[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81497.1

[Show Plain Result]


## Summary of Sequence Search
    1::725
    1::725       0.0 100%  725 aa  PURL_THET8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::725       0.0 100%  725 aa  PURL_THET2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::703       0.0  49%  733 aa  PURL_THETN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::707       0.0  49%  733 aa  PURL_THEP3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::707       0.0  48%  733 aa  PURL_THEPX RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::697       0.0  49%  742 aa  PURL_GEOSW RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::687       0.0  50%  739 aa  PURL_EXISA RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::687       0.0  50%  740 aa  PURL_ANOFW RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::761     e-180  51%  761 aa  PURL_THEEB RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::712     e-178  49%  742 aa  PURL_GEOTN RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::710     e-178  49%  742 aa  PURL_GEOKA RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::746     e-177  50%  747 aa  PURL_DEIRA RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::710     e-176  52%  733 aa  PURL_THERP RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::708     e-176  50%  733 aa  PURL_MOOTA RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-174  49%  742 aa  PURL_OCEIH RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::682     e-174  49%  739 aa  PURL_LISMF RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::683     e-173  48%  742 aa  PURL_BACSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::723     e-173  50%  767 aa  PURL_ANADF RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::698     e-173  48%  742 aa  PURL_BACLD RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::711     e-173  47%  738 aa  PURL_ALKMQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::745     e-171  52%  788 aa  PURL_NOSP7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::715     e-171  52%  774 aa  PURL_GLOVI RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::683     e-171  48%  743 aa  PURL_BACP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::712     e-171  47%  739 aa  PURL_LISW6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::689     e-171  48%  739 aa  PURL_BACCN RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::749     e-171  51%  777 aa  PURL_ANAVT RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::683     e-170  48%  742 aa  PURL_BACA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-170  47%  739 aa  PURL_BACCZ RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::723     e-170  50%  759 aa  PURL_ANASK RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-170  47%  739 aa  PURL_BACHK RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::712     e-170  47%  739 aa  PURL_LISIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::682     e-169  48%  739 aa  PURL_LISMC RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACCQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACC7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACC1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACC0 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACAN RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACAH RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACAA RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::730     e-169  50%  768 aa  PURL_SYNY3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACC4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACC2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::723     e-169  49%  759 aa  PURL_ANADE RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::682     e-169  48%  739 aa  PURL_LISMH RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::706     e-169  48%  739 aa  PURL_ENTFA RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::733     e-169  46%  741 aa  PURL_BACSK RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-169  47%  739 aa  PURL_BACWK RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::682     e-168  48%  739 aa  PURL_LISMO RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::684     e-168  47%  739 aa  PURL_BACCR RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::754     e-168  51%  782 aa  PURL_ANASP RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::699     e-168  46%  724 aa  PURL_THELT RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::695     e-167  48%  728 aa  PURL_CARHZ RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::722     e-167  51%  783 aa  PURL_ACAM1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::733     e-167  51%  766 aa  PURL_SYNJA RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::708     