[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81487.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
    7::210     5e-24  38%  251 aa  HDHD3_BOVIN RecName: Full=Haloacid dehalogenase-like hydrolase
    7::210     6e-23  39%  251 aa  HDHD3_MOUSE RecName: Full=Haloacid dehalogenase-like hydrolase
    7::210     3e-18  37%  251 aa  HDHD3_HUMAN RecName: Full=Haloacid dehalogenase-like hydrolase
   81::216     6e-15  34%  244 aa  HDHD3_XENLA RecName: Full=Haloacid dehalogenase-like hydrolase
   60::210     1e-14  33%  242 aa  HDHD3_DANRE RecName: Full=Haloacid dehalogenase-like hydrolase
   98::196     1e-14  39%  240 aa  Y1777_PYRFU RecName: Full=Uncharacterized HAD-hydrolase PF1777;    
   96::194     4e-14  39%  241 aa  Y1655_PYRHO RecName: Full=Uncharacterized HAD-hydrolase PH1655;    
   97::193     4e-13  43%  226 aa  Y209_METTH RecName: Full=Uncharacterized HAD-hydrolase MTH_209;    
    8::220     4e-13  32%  260 aa  REG2_DROME RecName: Full=Rhythmically expressed gene 2
   84::179     7e-13  40%  213 aa  GPH_AQUAE RecName: Full=Phosphoglycolate phosphatase;       
   76::227     7e-13  33%  272 aa  GPH1_PSEAE RecName: Full=Phosphoglycolate phosphatase 1;       
   43::247     1e-12  33% 1059 aa  ACD10_HUMAN RecName: Full=Acyl-CoA dehydrogenase family member 10; 
    1::191     2e-12  33%  233 aa  Y970_METKA RecName: Full=Uncharacterized HAD-hydrolase MK0970;     
   96::194     5e-12  35%  238 aa  YB10_PYRAB RecName: Full=Uncharacterized HAD-hydrolase PYRAB05140; 
   78::203     5e-11  37%  231 aa  HAD4_BURCE RecName: Full=(S)-2-haloacid dehalogenase 4A;       
   69::185     7e-11  37%  218 aa  GPH_RHOSH RecName: Full=Phosphoglycolate phosphatase;       
   69::185     9e-11  37%  218 aa  GPH_RHOSK RecName: Full=Phosphoglycolate phosphatase;       
   69::185     9e-11  37%  218 aa  GPH_RHOS4 RecName: Full=Phosphoglycolate phosphatase;       
   69::185     9e-11  37%  218 aa  GPH_RHOS1 RecName: Full=Phosphoglycolate phosphatase;       
   64::177     1e-10  31%  251 aa  GPH_PSEPU RecName: Full=Probable phosphoglycolate phosphatase;     
   90::193     3e-10  40%  214 aa  PPAX_CLOPE RecName: Full=Putative pyrophosphatase ppaX;       
   93::190     3e-09  30%  227 aa  GPH_RHILO RecName: Full=Phosphoglycolate phosphatase;       
   66::198     5e-09  26%  272 aa  GPH_PSEPK RecName: Full=Phosphoglycolate phosphatase;       
    8::189     6e-09  33%  235 aa  GPH_NEIMA RecName: Full=Phosphoglycolate phosphatase;       
   59::189     8e-09  33%  228 aa  GPH_VIBVY RecName: Full=Phosphoglycolate phosphatase;       
  104::217     8e-09  30%  272 aa  GPH_PSEF5 RecName: Full=Phosphoglycolate phosphatase;       
   86::177     1e-08  33%  215 aa  PPAX_BACHD RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
  104::198     1e-08  29%  272 aa  GPH_PSEPF RecName: Full=Phosphoglycolate phosphatase;       
   98::208     1e-08  35%  224 aa  DEH2_MORSB RecName: Full=Haloacetate dehalogenase H-2;       
  111::216     1e-08  36%  554 aa  HYES_RAT RecName: Full=Epoxide hydrolase 2;       
  138::229     2e-08  34%  260 aa  YSAA_BACSU RecName: Full=Putative uncharacterized hydrolase ysaA;  
    7::204     2e-08  32%  252 aa  GPH_SHIBS RecName: Full=Phosphoglycolate phosphatase;       
   97::190     2e-08  39%  225 aa  YJJG_ECOLI RecName: Full=5'-nucleotidase yjjG;       
   97::190     2e-08  39%  225 aa  YJJG_ECO57 RecName: Full=5'-nucleotidase yjjG;       
  112::204     2e-08  33%  252 aa  GPH_SHISS RecName: Full=Phosphoglycolate phosphatase;       
  112::204     2e-08  33%  252 aa  GPH_SHIFL RecName: Full=Phosphoglycolate phosphatase;       
  112::204     2e-08  33%  252 aa  GPH_SHIDS RecName: Full=Phosphoglycolate phosphatase;       
   96::188     2e-08  33%  224 aa  GPH_PASMU RecName: Full=Phosphoglycolate phosphatase;       
  112::204     2e-08  33%  252 aa  GPH_ECOLI RecName: Full=Phosphoglycolate phosphatase;       
  112::204     2e-08  33%  252 aa  GPH_ECOL6 RecName: Full=Phosphoglycolate phosphatase;       
  112::204     2e-08  33%  252 aa  GPH_ECO57 RecName: Full=Phosphoglycolate phosphatase;       
   59::189     3e-08  33%  228 aa  GPH_VIBVU RecName: Full=Phosphoglycolate phosphatase;       
    4::192     4e-08  31%  227 aa  HAD1_PSEUC RecName: Full=(S)-2-haloacid dehalogenase 1;       
   95::187     4e-08  33%  226 aa  GPH_VIBCH RecName: Full=Phosphoglycolate phosphatase;       
    8::189     4e-08  31%  236 aa  GPH_NEIG1 RecName: Full=Phosphoglycolate phosphatase;       
    7::205     4e-08  32%  253 aa  GPH_KLEAE RecName: Full=Phosphoglycolate phosphatase;       
   97::189     5e-08  38%  224 aa  GPH_HAEI8 RecName: Full=Phosphoglycolate phosphatase;       
   38::208     7e-08  26%  224 aa  HAD9_PSEPU RecName: Full=(S)-2-haloacid dehalogenase H-109;        
   97::189     7e-08  39%  228 aa  GPH_VIBPA RecName: Full=Phosphoglycolate phosphatase;       
  136::247     7e-08  32% 1069 aa  ACD10_MOUSE RecName: Full=Acyl-CoA dehydrogenase family member 10; 
   34::183     9e-08  30%  199 aa  YIHX_SHIFL RecName: Full=Phosphatase yihX;         EC=3.1.3.-;
   34::183     9e-08  30%  199 aa  YIHX_ECOLI RecName: Full=Phosphatase yihX;         EC=3.1.3.-;
   93::180     9e-08  36%  216 aa  PPAX_BACSU RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
  112::216     9e-08  36%  555 aa  HYES_HUMAN RecName: Full=Epoxide hydrolase 2;       
   97::183     9e-08  36%  233 aa  GPH_AGRT5 RecName: Full=Phosphoglycolate phosphatase;       
   94::188     1e-07  29%  219 aa  PGMB_ECOLI RecName: Full=Putative beta-phosphoglucomutase;       
   68::185     2e-07  34%  218 aa  GPH_RHOS5 RecName: Full=Phosphoglycolate phosphatase;       
   97::189     2e-07  36%  224 aa  GPH_HAEIN RecName: Full=Phosphoglycolate phosphatase;       
   98::180     3e-07  34%  216 aa  PPAX_BACA2 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
    1::185     3e-07  32%  219 aa  GPH_RHOCA RecName: Full=Phosphoglycolate phosphatase;       
  111::216     4e-07  35%  554 aa  HYES_MOUSE RecName: Full=Epoxide hydrolase 2;       
  106::209     5e-07  38%  238 aa  YIGB_SHIFL RecName: Full=Uncharacterized protein yigB;
  106::209     5e-07  38%  238 aa  YIGB_ECOLI RecName: Full=Uncharacterized protein yigB;
   97::189     5e-07  34%  228 aa  Y1437_METJA RecName: Full=Uncharacterized HAD-hydrolase MJ1437;    
   95::177     5e-07  32%  216 aa  PPAX_BACC0 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   96::188     5e-07  32%  227 aa  GPH_VIBF1 RecName: Full=Phosphoglycolate phosphatase;       
  105::190     6e-07  33%  226 aa  GPH_COLP3 RecName: Full=Phosphoglycolate phosphatase;       
  102::191     8e-07  36%  222 aa  YRFG_SHIFL RecName: Full=Uncharacterized protein yrfG;
  102::191     8e-07  36%  222 aa  YRFG_ECOLI RecName: Full=Uncharacterized protein yrfG;
   95::177     1e-06  32%  216 aa  PPAX_BACCR RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     1e-06  32%  216 aa  PPAX_BACC2 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   85::175     1e-06  31%  221 aa  PGMB_LACLA RecName: Full=Beta-phosphoglucomutase;       
   94::188     1e-06  32%  225 aa  GPH_NITOC RecName: Full=Phosphoglycolate phosphatase;       
   60::165     1e-06  37%  231 aa  GPHC_RALEH RecName: Full=Phosphoglycolate phosphatase, chromosomal;
   91::179     1e-06  36%  220 aa  PPAX_THETN RecName: Full=Putative pyrophosphatase ppaX;       
   93::180     1e-06  34%  216 aa  PPAX_BACP2 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   98::188     1e-06  31%  229 aa  GPH_PHOPR RecName: Full=Phosphoglycolate phosphatase;       
   97::193     1e-06  34%  224 aa  GPH_MANSM RecName: Full=Phosphoglycolate phosphatase;       
   90::190     2e-06  27%  222 aa  YNIC_ECOLI RecName: Full=Phosphatase yniC;         EC=3.1.3.-;
   90::190     2e-06  27%  222 aa  YNIC_ECO57 RecName: Full=Phosphatase yniC;         EC=3.1.3.-;
   86::189     2e-06  28%  215 aa  YFGS_LACCA RecName: Full=Uncharacterized protein in fgs 3'region;
