-----WLWRKLDEGXXXXXXXXXXXVVYHTPCH-MEK
GLPC_ECO57      PVIATSSTCTFALRDEYPEVLKGLRDHIELATR-----WLWRKLDEGXXXXXXXXXXXVVYHTPCH-MEK
HDRB_METMA      ---------------------------------------------------------KVALHYGCHLIRN
HDRB_METAC      ---------------------------------------------------------KVALHYGCHLIRN
GLCF_ECOLI      AILQTASGCGAFVKE-YGQMLKNDALYADKARQVSELAVVELLREEPLEKLAIRGDKKLAFHCPCHAQKL
HDRB1_METJA     ----------------------------------------------------------VAVHYGCHYLKP
HDRB2_METJA     IVTVCNGCYGSLFEAAH--ILHENKEALDFVNETIKVRHFAELIYKDIGVDKIKEKVNVAIHYGCHFLKP
HDRB_METKA      YDILTNGCFGSLNENHLPELREFVNEKLAEIDKVYHVNTFLYXXXXXXXXXXXXXRPKVAVHYGCHLLKP
HDRB_METTM      ----------------------------------------------------------VAVHYGCHFLKE


                         +         .         .         .         .         *         .:210
query           LGVREEPLLLLQNAGAEILPWEAWEECCGFGGLFSVKLPEVSLAMADRKLATLPKAEVLTSTDAGCLLHL
LUTA2_BACCZ     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA2_BACCQ     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA2_BACC3     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA2_BACC0     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA2_BACAN     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA2_BACAA     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA1_BACAC     LGIKEEPLLLSQVEGLDIKELPYCQDCCGFGGTFAVKMSSISETMVDEKIKHITEANLLIGADMGCLMNI
LUTA_GEOSW      LGVKEAPFKLLKNVGLELVPLPNAYQCCGFGGTFSVKMGTISEQMVDEKIEHIEEADYLIGADCGCLMNI
LUTA_GEOKA      LGVKDAPLRLLEHVGLELVPLPNAHQCCGFGGTFSVKMGPISEQMVDEKIGHIEEAEALIGADCGCLLNI
LUTA_GEOTN      LGEKEVPLRLLEHVGLELVPLPNAHQCCGFGGTFSVKMGPISEQMVDEKIEHIEKADYLIGADCGCLMNI
LUTA_ANOFW      LGVKDAPLTLLQHVGLEVVPLPNAHNCCGFGGTFSVKMGPISEQMVDEKIQCIEEADYLIGADCGCLMNI
LUTA_BACA2      LGVSEEPMKLLRHVGLELTALPGKHQCCGFGGTFSVKMAQISEQMVDEKVACVTEAEVLIGADCGCLMNI
LUTA_BACLD      LGVTDAPMKLLRHVGLEFTPLPRKHDCCGFGGTFSVKMSQISEQMVDEKVACVEEADVLIGADCGCLMNI
LUTA_BACSK      LRETEAPFSLLEQVGLELAPLANKESCCGFGGTFSVKMPAISEQMVEEKVGHIEAADLLIGADCGCLMNI
LUTA_OCEIH      LGVKDAPQKLLQSVGIDFVELPVKEDCCGFGGTFSIKNPEISREMVKEKSVSETKAEYLVGGDMGCLMNI
LUTA_BACSU      LGVRKEPMKLLSHVGLQFTELPGKHNCCGFGGTFSVKMAQISEQMVDEKVECVEEAEVLIGADCGCLMNI
LUTA_BACHD      LGETQSPFDLLEKVGLQLEELPNRETCCGFGGTFSVKMTPISEQMVDEKVRHIEEADVLIGADCGCLMNI
LUTA_EXISA      LGIEAAPGKLLGNVGLTMVPLANVHNCCGFGGTFSVKMPDVSVQMVDEKVDSILQAEVLIGADASCLMNI
LUTA_BACCN      LGVKEAPGILLSNVGLTVKELPNVQNCCGFGGTFSVKMTPISEQMVDEKVDSVMEADYLIGADCGCLLNI
LUTA_BACCR      LGVKEAPGILLSNVGLTVRDLPNVQNCCGFGGTFSVKMTPISEQMVDEKVDSVMEADYLIGADCGCLLNI
LUTA_BACC4      LGVKEAPGILLSNVGLTVRDLPNVQNCCGFGGTFSVKMTPISEQMVDEKVDSVMEADYLIGADCGCLLNI