e-164  51%  777 aa  PURL_SYNP6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::708     e-164  51%  777 aa  PURL_SYNE7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::734     e-164  50%  768 aa  PURL_SYNJB RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::723     e-164  48%  759 aa  PURL_ANAD2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::744     e-163  50%  778 aa  PURL_SYMTH RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::726     e-163  50%  768 aa  PURL_SYNPX RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::707     e-160  46%  739 aa  PURL_LACLS RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::707     e-160  46%  739 aa  PURL_LACLM RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::707     e-160  46%  739 aa  PURL_LACLC RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::696     e-160  45%  743 aa  PURL_BACHD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::725     e-159  48%  765 aa  PURL_SYNPW RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::724     e-159  51%  794 aa  PURL_PROMM RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::708     e-159  46%  735 aa  PURL_METSB RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::707     e-159  47%  739 aa  PURL_LACLA RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::709     e-159  46%  735 aa  PURL_AZOC5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::711     e-158  46%  734 aa  PURL_ZYMMO RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::724     e-158  51%  794 aa  PURL_PROM3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::717     e-158  51%  782 aa  PURL_CYAP4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::721     e-157  48%  793 aa  PURL_PROMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::727     e-156  45%  736 aa  PURL_RHOPB RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::676     e-156  46%  729 aa  PURL_STAHJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::715     e-155  46%  740 aa  PURL_RHORT RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::728     e-155  48%  766 aa  PURL_SYNS9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::726     e-154  44%  735 aa  PURL_BRASB RecName: Full=Phosphoribosylformylglycinamidine synthase
   28::732     e-154  49%  803 aa  PURL_PROMT RecName: Full=Phosphoribosylformylglycinamidine synthase
   26::742     e-153  48%  803 aa  PURL_PROM1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAN RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAM RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAA9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAA1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::721     e-153  47%  779 aa  PURL_PROM2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::676     e-153  45%  729 aa  PURL_STAES RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::676     e-153  45%  729 aa  PURL_STAEQ RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::722     e-153  46%  744 aa  PURL_ERYLH RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAW RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAT RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAS RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAE RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAA8 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-153  45%  729 aa  PURL_STAA3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::721     e-153  47%  779 aa  PURL_PROM0 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::696     e-153  45%  739 aa  PURL_PARL1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::721     e-152  47%  779 aa  PURL_PROMS RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-152  46%  729 aa  PURL_STAS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::675     e-152  45%  729 aa  PURL_STAAR RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::688     e-152  46%  739 aa  PURL_LACPL RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::690     e-152  45%  736 aa  PURL_BRASO RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::709     e-152  45%  736 aa  PURL_RHOPT RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::676     e-151  45%  729 aa  PURL_STACT RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::731     e-151  45%  759 aa  PURL_CHLTE RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::709     e-151  45%  736 aa  PURL_RHOPA RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::721     e-151  46%  779 aa  PURL_PROM9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::708     e-150  43%  733 aa  PURL_WOLSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   14::558     e-150  50%  729 aa  PURL_STAAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::709     e-150  45%  736 aa  PURL_RHOP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::727     e-150  48%  779 aa  PURL_PROMP RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::707     e-150  46%  745 aa  PURL_AQUAE RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::709     e-149  45%  736 aa  PURL_RHOPS RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::683     e-149  45%  741 aa  PURL_LACS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::693     e-149  48%  754 aa  PURL_SALRD RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::623     e-149  48%  728 aa  PURL_MACCJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::679     e-149  44%  738 aa  PURL_LEUMM RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::728     e-148  43%  737 aa  PURL_RHOP5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::689     e-148  45%  719 aa  PURL_NOVAD RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::698     e-148  45%  719 aa  PURL_JANSC RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::682     e-148  44%  741 aa  PURL_LACSS RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-147  46%  740 aa  PURL_BRUSU RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-147  46%  740 aa  PURL_BRUSI RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-147  46%  740 aa  PURL_BRUO2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-147  46%  740 aa  PURL_BRUC2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::705     e-147  43%  736 aa  PURL_BEII9 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::635     e-146  46%  739 aa  PURL_CAUCR RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-146  46%  740 aa  PURL_BRUME RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-146  46%  740 aa  PURL_BRUMB RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-146  46%  740 aa  PURL_BRUAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-146  46%  740 aa  PURL_BRUA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-146  46%  740 aa  PURL_BRUA1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::704     e-146  48%  768 aa  PURL_SYNSC RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::686     e-146  45%  712 aa  PURL_THEGJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::709     e-146  46%  740 aa  PURL_OCHA4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::625     e-145  48%  724 aa  PURL_GRABC RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::668     e-145  45%  734 aa  PURL_GLUOX RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::696     e-145  46%  720 aa  PURL_RHOS4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::716     e-145  48%  779 aa  PURL_PROM5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   49::761     e-145  43%  775 aa  PURL_AGRT5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::696     e-145  46%  720 aa  PURL_RHOSK RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::710     e-145  42%  736 aa  PURL_BARQU RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::710     e-145  43%  735 aa  PURL_BARHE RecName: Full=Phosphoribosylformylglycinamidine synthase
   13::720     e-145  45%  761 aa  PURL_CHLCH RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::709     e-144  43%  744 aa  PURL_NITHX RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::713     e-144  44%  744 aa  PURL_MESSB RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::698     e-144  44%  719 aa  PURL_RHOS5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::679     e-143  43%  738 aa  PURL_LACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::710     e-143  43%  737 aa  PURL_NITWN RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::727     e-143  42%  751 aa  PURL_NOCSJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::696     e-142  44%  721 aa  PURL_SILST RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::687     e-142  45%  713 aa  PURL_PYRKO RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::696     e-142  41%  730 aa  PURL_PELUB RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::703     e-142  42%  742 aa  PURL_LACRJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::703     e-142  42%  742 aa  PURL_LACRD RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::702     e-142  42%  727 aa  PURL_ACICJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::706     e-142  42%  737 aa  PURL_SULDN RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::704     e-141  41%  735 aa  PURL_NITSB RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::683     e-141  43%  741 aa  PURL_LACF3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::681     e-141  43%  740 aa  PURL_LACDB RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::681     e-141  43%  740 aa  PURL_LACDA RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::695     e-141  42%  728 aa  PURL_CAMJJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::695     e-141  43%  728 aa  PURL_CAMJD RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::610     