   95::179     2e-06  30%  215 aa  PPAX_BACWK RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
  104::216     2e-06  33%  555 aa  HYES_PIG RecName: Full=Epoxide hydrolase 2;       
   94::208     2e-06  35%  232 aa  HAD_PSEUY RecName: Full=(S)-2-haloacid dehalogenase;       
  104::186     2e-06  30%  272 aa  GPH_PSE14 RecName: Full=Phosphoglycolate phosphatase;       
   97::165     2e-06  40%  231 aa  GPHP_RALEH RecName: Full=Phosphoglycolate phosphatase, plasmid;    
   17::212     2e-06  32%  230 aa  CBBY_RHOSH RecName: Full=Protein cbbY;
   95::177     3e-06  30%  216 aa  PPAX_BACHK RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACCZ RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACCQ RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACC7 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  32%  216 aa  PPAX_BACC4 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACC3 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACAN RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACAH RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACAC RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   95::177     3e-06  30%  216 aa  PPAX_BACAA RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   92::208     3e-06  32%  248 aa  NANP_RAT RecName: Full=N-acylneuraminate-9-phosphatase;       
   92::208     3e-06  30%  248 aa  NANP_MOUSE RecName: Full=N-acylneuraminate-9-phosphatase;       
  102::191     3e-06  33%  234 aa  GPH_ERWCT RecName: Full=Phosphoglycolate phosphatase;       
   99::194     3e-06  33%  237 aa  GPH_CAUCR RecName: Full=Phosphoglycolate phosphatase;       
   88::183     4e-06  31%  220 aa  YHCW_BACSU RecName: Full=Uncharacterized protein yhcW;
  187::230     4e-06  49%  270 aa  LHPP_XENLA RecName: Full=Phospholysine phosphohistidine inorganic
   95::177     5e-06  30%  216 aa  PPAX_BACC1 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
    6::208     5e-06  31%  248 aa  NANP_HUMAN RecName: Full=N-acylneuraminate-9-phosphatase;       
  104::186     5e-06  29%  272 aa  GPH_PSESM RecName: Full=Phosphoglycolate phosphatase;       
   89::171     9e-06  35%  217 aa  PPAX_LISMO RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   89::171     9e-06  35%  217 aa  PPAX_LISMH RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   89::171     9e-06  35%  217 aa  PPAX_LISMF RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   89::171     9e-06  35%  217 aa  PPAX_LISMC RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   89::171     9e-06  35%  217 aa  PPAX_LISIN RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   84::176     1e-05  27%  214 aa  PPAX_OCEIH RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   92::186     1e-05  29%  226 aa  PGMB_BACSU RecName: Full=Putative beta-phosphoglucomutase;       
   89::165     1e-05  35%  208 aa  P845_THEAC RecName: Full=Phosphatase Ta0845;         EC=3.1.3.-;
  104::186     1e-05  28%  272 aa  GPH_PSEU2 RecName: Full=Phosphoglycolate phosphatase;       
  104::183     2e-05  32%  188 aa  YQAB_ECOLI RecName: Full=Phosphatase yqaB;         EC=3.1.3.-;
  102::208     2e-05  28%  229 aa  HAD2_PSEUC RecName: Full=(S)-2-haloacid dehalogenase 2;       
   99::193     2e-05  32%  229 aa  GPH_XYLFA RecName: Full=Phosphoglycolate phosphatase;       
  124::193     3e-05  34%  225 aa  YFP5_SCHPO RecName: Full=Putative uncharacterized hydrolase
   89::171     3e-05  33%  217 aa  PPAX_LISW6 RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
   88::181     3e-05  32%  221 aa  GPH_XANCP RecName: Full=Phosphoglycolate phosphatase;       
   88::181     3e-05  32%  221 aa  GPH_XANC8 RecName: Full=Phosphoglycolate phosphatase;       
   99::193     3e-05  32%  229 aa  GPH_XYLFT RecName: Full=Phosphoglycolate phosphatase;       
  158::304     4e-05  33%  344 aa  SERB_ARCFU RecName: Full=Phosphoserine phosphatase;       
  179::222     4e-05  49%  259 aa  HDHD2_PONAB RecName: Full=Haloacid dehalogenase-like hydrolase
  179::222     4e-05  49%  259 aa  HDHD2_HUMAN RecName: Full=Haloacid dehalogenase-like hydrolase
  179::222     4e-05  51%  262 aa  HDHD2_DANRE RecName: Full=Haloacid dehalogenase-like hydrolase
   94::187     4e-05  29%  221 aa  5NTD_PSEAE RecName: Full=5'-nucleotidase;       
   90::177     6e-05  30%  215 aa  PPAX_ANOFW RecName: Full=Pyrophosphatase ppaX;         EC=3.6.1.1;
  208::355     6e-05  30%  381 aa  KCRM_RABIT RecName: Full=Creatine kinase M-type;       
  208::355     6e-05  30%  381 aa  KCRM_PIG RecName: Full=Creatine kinase M-type;       
  208::355     6e-05  30%  381 aa  KCRM_HUMAN RecName: Full=Creatine kinase M-type;       
  208::355     6e-05  30%  381 aa  KCRM_BOVIN RecName: Full=Creatine kinase M-type;       
  179::222     6e-05  47%  259 aa  HDHD2_BOVIN RecName: Full=Haloacid dehalogenase-like hydrolase
   30::148     6e-05  37%  182 aa  GMHB_HAEDU RecName: Full=D,D-heptose 1,7-bisphosphate phosphatase; 
  149::187     7e-05  44%  241 aa  GPH_RHORT RecName: Full=Phosphoglycolate phosphatase;       
  208::355     1e-04  29%  381 aa  KCRM_CANFA RecName: Full=Creatine kinase M-type;       
   95::187     1e-04  27%  232 aa  GPH_YERPS RecName: Full=Phosphoglycolate phosphatase;       
   95::187     1e-04  27%  232 aa  GPH_YERPE RecName: Full=Phosphoglycolate phosphatase;       
   97::189     1e-04  26%  234 aa  GPH_PHOLL RecName: Full=Phosphoglycolate phosphatase;       
   80::181     2e-04  34%  211 aa  SERB_METJA RecName: Full=Phosphoserine phosphatase;       
   87::181     2e-04  26%  216 aa  P1254_THEMA RecName: Full=Phosphorylated carbohydrates phosphatase
   81::139     2e-04  31%  189 aa  HDHD3_XENTR RecName: Full=Haloacid dehalogenase-like hydrolase
  160::204     2e-04  40%  234 aa  PGP_THESM RecName: Full=Phosphoglycolate phosphatase;       
   71::185     3e-04  33%  221 aa  YIEH_ECOLI RecName: Full=Phosphatase yieH;         EC=3.1.3.-;
  103::189     3e-04  29%  263 aa  PHNX_BACFR RecName: Full=Phosphonoacetaldehyde hydrolase;       
  103::189     3e-04  29%  263 aa  PHNX_BACFN RecName: Full=Phosphonoacetaldehyde hydrolase;       
  108::210     3e-04  33%  232 aa  MTNC_XANAC RecName: Full=Enolase-phosphatase E1;       
  101::208     3e-04  26%  227 aa  MTNC_PERMH RecName: Full=Enolase-phosphatase E1;       
  124::191     3e-04  29%  230 aa  GPH_PSYA2 RecName: Full=Phosphoglycolate phosphatase;       
  130::253     4e-04  34%  291 aa  Y2257_MYCBO RecName: Full=Uncharacterized protein Mb2257;
  130::253     4e-04  34%  291 aa  Y2232_MYCTU RecName: Full=Uncharacterized protein Rv2232/MT2292;
  108::210     4e-04  32%  232 aa  MTNC_XANCP RecName: Full=Enolase-phosphatase E1;       
  108::210     4e-04  32%  232 aa  MTNC_XANCB RecName: Full=Enolase-phosphatase E1;       
  108::210     4e-04  32%  232 aa  MTNC_XANC8 RecName: Full=Enolase-phosphatase E1;       
  163::235     5e-04  42%  239 aa  PGP_PYRKO RecName: Full=Phosphoglycolate phosphatase;       
  100::200     5e-04  33%  229 aa  MTNC_ENT38 RecName: Full=Enolase-phosphatase E1;       
  179::222     5e-04  44%  259 aa  HDHD2_RAT RecName: Full=Haloacid dehalogenase-like hydrolase
  179::222     5e-04  44%  259 aa  HDHD2_MOUSE RecName: Full=Haloacid dehalogenase-like hydrolase
  160::191     6e-04  50%  231 aa  PGP_PYRFU RecName: Full=Phosphoglycolate phosphatase;       
  160::204     6e-04  45%  233 aa  PGP_PYRAB RecName: Full=Phosphoglycolate phosphatase;       
   98::199     6e-04  32%  227 aa  GPH_NITMU RecName: Full=Phosphoglycolate phosphatase;       
  927::1029    6e-04  32% 1065 aa  CARB_BACCL RecName: Full=Carbamoyl-phosphate synthase
  100::200     8e-04  32%  229 aa  MTNC_CITK8 RecName: Full=Enolase-phosphatase E1;       
  996::1155    8e-04  27% 1174 aa  KCRF_STRPU RecName: Full=Creatine kinase, flagellar;       
  100::189     8e-04  31%  227 aa  GPH_THIDA RecName: Full=Phosphoglycolate phosphatase;       
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLETALGLWREFHR
HDHD3_BOVIN     -LRLLTWDVKDTLLRLRHPVGVEYATKARGLEVEGQAFKQAYKAQSQSFPNYGLGHGL-TSHQWWLDLVQ
HDHD3_MOUSE     -MRLLTWDVKDTLIKLRR-----PVGEEYASKARAHVEQAFRQAYRAQSHNFPNSRGL-TSRQWWKDLHT
HDHD3_HUMAN     -IRLLTWDVKDTLLRLRH-----PLGEAYATKARAEVEPSALESFPNYGLSHLTSRQLDVVL---QTFH-
HDHD3_XENLA     ----------------------------------------------------------------------
HDHD3_DANRE     --------------------------------------------------NYGRAQGMDSQVW-WTGLVR
Y1777_PYRFU     ----------------------------------------------------------------------
Y1655_PYRHO     ----------------------------------------------------------------------
Y209_METTH      ----------------------------------------------------------------------
REG2_DROME      --RLITFDVTNTLL----QFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKGRDTNPQME-WQQWWR
GPH_AQUAE       ----------------------------------------------------------------------
GPH1_PSEAE      ----------------------------------------------------------------------
ACD10_HUMAN     --RAVIFDMGGVLIPSPGR--VAAEWEVQNRIPSGTILKALMEG----GENGPWMRFMRTAEGFLREFGR
Y970_METKA      MIKAVLFDVDDTLYPSSKL-----AEEARRNAIRAMI-EAGLETDLSEEELYRELQEVVKEYGSNHPRHF
YB10_PYRAB      ----------------------------------------------------------------------
HAD4_BURCE      ----------------------------------------------------------------------
GPH_RHOSH       ----------------------------------------------------------------------
GPH_RHOSK       ----------------------------------------------------------------------
GPH_RHOS4       ----------------------------------------------------------------------
GPH_RHOS1       ----------------------------------------------------------------------
GPH_PSEPU       ----------------------------------------------------------------------
PPAX_CLOPE      ----------------------------------------------------------------------
GPH_RHILO       ----------------------------------------------------------------------
GPH_PSEPK       ---------------------------------------------------------------------R
GPH_NEIMA       -VQAVAFDLDGTLCDSVPDLXXXXMLEQLGMKP-------------------LPAKVVESYVGIGKLVHR
GPH_VIBVY       -----------------------------------------------------------------RALSQ
GPH_PSEF5       ----------------------------------------------------------------------
PPAX_BACHD      ----------------------------------------------------------------------
GPH_PSEPF       ----------------------------------------------------------------------
DEH2_MORSB      ----------------------------------------------------------------------
HYES_RAT        ----------------------------------------------------------------------
YSAA_BACSU      ----------------------------------------------------------------------
GPH_SHIBS       -IRGVAFDLDGTLVDSAP-----------GLAAAVDMALYALELPVAGEERVINGADMERALAWARQERA
YJJG_ECOLI      ----------------------------------------------------------------------
YJJG_ECO57      ----------------------------------------------------------------------
GPH_SHISS       ----------------------------------------------------------------------
GPH_SHIFL       ----------------------------------------------------------------------
GPH_SHIDS       ----------------------------------------------------------------------
GPH_PASMU       ----------------------------------------------------------------------
GPH_ECOLI       ----------------------------------------------------------------------
GPH_ECOL6       ----------------------------------------------------------------------
GPH_ECO57       ----------------------------------------------------------------------
GPH_VIBVU       -----------------------------------------------------------------RALSQ
HAD1_PSEUC      -IRACVFDAYGTLLDVNTAV----------MKHAHDIGGCAEELSSLWRQRQLEYSWTRTLMGRYADFWQ
GPH_VIBCH       ----------------------------------------------------------------------
GPH_NEIG1       -VQAVAFDLDGTLCDSVPDLXXXXMLEQLGMKP-------------------LPAKVVESYVGIGKLVHR
GPH_KLEAE       -IRGIAFDLDGTLVDSAP-----------GLTSAVDNALYALELPVAGEERVINGADMERALTWARQERA
GPH_HAEI8       ----------------------------------------------------------------------
HAD9_PSEPU      ---------------------------------------------RLWRQKQLEYTWLSSLMGRYASFEQ
GPH_VIBPA       ----------------------------------------------------------------------
ACD10_MOUSE     ----------------------------------------------------------------------
YIHX_SHIFL      ---------------------------------------------------------LKKSFHMGEAFHQ
YIHX_ECOLI      ---------------------------------------------------------LKKSFHMGEAFHQ
PPAX_BACSU      ----------------------------------------------------------------------
HYES_HUMAN      ----------------------------------------------------------------------
GPH_AGRT5       ----------------------------------------------------------------------
PGMB_ECOLI      ----------------------------------------------------------------------
GPH_RHOS5       ----------------------------------------------------------------------
GPH_HAEIN       ----------------------------------------------------------------------
PPAX_BACA2      ----------------------------------------------------------------------
GPH_RHOCA       MAPALIFDLDGTLIDSAPAIHKVSVLRARGYAPLG------LDQIRSF-------------VGQGAPHLV
HYES_MOUSE      ----------------------------------------------------------------------
YIGB_SHIFL      ----------------------------------------------------------------------
YIGB_ECOLI      ----------------------------------------------------------------------
Y1437_METJA     ----------------------------------------------------------------------
PPAX_BACC0      ----------------------------------------------------------------------
GPH_VIBF1       ----------------------------------------------------------------------
GPH_COLP3       ----------------------------------------------------------------------
YRFG_SHIFL      ----------------------------------------------------------------------
YRFG_ECOLI      ----------------------------------------------------------------------
PPAX_BACCR      ----------------------------------------------------------------------
PPAX_BACC2      ----------------------------------------------------------------------
PGMB_LACLA      ----------------------------------------------------------------------
GPH_NITOC       ----------------------------------------------------------------------
GPHC_RALEH      ---------------------------------------------------------------------R
PPAX_THETN      ----------------------------------------------------------------------
PPAX_BACP2      ----------------------------------------------------------------------
GPH_PHOPR       ----------------------------------------------------------------------
GPH_MANSM       ----------------------------------------------------------------------
YNIC_ECOLI      ----------------------------------------------------------------------
YNIC_ECO57      ----------------------------------------------------------------------
YFGS_LACCA      ----------------------------------------------------------------------
PPAX_BACWK      ----------------------------------------------------------------------
HYES_PIG        ----------------------------------------------------------------------
HAD_PSEUY       ----------------------------------------------------------------------
GPH_PSE14       ----------------------------------------------------------------------
GPHP_RALEH      ----------------------------------------------------------------------
CBBY_RHOSH      ------------------------------------------------EELHRRANETFAALGVWREEYR
PPAX_BACHK      ----------------------------------------------------------------------
PPAX_BACCZ      ----------------------------------------------------------------------
PPAX_BACCQ      ----------------------------------------------------------------------
PPAX_BACC7      ----------------------------------------------------------------------
PPAX_BACC4      ----------------------------------------------------------------------