LUTA_BACC2      LGVKEAPGILLSNVGLTVRDLPNVQNCCGFGGTFSVKMTPISEQMVDEKVDSVMEADYLIGADCGCLLNI
LUTA_BACP2      LRIKEAPFTLLSNVDLSMTPLPRAENCCGFGGTFSVKMTPISEQMVDEKVQSIEEAQYIIGADCGCLLNI
LUTA_BACHK      LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA_BACC7      LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA_BACC1      LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA_BACAH      LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA2_BACAC     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA1_BACWK     MGIKEPPQKLLKCVGLEVVSLPHNYDCCGFGGTFSVKMPEISEQMVEEKVKHIMEAELLIGMDCSCLMNI
LUTA1_BACCZ     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA1_BACCQ     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA1_BACC3     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA1_BACC0     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA1_BACAN     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA1_BACAA     LGVTEAPGILLSNVGLTVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVAMETGADYLIGADCGCLLNI
LUTA2_BACWK     LGVKEAPGILLSSVGLIVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVDSVMEADYLIGADCGCLLNI
LUTA_LYSSC      LGVNEAPIKLLQNVGLQYVELPGKDRCCGFGGTFSVKMGNISGEMVQEKVHHVEEADYLIGADAGCLINM
LUTA_MACCJ      LGVTAPAKXXXXXXXXXXXXXPKYYNCCGFGGTFAVKMSDVSGEMVDEKVDCIVEADYLVGGDCSCLMNI
YKGE_ECOLI      LGVKDEPLTLLKNVGLELLTFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLVRPEYLIGADVSCLLNI
GLCF_BACSU      MHTSLEPRQLLKSIGAEFKEMEKADSCCGSAGIYNIVEVEMSMKILDSKMAAVKATELIVTANPGCLLQM
Y1067_METMP     QKVYLEPRKILESPKLKFIEMEIPDQCCGAGGGVRSGKPEVAEAIGKR------KANMIYATDADYLI--
Y092_METJA      QKIYKQPREILKSPELEFIDIEA--RCCGAGGGVRSGKPDIA----------------------------
HDRD_METBF      VGVFNAPRYVLSHIGVKFVEMDRSKECCGAGGGVKAGMPDLAVAMGESRVALETNADILSSACPFCKRNL
HDRD_METAC      VGVFEPPRYVLSHIGVKFVEMDRVKECCGAGGGVKAGIPDLALSVAESRVALDTNADVLSSACPFCKRNL
HDRD_METMA      VGVFDAPRYVLSHIGVKFVEMDRVKECCGAGGGVKAGIPDLALGVAESRVAVATDADILSSCCPFCKRNL
GLPC_ECOLI      MGWTLYTLELLRNPGLELTVLDS--QCCGIAGTYGFK---------------------------------
GLPC_ECO57      MGWTLYTLELLRNPGLELTVLDS--QCCGIAGTYGFK---------------------------------
HDRB_METMA      LGDTESPVFLVEATGAKSVDYTDKMMCCGAGGGVRSGYADESLEMLEHKLDCICKAGVDCIVNACPFCHL
HDRB_METAC      LGETEAPVFLVEATGAKSVDYTDKMMCCGAGGGVRSGHAAESLEMLEHKLACIRNAGVDCIVNACPFCHL
GLCF_ECOLI      NGEVEKVLLRL---GFTLTDVPDSHLCCGSAGTYALTHPDLARQLRDNKMNALEKPEMIVTANIGCQTHL
HDRB1_METJA     TDIKERPRSLVEALGAVSVNYKDKNMCCGAGGGVRARNLDVALKMTKTKLENIKEAKADCITEVCPFCHL
HDRB2_METJA     SDVKERPKLLVAATGAKPVMYRDYLMCCGAGGGVRARFLPTALDMTKEKIRNMLEA--------------