e-140  47%  719 aa  PURL_SILPO RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::695     e-140  43%  728 aa  PURL_CAMJ8 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::711     e-140  43%  745 aa  PURL_AGRVS RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::714     e-140  41%  740 aa  PURL_SULNB RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::695     e-140  41%  728 aa  PURL_CAMJE RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::695     e-139  43%  728 aa  PURL_CAMJR RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::724     e-139  41%  745 aa  PURL_LEPBL RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::724     e-139  41%  745 aa  PURL_LEPBJ RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::690     e-139  43%  736 aa  PURL_BRAJA RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::725     e-139  42%  748 aa  PURL_LEPBP RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::725     e-139  42%  748 aa  PURL_LEPBA RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::681     e-138  44%  713 aa  PURL_THESM RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::730     e-138  42%  743 aa  PURL_RHIFR RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::694     e-138  44%  723 aa  PURL_PARDP RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::716     e-138  41%  745 aa  PURL_LEPIN RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::734     e-138  43%  761 aa  PURL_FRASC RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::684     e-138  43%  743 aa  PURL_LACH4 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::716     e-138  41%  745 aa  PURL_LEPIC RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::710     e-138  41%  736 aa  PURL_BART1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::711     e-137  44%  743 aa  PURL_AGRRK RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::710     e-137  41%  743 aa  PURL_RHIME RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::694     e-137  42%  719 aa  PURL_ROSDO RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::710     e-137  41%  737 aa  PURL_BARBK RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::681     e-136  42%  740 aa  PURL_LACCA RecName: Full=Phosphoribosylformylglycinamidine synthase
   30::730     e-136  43%  769 aa  PURL_FRASN RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::693     e-136  41%  727 aa  PURL_PETMO RecName: Full=Phosphoribosylformylglycinamidine synthase
   36::727     e-136  41%  760 aa  PURL_TROWT RecName: Full=Phosphoribosylformylglycinamidine synthase
   36::727     e-136  41%  760 aa  PURL_TROW8 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::714     e-135  43%  743 aa  PURL_RHILO RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::710     e-135  41%  743 aa  PURL_SINMW RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::698     e-135  40%  725 aa  PURL_CAMLR RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::705     e-135  40%  732 aa  PURL_CAMHC RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::711     e-135  41%  743 aa  PURL_RHIEC RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::711     e-135  41%  743 aa  PURL_RHIE6 RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::699     e-134  42%  744 aa  PURL_RHIL3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::720     e-134  43%  761 aa  PURL_PELLD RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::681     e-133  43%  705 aa  PURL_PYRAB RecName: Full=Phosphoribosylformylglycinamidine synthase
   21::712     e-133  40%  742 aa  PURL_LACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::729     e-133  41%  742 aa  PURL_RHISN RecName: Full=Phosphoribosylformylglycinamidine synthase
   27::714     e-133  40%  745 aa  PURL_HELHP RecName: Full=Phosphoribosylformylglycinamidine synthase
   18::699     e-132  42%  743 aa  PURL_RHILW RecName: Full=Phosphoribosylformylglycinamidine synthase
   17::739     e-131  42%  765 aa  PURL_CORA7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   31::738     e-131  41%  767 aa  PURL_RENSM RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::698     e-131  40%  729 aa  PURL_CAMC5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::737     e-131  40%  765 aa  PURL_THEFY RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::737     e-130  41%  761 aa  PURL_MYCA9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::688     e-130  42%  714 aa  PURL_METTH RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::658     e-129  43%  705 aa  PURL_PYRHO RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::725     e-129  41%  764 aa  PURL_MYCVP RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::717     e-129  40%  758 aa  PURL_CORAM RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::693     e-128  39%  724 aa  PURL_CALMQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::681     e-128  42%  704 aa  PURL_PYRFU RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::699     e-127  39%  729 aa  PURL_CAMC1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::742     e-127  41%  781 aa  PURL_MYCGI RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::703     e-127  41%  733 aa  PURL_METJA RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::720     e-126  42%  724 aa  PURL_METKA RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::728     e-126  39%  752 aa  PURL_STRCO RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::728     e-126  39%  752 aa  PURL_STRAW RecName: Full=Phosphoribosylformylglycinamidine synthase