PPAX_BACC3      ----------------------------------------------------------------------
PPAX_BACAN      ----------------------------------------------------------------------
PPAX_BACAH      ----------------------------------------------------------------------
PPAX_BACAC      ----------------------------------------------------------------------
PPAX_BACAA      ----------------------------------------------------------------------
NANP_RAT        ----------------------------------------------------------------------
NANP_MOUSE      ----------------------------------------------------------------------
GPH_ERWCT       ----------------------------------------------------------------------
GPH_CAUCR       ----------------------------------------------------------------------
YHCW_BACSU      ----------------------------------------------------------------------
LHPP_XENLA      ----------------------------------------------------------------------
PPAX_BACC1      ----------------------------------------------------------------------
NANP_HUMAN      -VRAVFFDLDNTLI------------DTAGASRRGEVIKLLQSKYHYKEEAEIICDKVQVKLSK-ECFHN
GPH_PSESM       ----------------------------------------------------------------------
PPAX_LISMO      ----------------------------------------------------------------------
PPAX_LISMH      ----------------------------------------------------------------------
PPAX_LISMF      ----------------------------------------------------------------------
PPAX_LISMC      ----------------------------------------------------------------------
PPAX_LISIN      ----------------------------------------------------------------------
PPAX_OCEIH      ----------------------------------------------------------------------
PGMB_BACSU      ----------------------------------------------------------------------
P845_THEAC      ----------------------------------------------------------------------
GPH_PSEU2       ----------------------------------------------------------------------
YQAB_ECOLI      ----------------------------------------------------------------------
HAD2_PSEUC      ----------------------------------------------------------------------
GPH_XYLFA       ----------------------------------------------------------------------
YFP5_SCHPO      ----------------------------------------------------------------------
PPAX_LISW6      ----------------------------------------------------------------------
GPH_XANCP       ----------------------------------------------------------------------
GPH_XANC8       ----------------------------------------------------------------------
GPH_XYLFT       ----------------------------------------------------------------------
SERB_ARCFU      ------------------------------------------------EVSKLTERAMRGEIGFKEALEE
HDHD2_PONAB     ----------------------------------------------------------------------
HDHD2_HUMAN     ----------------------------------------------------------------------
HDHD2_DANRE     ----------------------------------------------------------------------
5NTD_PSEAE      ----------------------------------------------------------------------
PPAX_ANOFW      ----------------------------------------------------------------------
KCRM_RABIT      ------------------------------------------------------ARDWPDARGIWHNDNK
KCRM_PIG        ------------------------------------------------------ARDWPDARGIWHNDNK
KCRM_HUMAN      ------------------------------------------------------ARDWPDARGIWHNDNK
KCRM_BOVIN      ------------------------------------------------------ARDWPDARGIWHNDNK
HDHD2_BOVIN     ----------------------------------------------------------------------
GMHB_HAEDU      ----------------------------------------------------------------------
GPH_RHORT       ----------------------------------------------------------------------
KCRM_CANFA      ------------------------------------------------------ARDWPDARGIWHNDNK
GPH_YERPS       ----------------------------------------------------------------------
GPH_YERPE       ----------------------------------------------------------------------
GPH_PHOLL       ----------------------------------------------------------------------
SERB_METJA      ----------------------------------------------------------------------
P1254_THEMA     ----------------------------------------------------------------------
HDHD3_XENTR     ----------------------------------------------------------------------
PGP_THESM       ----------------------------------------------------------------------
YIEH_ECOLI      ----------------------------------------------------------------------
PHNX_BACFR      ----------------------------------------------------------------------
PHNX_BACFN      ----------------------------------------------------------------------
MTNC_XANAC      ----------------------------------------------------------------------
MTNC_PERMH      ----------------------------------------------------------------------
GPH_PSYA2       ----------------------------------------------------------------------
Y2257_MYCBO     ----------------------------------------------------------------------
Y2232_MYCTU     ----------------------------------------------------------------------
MTNC_XANCP      ----------------------------------------------------------------------
MTNC_XANCB      ----------------------------------------------------------------------
MTNC_XANC8      ----------------------------------------------------------------------
PGP_PYRKO       ----------------------------------------------------------------------
MTNC_ENT38      ----------------------------------------------------------------------
HDHD2_RAT       ----------------------------------------------------------------------
HDHD2_MOUSE     ----------------------------------------------------------------------
PGP_PYRFU       ----------------------------------------------------------------------
PGP_PYRAB       ----------------------------------------------------------------------
GPH_NITMU       ----------------------------------------------------------------------
CARB_BACCL      ------------------------------------------------------------ASGIHIQPHG
MTNC_CITK8      ----------------------------------------------------------------------
KCRF_STRPU      ------------------------------------------------------ARDWPQGRGIWHNDEK
GPH_THIDA       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLAVVSNWDATLPEILEVVGLGR
HDHD3_BOVIN     QTFHQAGVRD-AQAIAEQLYKDFSSPSTWQVLEGAEATLRGCRKRGLKLAVVSNFDRRLEDILEGVGLRE
HDHD3_MOUSE     FRLAGVPDAQAMTPVADQLYEDFSSPFTWQVLEGAEMTLKGCRKRGLKLAVVSNFDRRLEDILTGLGLRE
HDHD3_HUMAN     --LAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDXXXXXXXXXXXXXX
HDHD3_XENLA     --LSGIEDSDTVQSLAKQLYQDFSTAHNWALVPGAREALDSCTNLGLRMAVISNFDXXXXXXXXXXXXXX
HDHD3_DANRE     DTFGQCGVHDPADKLANNLYHNFCGPENWEVFSDSNSTLKSCTALGLKQGVVSNFDRRLEGILRGCGLLT
Y1777_PYRFU     -------------------------------VPGARKTLLRLKKEGYMTGIITDGNPIKQEKILRLELDD
Y1655_PYRHO     -------------------------------VPGARKVLIRLKELGYELGIITDGNPVKQEKILRLELDD
Y209_METTH      --------------------------------PNTTSTLIDLKSKGYRLGVISN-GITIKQWEKLIRLGH
REG2_DROME      KLIAGTFAESGAAIFSNHLIELYKTSICWQPCNGSVELLKELKPEKCKLGVIANFDPRLPTLLQNTKLDQ
GPH_AQUAE       --------------------------------PEIPYTLEALKSKGFKLAVVSNLEELSKKILDILNLSG
GPH1_PSEAE      ----GIGEEETEAALALFMEAYADSHALTEVYPGVVDTLKWLKRNGVEMALITNKERFVAPLLDEMKLGR
ACD10_HUMAN     MLKTSVPVDSFFSLLTSERVAK-----QFPVMTEA---ITQIRAKGLQTAVLSN-NFYLPNQKSFLPLDR
Y970_METKA      DLLLRRIGADPEPKLVAAAVVAYHDTKFAYLKPYPDVTLMQLREMGFKLGAVTSGLAVKQEKLIRLGIHH
YB10_PYRAB      -------------------------------VPGARKVLIRLRELGYRLGIITDGNPVKQEKILRLEIDD
HAD4_BURCE      -------LEDR-KGLKDRLMSAYKELSAYP---DAAETLEKLKSAGYIVAILSNGDEMLQAALKASKLDR
GPH_RHOSH       -----------AELQGRFMAHYEADPATLTSVPGAEAAIRHLRAEGWRIGLCTNKPVGASQILSLFGLLE
GPH_RHOSK       -----------AELQGRFMAHYEADPATLTSVPGAEAAIRHLRAEGWRIGLCTNKPVGASQILSLFGLLE