HDRB_METKA      SEVTEDPRTLVEALGAESVDYKDKIMCCGAGGGVRSRELKVSLHFTREKIFNMLEAGADCTTNVCPFCHL
HDRB_METTM      INIDERPTILVEVTGAKSVEYKDKMMCCGAGGGVRSRDLDVALDFTREKLTNMKEAGVDAIVNVCPFCHL


                         .         .         .         +         .         .         .:280
query           AGRLGKKGENLRVAPLATLLWEAxxx
LUTA2_BACCZ     GGRLRRKNKNIQVLHVAEVL------
LUTA2_BACCQ     GGRLRRKNKNIQVLHVAEVL------
LUTA2_BACC3     GGRLRRKNKNIQVLHVAEVL------
LUTA2_BACC0     GGRLRRENKNIQVLHVAEVL------
LUTA2_BACAN     GGRLRRENKNIQVLHVAEVL------
LUTA2_BACAA     GGRLRRENKNIQVLHVAEVL------
LUTA1_BACAC     GGRLRRENKNIQVLHVAEVL------
LUTA_GEOSW      GGRLKRQGKPIKVMHIAEVL------
LUTA_GEOKA      GGRIARLGKPIRVMHIAEVL------
LUTA_GEOTN      GGRIGRVGKPIRVMHIAEVL------
LUTA_ANOFW      GGRIERKGKPIRVMHIAEVL------
LUTA_BACA2      GGRLDRKDKNVRVMHIAEVL------
LUTA_BACLD      GGRIGRKNKPIEVMHIAEVL------
LUTA_BACSK      GGRIERNGKTIEVKHIAQVL------
LUTA_OCEIH      GGRMRREGKDVKVVHITEIL------
LUTA_BACSU      GGRLGRKDKNVKVMHIAEVL------
LUTA_BACHD      GGRIQRKGKPIKMMHLAEVL------
LUTA_EXISA      GGRLHKQGHPIKVMHIAEVLNE----
LUTA_BACCN      GGRIERLGKKVRVMHIAEVL------
LUTA_BACCR      GGRIERLGKEVKVMHIAEVL------
LUTA_BACC4      GGRIERLGKEVKVMHIAEVL------
LUTA_BACC2      GGRIERLGKEVKVMHIAEVL------
LUTA_BACP2      GGRLNRLDKPIQVMHIAEVL------
LUTA_BACHK      GGRIERLGKEIKVMHIAEVL------
LUTA_BACC7      GGRIERLGKEIKVMHIAEVL------
LUTA_BACC1      GGRIERLGKEIKVMHIAEVL------
LUTA_BACAH      GGRIERLGKEIKVMHIAEVL------
LUTA2_BACAC     GGRIERLGKEIKVMHIAEVL------
LUTA1_BACWK     KGRLTRNGYPIDVKHIAQVLNE----
LUTA1_BACCZ     GGRIERLGKEIKVMHIAEVL------
LUTA1_BACCQ     GGRIERLGKEIKVMHIAEVL------
LUTA1_BACC3     GGRIERLGKEIKVMHIAEVL------
LUTA1_BACC0     GGRIERLGKEIKVMHIAEVL------
LUTA1_BACAN     GGRIERLGKEIKVMHIAEVL------
LUTA1_BACAA     GGRIERLGKEIKVMHIAEVL------
LUTA2_BACWK     GGRIERLGKEVKVMHIAEVL------
LUTA_LYSSC      GGRIHRQGKPIKVMHIAEVL------
LUTA_MACCJ      DGRLRRRGVDVKAVHIIEIL------
YKGE_ECOLI      SGRLQREGQKVKVMHIAEVL------
GLCF_BACSU      --KLGIEREGLRAVHLADLLLEA---
Y1067_METMP     --------------------------
Y092_METJA      --------------------------
HDRD_METBF      SDGRDALKSDIVVEDIIELVAEA---
HDRD_METAC      MDGRDSLKADIEVEDVIVLVAQA---
HDRD_METMA      --------------------------
GLPC_ECOLI      --------------------------
GLPC_ECO57      --------------------------
HDRB_METMA      --------------------------
HDRB_METAC      QFDRGQLAVN----------------
GLCF_ECOLI      A-------------------------
HDRB1_METJA     --------------------------
HDRB2_METJA     --------------------------
HDRB_METKA      --------------------------
HDRB_METTM      QFDVGQ--------------------