   29::732     e-125  40%  772 aa  PURL_LEIXX RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::714     e-125  40%  754 aa  PURL_MYCTU RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::714     e-125  40%  754 aa  PURL_MYCTA RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::714     e-125  40%  754 aa  PURL_MYCBT RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::714     e-125  40%  754 aa  PURL_MYCBP RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::714     e-125  40%  754 aa  PURL_MYCBO RecName: Full=Phosphoribosylformylglycinamidine synthase
   31::725     e-124  40%  765 aa  PURL_MYCPA RecName: Full=Phosphoribosylformylglycinamidine synthase
   31::725     e-124  40%  765 aa  PURL_MYCA1 RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::738     e-123  40%  762 aa  PURL_RHOE4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::688     e-122  39%  715 aa  PURL_METAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::718     e-122  42%  813 aa  PURL_CORJK RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::737     e-122  40%  761 aa  PURL_RHOSR RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::688     e-122  39%  716 aa  PURL_METMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::730     e-121  40%  754 aa  PURL_MYCLE RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::730     e-121  40%  754 aa  PURL_MYCLB RecName: Full=Phosphoribosylformylglycinamidine synthase
   22::736     e-121  40%  764 aa  PURL_NOCFA RecName: Full=Phosphoribosylformylglycinamidine synthase
   23::737     e-120  39%  761 aa  PURL_RHOOB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::594     e-120  41%  697 aa  PURL_PYRAE RecName: Full=Phosphoribosylformylglycinamidine synthase
   24::729     e-120  39%  763 aa  PURL_COREF RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::716     e-119  39%  750 aa  PURL_PROAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::691     e-119  39%  716 aa  PURL_METS3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::701     e-119  38%  732 aa  PURL_META3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::722     e-117  38%  762 aa  PURL_CORGB RecName: Full=Phosphoribosylformylglycinamidine synthase
   25::722     e-117  38%  762 aa  PURL_CORGL RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::654     e-117  41%  693 aa  PURL_PYRCJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::686     e-116  37%  723 aa  PURL_METST RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::674     e-116  42%  720 aa  PURL_HALMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::594     e-115  40%  697 aa  PURL_PYRAR RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::688     e-114  37%  715 aa  PURL_METBF RecName: Full=Phosphoribosylformylglycinamidine synthase
   20::689     e-114  39%  768 aa  PURL_METTP RecName: Full=Phosphoribosylformylglycinamidine synthase
   44::741     e-113  37%  765 aa  PURL_ARCFU RecName: Full=Phosphoribosylformylglycinamidine synthase
   16::612     e-113  41%  713 aa  PURL_IGNH4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::628     e-113  40%  693 aa  PURL_THENV RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::509     e-110  48%  603 aa  PURL_THEMA RecName: Full=Phosphoribosylformylglycinamidine synthase
   19::653     e-109  37%  693 aa  PURL_PYRIL RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::549     e-107  43%  725 aa  PURL_HALWD RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::534     e-106  41%  710 aa  PURL_SULAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::532     e-103  40%  703 aa  PURL_SULTO RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::540     e-102  44%  713 aa  PURL_NATPD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::580     e-102  43%  759 aa  PURL_HALLT RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-102  39%  709 aa  PURL_SULIA RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-101  39%  709 aa  PURL_SULIM RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-101  39%  709 aa  PURL_SULIK RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-101  39%  709 aa  PURL_SULIY RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-101  39%  709 aa  PURL_SULIN RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-101  39%  709 aa  PURL_SULIL RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::534     e-100  39%  709 aa  PURL_SULSO RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::532     2e-98  40%  702 aa  PURL_METS5 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::655     2e-96  40%  700 aa  PURL_HALSA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::655     2e-96  40%  700 aa  PURL_HALS3 RecName: Full=Phosphoribosylformylglycinamidine synthase