GPH_RHOS4       -----------AELQGRFMAHYEADPATLTSVPGAEAAIRHLRAEGWRIGLCTNKPVGASQILSLFGLLE
GPH_RHOS1       -----------AELQGRFMAHYEADPATLTSVPGAEAAIRHLRAEGWRIGLCTNKPVGASQILSLFGLLE
GPH_PSEPU       ----GLALFMEAYAQSHELTV---------VYPGVKDTLRWLQKQGVEMALITNKERFVAPLLDQMKIGR
PPAX_CLOPE      --------------------------------------LKTLKSKGIKIGVVTSKKSDMAERAKLMGIFK
GPH_RHILO       --------------------------------PGVIEAIARFEKAGYLLAICTNYEANSLALIEALGLTR
GPH_PSEPK       ALAGGIDHADVDDALAEQALALFMDAYAESVYPGVRDTLRWLRKQGVEMALITNKERFVGPLLDQMKIGN
GPH_NEIMA       VLTNDRDREADSELWEKGFVSYMKSVFTRPY-PETEAGLALLKSLGIPLAVITNKNEILAELLKQLGLAD
GPH_VIBVY       SLTINPELSDELRAQARELFDDFYQQTGHKLYPTVKETLKALHQAGFTLALVTNKPSKVPDVLQQHGIAD
GPH_PSEF5       --------------------------------PGARETLKWLHKQGVEMALITNKERFVAPLLDQMKIGR
PPAX_BACHD      ---------------------------------GVYETVKTLHEQGFKLAIVTTKRETAMKGLKLFGLDE
GPH_PSEPF       --------------------------------PGVRDTLKWLHKQGVAMALITNKERFVAPLLDQMKIGR
DEH2_MORSB      --------------------------------PEVRGALRALRQRGMRLAILSNGSTTIHDVVHNSGVEG
HYES_RAT        ----------------------------------------ALKKKGFTTCIVTNWDSDKRDILAMCELSQ
YSAA_BACSU      ------------------------------------AVLDQLKGK-YELLLLTNGDPSLQKLAGVPELAP
GPH_SHIBS       TLRKTMGVDDDIPAILRKLFDRYYSEVAEELFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
YJJG_ECOLI      -------------------------------LPGAVSLLNAIRGNA-KIGIITNGFSALQQVLERTGLRD
YJJG_ECO57      -------------------------------LPGAVSLLNAIRGNA-KIGIITNGFSALQQVLERTGLRD
GPH_SHISS       ------------------------------LFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
GPH_SHIFL       ------------------------------LFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
GPH_SHIDS       ------------------------------LFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
GPH_PASMU       ------------------------------LYPNVKSTLETLKQKGYLLAVVTNKPTKVQPVLQAFGIDH
GPH_ECOLI       ------------------------------LFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
GPH_ECOL6       ------------------------------LFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
GPH_ECO57       ------------------------------LFPHVADTLGALQAKGLPLGLVTNKPTPVAPLLEALDIAK
GPH_VIBVU       SLTINPELSDELRAQARELFDDFYQQTGHKLYPTVKETLKELHQAGFTLALVTNKPSKVPDVLQQHGIAD
HAD1_PSEUC      LTLESFGLLERTDLKNRLLDAYHELSA----YPDAVGTLGALKAAGFTTAILSNGNEMLRGALRAGNLTE
GPH_VIBCH       ------------------------------LYPNVKTTLLELHQAGFILALVTNKPSKVPDVLEQHGIAH
GPH_NEIG1       VLTNDRDREADSELWEKGFVSYMKSVFTRPY-PETEAGLALLKSLGIPLVIITNKNEILAELLKQLGLAD
GPH_KLEAE       TLRAAMGKQDEQLRILRKLFDRYYAEAAEELFPAVADTLGALHAKGLPLALITNKPTPVAPLLDALDIAK
GPH_HAEI8       ------------------------------LYPNVKETLETLKEKGYVLAVVTNKPTRVQPVLAAFGI--
HAD9_PSEPU      RTEEALRYTKHLGLATDETTLRQLGQAYLHLAPHPDTTLRRLKASGLPMAIASNGSHSIEQVVSHSDMGW
GPH_VIBPA       ------------------------------LYPTVKETLEELHQAGFTMALVTNKPSKVPEILEQHGIAK
ACD10_MOUSE     --------------------------------PVMTQAISQIRAKGLQTAVLTN-NFHLSSGESFLPLDR
YIHX_SHIFL      HERGEISDEAFAEALCHEMLSYEQFSHGWQAVPEVIAIMHKLREQGHRVVVLSNWPEEYPEIRDAA----
YIHX_ECOLI      HERGEISDEAFAEALCHEMLSYEQFSHGWQAVPEVIAIMHKLREQGHRVVVLSNWPEEYPEIRDAA----
PPAX_BACSU      -------------------------------------TLDALKKAGFTLGIVTTLRDTVNMGLKLTGIGE
HYES_HUMAN      -----------------------------------------LRKKGFTTAILTN--TWLDDRAERDGLAQ
GPH_AGRT5       --------------------------------PGIIETLDALSQAGITLAVCTNKTEILAPLLEKLGLTR
PGMB_ECOLI      ------------------------------VLPGIRSLLADLRAQQISVGLASV-SLNAPTILAALELRE
GPH_RHOS5       ----------HAEMQDRFMKHYEADPALTSVYPGAEAALRHLHSEGWRIALCTNKPAASRQILSNFGILD
GPH_HAEIN       ------------------------------LYPNVKETLEILKEKGYVLAVVTNKPTRVQPVLAAFGI--
PPAX_BACA2      ------------------------------------------KKAGYQLGIVTTLRDTVNMGLKLTGIGA
GPH_RHOCA       RCLLTTAGEDPEDAIYADLVSRYEDVEGNTLYPGVITALQRLREMGCPMAITTNYKPALAAIAH-VGLTD
HYES_MOUSE      ----------------------------------------ALKKKGFTTCIVTNWDGDKRDSLAMCELSQ
YIGB_SHIFL      --------------------AKWRSRIDVP--QQTHDTLKQL-AKKWPLVAITNGNAQ-PELF---GLGD
YIGB_ECOLI      --------------------AKWRSRIDVP--QQTHDTLKQL-AKKWPLVAITNGNAQ-PELF---GLGD
Y1437_METJA     --------------------------------PHTIKTLMELKAMGLKLGVITD-GLTIKQWEKLIRLGP
PPAX_BACC0      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
GPH_VIBF1       ------------------------------LYPDVKDTLERLHQQGYTLALVTNKPSQVPELLEQHQLTH
GPH_COLP3       --------------------------------------LLSLKAAGFRLAIITNKPAIIQPILTGLGIDN
YRFG_SHIFL      --------------------------------------LEALKASGKQRILLTNAHPNLAVKLEHTGLDA
YRFG_ECOLI      --------------------------------------LEALKASGKQRILLTNAHPNLAVKLEHTGLDA
PPAX_BACCR      ------------------------------------------KKQGYKVGIVTTKARQTVEMLQLSKLDE
PPAX_BACC2      ------------------------------------------KKQGYKVGIVTTKARQTVEMLQLSKLDE
PGMB_LACLA      -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLEKMNLTG
GPH_NITOC       ------------------------------LYPGVNEGLAWLKSQGYRVGCVTNKAATYPLLTEL-GIID
GPHC_RALEH      RVLETAGLTPRVEAA--EAVAMFHNGRLGSVFPGVEAGLEALRRQGYRLACVTNKPRALAPLLALTGLSQ
PPAX_THETN      --------------------------------------LARLKEEGIKTAVVTSKRRELAKRLKLFELDK
PPAX_BACP2      -------------------------------------TLKVLQDRGFKLGIVTTKIRTVLMGLKLTGLEP
GPH_PHOPR       ------------------------------LYAGVKETLAAFHQANIPMAIVTNKPAQVPHLLEQHGISE
GPH_MANSM       ------------------------------LYPNVKETLETLKEQGFILAVVTNKPTRVQPVLKAFAI--
YNIC_ECOLI      ---------------------------TRPLLPGVREAVALCKEQGLLVGLASASPLMLEKVLTMFDLRD
YNIC_ECO57      ---------------------------TRPLLPGVREAVALCKEQGLLVGLASASPLMLEKVLTMFDLRD
YFGS_LACCA      ------------------------------VLPGADKTLQTLDQMGYRLALTSSAKHYVDVVLAATGWVK
PPAX_BACWK      ------------------------------------------KKQGYKIGIVTTKARQTVEMLKLSKLDQ
HYES_PIG        --------------------------------PMLQAAL-TLKKKGFSTCILTNWSAQRGSRAQLMELRP
HAD_PSEUY       ------------------------------LAPFSEVSLRELKRRGLKLAILSNGSPSIDAVVSHAGLRD
GPH_PSE14       --------------------------------PGVRETLKWLQKMGVEMALITNKERFVAPLLDEMKLGR
GPHP_RALEH      --------------------------------PGVEAGLAALRRQGYRLACVTNKPRALAPLLALTGLSQ
CBBY_RHOSH      ELLTTTGGK---ERIARFLRHQKGDPAPLPIAPGIADLIAEAKRAGIRLAVATTTSLPNVEALCRACFGH
PPAX_BACHK      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACCZ      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACCQ      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACC7      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACC4      ------------------------------------------KRQGYKVGIVTTKARQTVEMLQLSKLDE
PPAX_BACC3      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACAN      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACAH      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACAC      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
PPAX_BACAA      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKLSKLDE
NANP_RAT        --------------LAEECYFLWKSTRLMTLEEDVKAMLTELR-KEVRLLLLTNGDRTQREKIEACACQS
NANP_MOUSE      --------------LAEECYFLWKSTRLQHMIDDVKAMLTELR-KEVRLLLLTNGDRTQREKIEACACQS
GPH_ERWCT       -------------------------------------TLAQLAQQGVPMAVVTNKPTPVAPLLAGLGIGD
GPH_CAUCR       --------------------------------PGVVEVLSDLKTAGAKLVVCTNKLTNLSTLLDAVALSP
YHCW_BACSU      --------------------------------PGVEAYLNAAKDLGLKIGLASSSDYKVSGHLKQIGLFD
LHPP_XENLA      ----------------------------------------------------------------------
PPAX_BACC1      ------------------------------------------KKQGYKVGIVTTKARQTVEMLKFSKLDE
NANP_HUMAN      TCITDLRTSHWEEALAEECYFLWKSTRLMTLAEDVKAMLTELR-KEVRLLLLTNGDRTQREKIEACACQS
GPH_PSESM       --------------------------------PGVRETLKWLQKMGVEMALITNKERFVAPLLDEMKLGR
PPAX_LISMO      ---------------------------------GVYEAIRALYEEDYKLGIVSTYD-TIMRGLKVTGLDK
PPAX_LISMH      ---------------------------------GVYEAIRALYEEDYKLGIVSTYD-TIMRGLKVTGLDK
PPAX_LISMF      ---------------------------------GVYEAIRALYEEDYKLGIVSTYD-TIMRGLKVTGLDK
PPAX_LISMC      ---------------------------------GVYEAIRALYEEDYKLGIVSTYD-TIMRGLKVTGLDK
PPAX_LISIN      ---------------------------------GVYEAIRALYEEDYKLGIVSTYD-TIMRGLKVTGLDK
PPAX_OCEIH      --------------------------------PHVYDTLEELQNRNISLGIVSTMRHTVHMGLELTGISK
PGMB_BACSU      ------------------------------LLPGIGRLLCQLKNENIKIGLASS-SRNAPKILRRLAIID
P845_THEAC      -------------------------------------TLAELRKRGIKTAVVTS---TRRIVMQKFSL--
GPH_PSEU2       --------------------------------PGVRETLKWLQKMGVEMALITNKERFVAPLLDEMKLGR
YQAB_ECOLI      -----------------------------------------------PMAVGTGSESAIAELLAHLGLRH
HAD2_PSEUC      ------------------------------------SALESLRSGAVPLAILSNGSASIQSVVGNAGIEH
GPH_XYLFA       ---------------------------------GVEMMLDALECAGTVWGIVTNKPEFLARILPLLGWTS
YFP5_SCHPO      ----------------------------------------------YIIGIISNTDERIRTVLEDYGIDH
PPAX_LISW6      ---------------------------------GVYEAIRVLYEEDYKLGIVSTYD-TIMRGLKVTGLDK
GPH_XANCP       ------------------------------LFDGVEVMLQRLEQAGCVWGIVTNKPEYLAQILPQLGWQQ
GPH_XANC8       ------------------------------LFDGVEVMLQRLEQAGCVWGIVTNKPEYLAQILPQLGWQQ
GPH_XYLFT       ---------------------------------GVEMMLHALECAGTVWGIVTNKPEFLARILPLLGWTS
SERB_ARCFU      RVRLLKGLP--VEVLER-IYSRIK------LTEGAKELVRSLKEAGYKVAVVSGGFSYFTDRLEELGLDY
HDHD2_PONAB     ----------------------------------------------------------------------
HDHD2_HUMAN     ----------------------------------------------------------------------
HDHD2_DANRE     ----------------------------------------------------------------------
5NTD_PSEAE      ---------------------------------GIPELLEALVGRGHTLYVATSKPGVFAEIARHFAFDR
PPAX_ANOFW      -------------------------------------TVQTLHEKGFKLGIVTTKIRTVNMGLKLTKLDS
KCRM_RABIT      SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNEHLGYVLTCLGTGR
KCRM_PIG        SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNEHLGYVLTCLGTGR
KCRM_HUMAN      SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNQHLGYVLTCLGTGR
KCRM_BOVIN      SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNEHLGYVLTCLGTGR
HDHD2_BOVIN     ----------------------------------------------------------------------
GMHB_HAEDU      -------------------------------IEGVGKALKQLQDKGYLLVLVTNWDWSLDEDYGVVLDGI
GPH_RHORT       ----------------------------------------------------------------------
KCRM_CANFA      TFLVWVNEEDHLRVISMQKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNEHLGYVLTCLGTGR
GPH_YERPS       ------------------------------LFPQVKATLAQLAANGLPIGLITNKPTPVAPLLTSLGIAD
GPH_YERPE       ------------------------------LFPQVKATLAQLAANGLPIGLITNKPTPVAPLLTSLGISD
GPH_PHOLL       ------------------------------LFPEVKVTLAELAKHNLPMGIITNKPTPIAPLLASLDISE
SERB_METJA      ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
P1254_THEMA     --------------------------------PGVREALEFVKSKRIKLALATSTQXXXXXXXXXXXXXK
HDHD3_XENTR     --LSGAEDDETVRSVAQQLYQDFSTARNWAVVPGAREALDSCKGLGLKMAVISNFDRRLEE---------
PGP_THESM       ----------------------------------------------------------------------
YIEH_ECOLI      -----------AEHVYRAEVARLFD-SELEAIEGAGALLSAITA---PMCVVSNGPNN--KMQHSMGKLN
PHNX_BACFR      -------------------------------IPGVIPTLEKLRAEGLKIGSTTGYTREMMDVVEAQAKGY
PHNX_BACFN      -------------------------------IPGVIPTLEKLRAEGLKIGSTTGYTREMMDVVEAQAKGY
MTNC_XANAC      ----------------------------------AAIQLKAWHAAGIPLYVYSSGSVPAQKL--------
MTNC_PERMH      -----------------------------PVYEDAYRKLKEWKEKNIPMYIYSSGSVKAQKL--------
GPH_PSYA2       ----------------------------------------------------------VPKILQFFGWHD
Y2257_MYCBO     --LRAMGLGESAEAYRADYSARW---AMNSLFDGIGPLLADLRTAGVRLAVASKAEPTARRILRHFGIEQ
Y2232_MYCTU     --LRAMGLGESAEAYRADYSARW---AMNSLFDGIGPLLADLRTAGVRLAVASKAEPTARRILRHFGIEQ
MTNC_XANCP      ----------------------------------AAIQLQAWHAEGIPLYVYSSGSVPAQKL--------
MTNC_XANCB      ----------------------------------AAIQLQAWHAEGIPLYVYSSGSVPAQKL--------
MTNC_XANC8      ----------------------------------AAIQLQAWHAEGIPLYVYSSGSVPAQKL--------
PGP_PYRKO       ----------------------------------------------------------------------
MTNC_ENT38      ---------------------------TGQLYPDVLPALEKWKAQGIDLYVYSSGSVAAQKLLF-----G
HDHD2_RAT       ----------------------------------------------------------------------
HDHD2_MOUSE     ----------------------------------------------------------------------
PGP_PYRFU       ----------------------------------------------------------------------
PGP_PYRAB       ----------------------------------------------------------------------
GPH_NITMU       --------------------------------PGVREGLNALRAGGFRLACVTNKAETLP-LLRAAELLD
CARB_BACCL      AVLLTVADKDKEEAV--ELARRFADIGYQLLA--TNGTAETLKAAGIPVTVVNKIHSASPNILDVIRQGK
MTNC_CITK8      ---------------------------TGHLYPDVLPALEKWKAQGIDLYVYSSGSVAAQKLLF-----G
KCRF_STRPU      NFLVWVNEEDHTRVISMEKSGNMK-RVFERFCDGLKKVEDSIKSKGYQFM----WNEHLGYVLTCLGTGR
GPH_THIDA       ---------------------------------GVVEGLQAFKAMGLHMACITNKQFTVP-LLKGTGLYD


                         +         .         .         .         .         *         .:210
query           YFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGDAEADLLGAEAVGMRALLFDPLGENPKALPR
HDHD3_BOVIN     HFDFVLTSEAAGWPKPDPRIFHEALHLAQVEPAVGAHIGDSQRDYKGARAVGMHSFL-------------
HDHD3_MOUSE     HFDFVLTSEAVGCPKPDPRIFREALQRACVEPAVAAHVGDSYCDYQGSQAVGMHSFL-------------
HDHD3_HUMAN     HFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYCDYQGPRAVGMHSFL-------------
HDHD3_XENLA     YFDFVVTAESAGVAKPHLGIFHKALSLAKVPPHQAVHVGDDYVDYCAARMVGMHSYLI-----HPKTPPK
HDHD3_DANRE     HFSFIVTSEDARVAKPDPAIFSQALERCGVPASSVVHVGDHYVDYLTSRSLGIRGYLLN-----------
Y1777_PYRFU     FFEHVMISDFEGVKKPHPKIFKKALKAFNVKPEEAIMVGDLYSDIYGAKNVGMKTVWF------------
Y1655_PYRHO     FFEHVIISDFEGVKKPHPKIFKKALKAFNVKPEEALMVGDLYSDIYGAKRVGMKTVWF------------
Y209_METTH      FFDEVVTSDEVGFEKPNIRIFEEALRRMGCKPERSVMVGNKNEDILGATNAGMSAIL-------------
REG2_DROME      YLDFAINSYEVQAEKPDPQIFQKAMEKSGLKPEECLHIGDGTTDYLAAKELGWHSAL-------------
GPH_AQUAE       YFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTAL-------------
GPH1_PSEAE      YFRWIIGGDTLPQQKPDPAALLFVMKMAGIEPEDALFVGDSRNDVLAAKAAGVRALTYGPIAEEAPTLV-
ACD10_HUMAN     QFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTI---KVNDPETAVKE
Y970_METKA      FFHEVVISEEIGVEKPNPKIFIEAARRLGVKPEEAVYVGDLDKDIRGANRAGM-----------------
YB10_PYRAB      FFEHVIISDFEGVKKPHPKIFKKALKAFNVDAQEALMVGDLYSDIYGAKNVGMKTVWF------------
HAD4_BURCE      VLDSLSADDLKIY-KPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPE----
GPH_RHOSH       LFDAIIGGESLPQRKPDPAPLRATAAAL--NEEVVLYVGDSEVDAATAEAAGLRFALF------------
GPH_RHOSK       LFDAIIGGDSLPQRKPDPAPLRATAAAL--NEEVVLYVGDSEVDAATAEAAGLRFALF------------
GPH_RHOS4       LFDAIIGGDSLPQRKPDPAPLRATAAAL--NEEVVLYVGDSEVDAATAEAAGLRFALF------------
GPH_RHOS1       LFDAIIGGDSLPQRKPDPAPLRATAAAL--NEEVVLYVGDSEVDAATAEAAGLRFALF------------
GPH_PSEPU       YFRWMIGGDTLPQKKPDPAALLFVMQMAGVTPQQSLFVGDSRSDVLAAKAAGVQCV--------------
PPAX_CLOPE      YFDTFITPEITTKHKPDGEPVLKACENLGVSPSEALMVGDSPYDILGAKTCGVKALPLEKLGES------
GPH_RHILO       HFAAIAGQDTFAFRKPDPRHLTETIRLAGGDAHRALMVGDSQTDIDTAKAAGIPVVAVD-----------
GPH_PSEPK       FFRWIIGGDTLPQKKPDPAALLFVMQMAGVTPQQSLFVGDSRSDVQAAKAAGVQCV--------------
GPH_NEIMA       YFSLILGGDXXXXXXXXXXXXRHAAEVLGIDVANMVMVGDSRNDIIAAKAAG------------------
GPH_VIBVY       YF----VDVLGGDSKPNPIALNWLMEKHQIQPTEMLMVGDSKNDILAAKNAG------------------
GPH_PSEF5       YFRWIIGGDTLPQKKPDPAALFFVMKMASVPASQSLFVGDSRSDVLAAKAAGVKCVALSPIAEESPAL--
PPAX_BACHD      FFDVIVALDDVENVKPNPEPLEKAMNALGAKKEETIMVGDNSHDILGGKNAGVK----------------
GPH_PSEPF       YFKWIIGGDTLPQKKPDPAALFFVMKMSGIPASQSLFVGDSRSDVLAAKAAGVKCV--------------
DEH2_MORSB      EFEHLSVDSARAY-KPHPLAYELGEEAFGISRESILFVSSNPWDVSGAKAFGYQGFAFDELGQTP-----
HYES_RAT        HFDFLIESCQVGMIKPEPQIYKFVLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTIL---VRDTASALRE
YSAA_BACSU      YFNEIVISGAFGKGKPDVSIFEHCLKLMNIEKDDAIMVGDLNTDILGASRAGIKTV--------------
GPH_SHIBS       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
YJJG_ECOLI      YFDLLVISEEVGVAKPNKKIFDYALEQAG-NPDRSLMVGDAESDILGGINAGL-----------------
YJJG_ECO57      YFDLLVISEEVGVAKPNKKIFDYALEQAG-NPDRSLMVGDAESDILGGINAGL-----------------
GPH_SHISS       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
GPH_SHIFL       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
GPH_SHIDS       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
GPH_PASMU       LFSELLGGQSLPAIKPHPAPLYYLCGKFGLYPKQVLFVGDSKNDILAAHTAG------------------
GPH_ECOLI       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
GPH_ECOL6       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
GPH_ECO57       YFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAG------------------
GPH_VIBVU       YF----VDVLGGDSKPNPIALNWLMEKHQIQPTEMLMVGDSKNDILAAKNAG------------------
HAD1_PSEUC      ALDQISVDEIKIY-KPDPRVYQFACDRLDVRPSEVCFVSSNAWDIGGAGAFGFNTV--------------
GPH_VIBCH       FFSDVIGGDTFPNKKPDPMALNWLLEKHQLSAEQMLMVGDSKNDILAAKNAG------------------
GPH_NEIG1       YFSLILGGDXXXXXXXXXXXXRHAAEVLGIDAANMLMVGDSRNDIIAAKAAG------------------
GPH_KLEAE       YFTVVIGGDDVQNKKPHPEPLLLVAEKLSLAPAELLFVGDSRNDIQAAKAAG------------------
GPH_HAEI8       --DHLFSEMLGGQSKPHPAPLYYLCGKFGFEPRQVLFVGDSKNDIIAAHAAG------------------
HAD9_PSEPU      AFDHLISVETVKVFKPDNRVYSLAEQTMAIPRDRLLFVSSNSWDATGARHFGFQGAVFDELGATP-----
GPH_VIBPA       YF----VDVLGGDAKPNPVALNWLMEKHQVKASEMLMVGDSKNDILAAKNAG------------------
ACD10_MOUSE     QFDVVVESCLEGICKPDPRIFQLCLQRLSLQPSEAIFLDDLGSNLKVAASLGIHTIKVD---RPETAVKE
YIHX_SHIFL      --DHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSIL-------------
YIHX_ECOLI      --DHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSIL-------------
PPAX_BACSU      FFETVVTLDDVTNAKPDPEPVLLALKQLGSEPAEAIMVGDNYHDVLAGKNAGTK----------------
HYES_HUMAN      HFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTIL---VQDTDTALKE
GPH_AGRT5       YFAAITCGDTFAFRKPDARHILGTIEKAGGDVQRSIMVGDSINDILAA----------------------
PGMB_ECOLI      FFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSV--------------
GPH_RHOS5       LFDAIVGGDCLPQRKPDXXXXXXXXXXX--TEEVVLYVGDSEVDAATAEAAGLRFALF------------
GPH_HAEIN       --DHLFSEMLGGQSKPHPAPLYYLCGKFGFEPRQVLFVGDSKNDIIAGHAAG------------------
PPAX_BACA2      FFDTVVTLDDVKHPKPDPEPVRLALSRLGCDPSEAIMVGDNYHDVMAGKNAGTK----------------
GPH_RHOCA       YFQLVIGGDSLPTRKPNPEMVNEARRVL--RRPHALYIGDSEIDAQTAQNAGLPFVIY------------
HYES_MOUSE      HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTIL---VHNTASALRE
YIGB_SHIFL      YFEFVLRAGPHGRSKPFSDMYFLAAEKLNVPIGEILHVGDLTTDVGGAIRSGMQACWIRP----------
YIGB_ECOLI      YFEFVLRAGPHGRSKPFSDMYFLAAEKLNVPIGEILHVGDLTTDVGGAIRSGMQACWIRP----------
Y1437_METJA     FFDDVITSEEFGLGKPHLEFFKYGLKRMGLKAEETVYVGDVDKDIKPAKELGM-----------------
PPAX_BACC0      FFDVVVTIDDVEHVKPHPEPLQKALQLLGAKPEEALMVGDNHHDIVGGQNAGTK----------------
GPH_VIBF1       LFSEVIGGDTFAEKKPNPFALNWLLDKHGLTAPQMLMVGDSKNDIQAAQAAG------------------
GPH_COLP3       LFELLIGGDTLADKKPHPAPLHYAMKQLNVVAEQCVMIGDSKNDILAAKAANI-----------------
YRFG_SHIFL      HLDLLLSTHTFGYPKEDQRLWHAVAEATGLKAERTLFIDDSEAILDAAAQFGIRYCL-------------
YRFG_ECOLI      HLDLLLSTHTFGYPKEDQRLWHAVAEATGLKAERTLFIDDSEAILDAAAQFGIRYCL-------------
PPAX_BACCR      FFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACC2      FFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PGMB_LACLA      YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
GPH_NITOC       YFEIVISGDTLPEKKPHPAPLLHAASHFGIAPEKALMIGDSISDVKAARAANFQ----------------
GPHC_RALEH      YLEVLVAGDSIAQMKPDPEPLRHACNLLDV----------------------------------------
PPAX_THETN      YFDVLVGLEDTEKHKPEPDPVLKALELLKSPREEALMVGDSPYDILSARSAGVRSV--------------
PPAX_BACP2      FFEVIVTLDDVQNEKPHPEPVQLALSKLGSDPHEAVMVGDNYHDILSGQAAGTK----------------
GPH_PHOPR       YFVDVIGGDTFPLKKPDPFALHWLMEKHQLAACEMLMIGDSRNDILAAQA--------------------
GPH_MANSM       --DHLFSETLGGQSKPHPAPLYYLCGKFGLYPHQILFVGDSRNDILAAHSAGCTAV--------------
YNIC_ECOLI      SFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIV-------------
YNIC_ECO57      SFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIV-------------
YFGS_LACCA      RFDPILTGSDVTAHKPDPEIYHVMKTKLPETP--AIVVEDTHVGVAAAEGAGLPVVMIPGIGQGP-----
PPAX_BACWK      FFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEETLMVGDNHHDIVGGQNAGTKTV--------------
HYES_PIG        HFDFLIESCRVGMAKPDPQIYKLMLDTLKAEPNEVVFLDDVGTHLKPVRDLGMATIL---VRDTDTALRE
HAD_PSEUY       GFDHLSVDPVQVY-KPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCVFEEMGQTP-----
GPH_PSE14       FFRWIIGGDTMPQKKPDPAALFFVMKMAGVPASQALFVGDSRSD--------------------------
GPHP_RALEH      YLEVLVAGDSIAQMKPDPEPLRHACNLLDV----------------------------------------
CBBY_RHOSH      IFDVIAAGDMVAEKKPSPDIYRLALRELDVPPERAVALEDSLNGLRAAKGAGLRCIVSPGFYTRHEEFAG
PPAX_BACHK      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACCZ      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACCQ      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACC7      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACC4      FFDVVVTIDDVENVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACC3      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACAN      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACAH      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACAC      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
PPAX_BACAA      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
NANP_RAT        YFDAIVVGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTETDIQGGLNAGLKATVW------------
NANP_MOUSE      YFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTETDIQGGLNAGLKATVW------------
GPH_ERWCT       YFSLIIGGDDVIVKKPHPAPLYLVLGKLGLRASELLFVGDSRNDIQAAQAAGCRSV--------------
GPH_CAUCR       FFEAVIGADLAPAAKPDGRHXXXXXXXXGGDVSRAVMIGDSVNDALGARNAGVPGVL-------------
YHCW_BACSU      DFEVIQTADDVEEVKPNPELYLLAAKNLGVSPAECLAFEDSVNGSIAAKRAGMKCVI-------------
LHPP_XENLA      --------------KPSPNFFLSALEEMGAKPEEALMIGDIVHDIGGAKSCGLRAVL-------------
PPAX_BACC1      FFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTK----------------
NANP_HUMAN      YFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTETDIQGGLNAGLKATVW------------
GPH_PSESM       FFRWIIGGDTMPQKKPDPAALFFVMKMAGVPASQSLFVGDSRSD--------------------------
PPAX_LISMO      FFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDI-------------------------
PPAX_LISMH      FFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDI-------------------------
PPAX_LISMF      FFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDI-------------------------
PPAX_LISMC      FFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDI-------------------------
PPAX_LISIN      FFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDI-------------------------
PPAX_OCEIH      FFSTIITYDDVTHAKPHPEPVQMAMQKLGAHPEHTLMVGDNHHDIVSGQRANVQ----------------
PGMB_BACSU      DFHAIVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAV--------------
P845_THEAC      QVDHVVTIDDVSKGKPDPEPYLKALKMMGIPAEECIVVGDIENDLIPAK---------------------
GPH_PSEU2       FFRWIVGGDTMPQKKPDPAALFFVMKMAGAPASQSLFVGDSRSD--------------------------
YQAB_ECOLI      YFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCVVFEDADFGIQAARAAGMDAV--------------
HAD2_PSEUC      FFSHLISADEVSVSKPSPAAYELAEKRLKVVRSKLLFVSSNAWDASGARHFGFQVCTFEQLGERP-----
GPH_XYLFA       RCAVLIGGDTLAERKPHPLPLLTAAERIGVMPTDCVYVGDDVSDIQAARAAGMPSMV-------------
YFP5_SCHPO      LIDIYAFSYDVGFEKPSREIFEKAVKLLGIQPEECMHLGD------------------------------
PPAX_LISW6      FFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDI-------------------------
GPH_XANCP       RCAVLIGGDTLAERKPHPLPLLVAADRIGVAATQCVYVGDDERDILAARAAGM-----------------
GPH_XANC8       RCAVLIGGDTLAERKPHPLPLLVAADRIGVAATQCVYVGDDERDILAARAAGM-----------------
GPH_XYLFT       RCAVLIGGDTLAERKPHPLPLLTAAERIGVMPTDCVYVGDDVRDIQAARAAGMPSMV-------------
SERB_ARCFU      AFGNIENGRLTGRIKEKARIVEEIARKEGISPENVVAVGDGANDRLMIERAGL-----------------
HDHD2_PONAB     --------------KPEKTFFLEALRGTGCEPEEAVMIGDCRDDVGGAQDVGMLGIL-------------
HDHD2_HUMAN     --------------KPEKTFFLEALRGTGCEPEEAVMIGDCRDDVGGAQDVGMLGIL-------------
HDHD2_DANRE     --------------KPEKGFFLEALRDLNCSPEEAVMIGDARDDVGGAQNAGMLGIL-------------
5NTD_PSEAE      HFKAIYGSELDGTRTHKEELIRHLLDSEGLAAEHCLMIGDRMHDLLGASRNGVACI--------------
PPAX_ANOFW      FFKCVITLDDVEHAKPHPEPIEKALACLQAKPEETLMVGDNHHDILAGKHAGTK----------------
KCRM_RABIT      GGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSSNADRLGSSEVEQVQLVVD-----------
KCRM_PIG        GGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSSNADRLGSSEVEQVQLVVD-----------
KCRM_HUMAN      GGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSSNADRLGSSEVEQVQLVVD-----------
KCRM_BOVIN      GGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSSNADRLGSSEVEQVQLVVD-----------
HDHD2_BOVIN     --------------KPEKTFFLEALRGTGCEPEETVMIGDCRDDVGGAQNAGMRGIL-------------
GMHB_HAEDU      YYCPHYPEGQGEYQKPKAGMFQQAIKDLNIDPAQSYMVGDKLEDLLAAETAGVK----------------
GPH_RHORT       --------------KPDPAPLRALLDSLGVEADQALMVGDSPTDVATAKAAGV-----------------
KCRM_CANFA      GGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSSNADRLGSSEVEQVQLVVD-----------
GPH_YERPS       YFSVIIGGDDVVVKKPHPAPXXXXXXXXXXHAREMLFVGDSRNDIMAAQAAG------------------
GPH_YERPE       YFSVIIGGDDVVVKKPHPAPXXXXXXXXXXHAREMLFVGDSRNDIMAAQAAG------------------
GPH_PHOLL       YFSLVLGGDDVKEKKPHPAPIYLTMGTFGLRKEELLFVGDSRNDILAAQAAG------------------
SERB_METJA      LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK----------------
P1254_THEMA     YFDVMVFGDQVKNGKPDPEIYLLVLERLNVVPEKVVVFEDSKSGVEAAKSAGIERI--------------
HDHD3_XENTR     ----------------------------------------------------------------------
PGP_THESM       ---------------------RNACQKLGITPEQVAHIGDGENDLDAFKVVGYRV----AVAQAPEVLKR
YIEH_ECOLI      MLHYFPDKLFSGYDKPDPALMFHAAKAMNVNVENCILVDDSVAGAQSGIDAGMEVFYF------------
PHNX_BACFR      RVDYCATPNLLPAGRPAPYMIFENLTKLAVDPDTVVKVGDTIADI-------------------------
PHNX_BACFN      RVDYCATPNLLPAGRPAPYMIFENLTKLAVDPDTVVKVGDTIADI-------------------------
MTNC_XANAC      FFAHSDAGDLSGLIKRESASYRRIAERIGVPGPEILFLSDVIEELDAAKRAGMRTALLDRLDDYP-----
MTNC_PERMH      FFSHTEYGDLTGFFKKDPQSYLKIAEAVGLKPENILFLSDNPDEIRAAAEAGMKVIKISRPEDSP-----
GPH_PSYA2       IFSEVLGGDSLPTKKPDPAPLLHVCEVLNINPAQAVMIGDSINDILAGQNANMDTL--------------
Y2257_MYCBO     HFEVIAGASTDGSRGSKVDVLAHALAQLRPLPERLVMVGDRSHDVDGAAAHGI-----------------
Y2232_MYCTU     HFEVIAGASTDGSRGSKVDVLAHALAQLRPLPERLVMVGDRSHDVDGAAAHGI-----------------
MTNC_XANCP      FFAHSDAGDLSGLVKRESSSYRRIAERIGVPAPEILFLSDVIEELDAAKRAGMRTALLDRLEDYP-----
MTNC_XANCB      FFAHSDAGDLSGLVKRESSSYRRIAERIGVPAPEILFLSDVIEELDAAKRAGMRTALLDRLEDYP-----
MTNC_XANC8      FFAHSDAGDLSGLVKRESSSYRRIAERIGVPAPEILFLSDVIEELDAAKRAGMRTALLDRLEDYP-----
PGP_PYRKO       ----------------------KACEYLGISPKEVAHIGDGENDLDAFGVVGYRVAVAQPYGEGAEAIEH
MTNC_ENT38      YSDEGDITHLSGYAKRDVQSYQNIAAQIGVSPSQILFLSDIHEELDAAEQAGFRTL--------------
HDHD2_RAT       --------------KPEKTFFLEALRDTDCAPEEAVMIGDCRDDVDGAQNIGMLGIL-------------
HDHD2_MOUSE     --------------KPEKTFFLEALRDADCAPEEAVMIGDCRDDVDGAQNIGMLGIL-------------
PGP_PYRFU       ----------------------KACELLGLNPKEVAHVGDGENDLDAFKVVGYR----------------
PGP_PYRAB       ----------------------KACELLGIKPREVAHIGDGENDLDAFKVVGYRIAIADVLKEN------
GPH_NITMU       YFDIVVSGDSXXXXXXXXXXXXHACERFEIQPHDMLLVGDSLNDAQAARAAGSHVFCV-PYGYN------
CARB_BACCL      --AQVVINTLTKGKQPESRIRREAVE--------------------------------------------
MTNC_CITK8      YSDEGDITHLSGYAKRETQSYRNIASYIGVAPSQILFLSDVYQELDAAEEAGLRTL--------------
KCRF_STRPU      AGVHVKVPLLSQQKIFDSILDHMRLQKRGTGGVDTAST-DGTFDISNSDRIGFSEVLVQQLVDGVKLLVN
GPH_THIDA       YFELILSGDTXXXXXXXXXXXXHACEVFGVAPAELLLIGDSLNDTQAARAAG------------------


                         .         .         .         +         .         .         .:280
query           LERVLDYLP
HDHD3_BOVIN     ---------
HDHD3_MOUSE     ---------
HDHD3_HUMAN     ---------
HDHD3_XENLA     LQ-------
HDHD3_DANRE     ---------
Y1777_PYRFU     ---------
Y1655_PYRHO     ---------
Y209_METTH      ---------
REG2_DROME      ---------
GPH_AQUAE       ---------
GPH1_PSEAE      IDNLRDLLP
ACD10_HUMAN     LEALLGF--
Y970_METKA      ---------
YB10_PYRAB      ---------
HAD4_BURCE      ---------
GPH_RHOSH       ---------
GPH_RHOSK       ---------
GPH_RHOS4       ---------
GPH_RHOS1       ---------
GPH_PSEPU       ---------
PPAX_CLOPE      ---------
GPH_RHILO       ---------
GPH_PSEPK       ---------
GPH_NEIMA       ---------
GPH_VIBVY       ---------
GPH_PSEF5       ---------
PPAX_BACHD      ---------
GPH_PSEPF       ---------
DEH2_MORSB      ---------
HYES_RAT        LEKV-----
YSAA_BACSU      ---------
GPH_SHIBS       ---------
YJJG_ECOLI      ---------
YJJG_ECO57      ---------
GPH_SHISS       ---------
GPH_SHIFL       ---------
GPH_SHIDS       ---------
GPH_PASMU       ---------
GPH_ECOLI       ---------
GPH_ECOL6       ---------
GPH_ECO57       ---------
GPH_VIBVU       ---------
HAD1_PSEUC      ---------
GPH_VIBCH       ---------
GPH_NEIG1       ---------
GPH_KLEAE       ---------
GPH_HAEI8       ---------
HAD9_PSEPU      ---------
GPH_VIBPA       ---------
ACD10_MOUSE     LEALLGF--
YIHX_SHIFL      ---------
YIHX_ECOLI      ---------
PPAX_BACSU      ---------
HYES_HUMAN      LEKV-----
GPH_AGRT5       ---------
PGMB_ECOLI      ---------
GPH_RHOS5       ---------
GPH_HAEIN       ---------
PPAX_BACA2      ---------
GPH_RHOCA       ---------
HYES_MOUSE      LEKV-----
YIGB_SHIFL      ---------
YIGB_ECOLI      ---------
Y1437_METJA     ---------
PPAX_BACC0      ---------
GPH_VIBF1       ---------
GPH_COLP3       ---------
YRFG_SHIFL      ---------
YRFG_ECOLI      ---------
PPAX_BACCR      ---------
PPAX_BACC2      ---------
PGMB_LACLA      ---------
GPH_NITOC       ---------
GPHC_RALEH      ---------
PPAX_THETN      ---------
PPAX_BACP2      ---------
GPH_PHOPR       ---------
GPH_MANSM       ---------
YNIC_ECOLI      ---------
YNIC_ECO57      ---------
YFGS_LACCA      ---------
PPAX_BACWK      ---------
HYES_PIG        LEKV-----
HAD_PSEUY       ---------
GPH_PSE14       ---------
GPHP_RALEH      ---------
CBBY_RHOSH      ADRLLD---
PPAX_BACHK      ---------
PPAX_BACCZ      ---------
PPAX_BACCQ      ---------
PPAX_BACC7      ---------
PPAX_BACC4      ---------
PPAX_BACC3      ---------
PPAX_BACAN      ---------
PPAX_BACAH      ---------
PPAX_BACAC      ---------
PPAX_BACAA      ---------
NANP_RAT        ---------
NANP_MOUSE      ---------
GPH_ERWCT       ---------
GPH_CAUCR       ---------
YHCW_BACSU      ---------
LHPP_XENLA      ---------
PPAX_BACC1      ---------
NANP_HUMAN      ---------
GPH_PSESM       ---------
PPAX_LISMO      ---------
PPAX_LISMH      ---------
PPAX_LISMF      ---------
PPAX_LISMC      ---------
PPAX_LISIN      ---------
PPAX_OCEIH      ---------
PGMB_BACSU      ---------
P845_THEAC      ---------
GPH_PSEU2       ---------
YQAB_ECOLI      ---------
HAD2_PSEUC      ---------
GPH_XYLFA       ---------
YFP5_SCHPO      ---------
PPAX_LISW6      ---------
GPH_XANCP       ---------
GPH_XANC8       ---------
GPH_XYLFT       ---------
SERB_ARCFU      ---------
HDHD2_PONAB     ---------
HDHD2_HUMAN     ---------
HDHD2_DANRE     ---------
5NTD_PSEAE      ---------
PPAX_ANOFW      ---------
KCRM_RABIT      ---------
KCRM_PIG        ---------
KCRM_HUMAN      ---------
KCRM_BOVIN      ---------
HDHD2_BOVIN     ---------
GMHB_HAEDU      ---------
GPH_RHORT       ---------
KCRM_CANFA      ---------
GPH_YERPS       ---------
GPH_YERPE       ---------
GPH_PHOLL       ---------
SERB_METJA      ---------
P1254_THEMA     ---------
HDHD3_XENTR     ---------
PGP_THESM       ---------
YIEH_ECOLI      ---------
PHNX_BACFR      ---------
PHNX_BACFN      ---------
MTNC_XANAC      ---------
MTNC_PERMH      ---------
GPH_PSYA2       ---------
Y2257_MYCBO     ---------
Y2232_MYCTU     ---------
MTNC_XANCP      ---------
MTNC_XANCB      ---------
MTNC_XANC8      ---------
PGP_PYRKO       ILRKFGYLP
MTNC_ENT38      ---------
HDHD2_RAT       ---------
HDHD2_MOUSE     ---------
PGP_PYRFU       ---------
PGP_PYRAB       ---------
GPH_NITMU       ---------
CARB_BACCL      ---------
MTNC_CITK8      ---------
KCRF_STRPU      LEKAL----
GPH_THIDA       ---------