   11::577     8e-96  36%  741 aa  PURL_PICTO RecName: Full=Phosphoribosylformylglycinamidine synthase
   36::732     4e-92  33%  759 aa  PURL_THEVO RecName: Full=Phosphoribosylformylglycinamidine synthase
   36::732     2e-91  32%  759 aa  PURL_THEAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::129     5e-34  54%  129 aa  PURL_METTM RecName: Full=Phosphoribosylformylglycinamidine synthase
  198::950     8e-29  28% 1297 aa  PUR4_MANSM RecName: Full=Phosphoribosylformylglycinamidine
  194::648     1e-24  32% 1295 aa  PUR4_PHOLL RecName: Full=Phosphoribosylformylglycinamidine
  194::552     4e-24  34% 1295 aa  PUR4_PSEA6 RecName: Full=Phosphoribosylformylglycinamidine
  206::673     5e-24  32% 1323 aa  PUR4_SCHPO RecName: Full=Probable phosphoribosylformylglycinamidine
  195::574     6e-24  35% 1295 aa  PUR4_SODGM RecName: Full=Phosphoribosylformylglycinamidine
  197::660     6e-24  31% 1298 aa  PUR4_HAHCH RecName: Full=Phosphoribosylformylglycinamidine
  179::551     8e-24  34% 1293 aa  PUR4_SHESR RecName: Full=Phosphoribosylformylglycinamidine
  179::551     1e-23  34% 1293 aa  PUR4_SHESM RecName: Full=Phosphoribosylformylglycinamidine
  181::553     2e-23  34% 1297 aa  PUR4_PASMU RecName: Full=Phosphoribosylformylglycinamidine
  194::776     3e-23  29% 1296 aa  PUR4_PSEHT RecName: Full=Phosphoribosylformylglycinamidine
  195::551     4e-23  33% 1293 aa  PUR4_SHEDO RecName: Full=Phosphoribosylformylglycinamidine
  195::647     4e-23  32% 1298 aa  PUR4_PSEAE RecName: Full=Phosphoribosylformylglycinamidine
  196::553     4e-23  35% 1295 aa  PUR4_ECOUT RecName: Full=Phosphoribosylformylglycinamidine
  179::551     5e-23  33% 1293 aa  PUR4_SHEON RecName: Full=Phosphoribosylformylglycinamidine
  167::647     5e-23  31% 1299 aa  PUR4_PSEPK RecName: Full=Phosphoribosylformylglycinamidine
  180::553     7e-23  34% 1297 aa  PUR4_VIBVY RecName: Full=Phosphoribosylformylglycinamidine
  180::553     7e-23  34% 1297 aa  PUR4_VIBVU RecName: Full=Phosphoribosylformylglycinamidine
  191::553     7e-23  34% 1295 aa  PUR4_SALTY RecName: Full=Phosphoribosylformylglycinamidine
  191::553     7e-23  34% 1295 aa  PUR4_SALTI RecName: Full=Phosphoribosylformylglycinamidine
  191::553     7e-23  34% 1295 aa  PUR4_SALCH RecName: Full=Phosphoribosylformylglycinamidine
  200::556     7e-23  34% 1299 aa  PUR4_MYXXD RecName: Full=Phosphoribosylformylglycinamidine
  196::553     7e-23  34% 1295 aa  PUR4_ECOLI RecName: Full=Phosphoribosylformylglycinamidine
  192::553     9e-23  34% 1297 aa  PUR4_VIBCH RecName: Full=Phosphoribosylformylglycinamidine
  196::553     9e-23  34% 1295 aa  PUR4_SHISS RecName: Full=Phosphoribosylformylglycinamidine
  196::553     9e-23  34% 1295 aa  PUR4_SHIDS RecName: Full=Phosphoribosylformylglycinamidine
  195::647     9e-23  32% 1298 aa  PUR4_PSESM RecName: Full=Phosphoribosylformylglycinamidine
  196::553     9e-23  34% 1295 aa  PUR4_ECOL6 RecName: Full=Phosphoribosylformylglycinamidine
  196::553     9e-23  34% 1295 aa  PUR4_ECOL5 RecName: Full=Phosphoribosylformylglycinamidine
  196::553     9e-23  34% 1295 aa  PUR4_ECO57 RecName: Full=Phosphoribosylformylglycinamidine
  195::551     1e-22  33% 1293 aa  PUR4_SHEFN RecName: Full=Phosphoribosylformylglycinamidine
  195::647     2e-22  32% 1298 aa  PUR4_PSEU2 RecName: Full=Phosphoribosylformylglycinamidine
  173::646     2e-22  30% 1293 aa  PUR4_METFK RecName: Full=Phosphoribosylformylglycinamidine
  190::551     2e-22  34% 1295 aa  PUR4_IDILO RecName: Full=Phosphoribosylformylglycinamidine
  196::553     2e-22  34% 1295 aa  PUR4_SHIBS RecName: Full=Phosphoribosylformylglycinamidine
  191::553     3e-22  34% 1295 aa  PUR4_SALPA RecName: Full=Phosphoribosylformylglycinamidine
  195::647     3e-22  32% 1298 aa  PUR4_PSE14 RecName: Full=Phosphoribosylformylglycinamidine
  180::553     3e-22  33% 1322 aa  PUR4_PHOPR RecName: Full=Phosphoribosylformylglycinamidine
  180::569     4e-22  32% 1302 aa  PUR4_VIBPA RecName: Full=Phosphoribosylformylglycinamidine
  193::647     4e-22  30% 1298 aa  PUR4_PSEF5 RecName: Full=Phosphoribosylformylglycinamidine
  196::568     6e-22  33% 1296 aa  PUR4_YERPS RecName: Full=Phosphoribosylformylglycinamidine
  196::568     6e-22  33% 1296 aa  PUR4_YERPN RecName: Full=Phosphoribosylformylglycinamidine
  196::568     6e-22  33% 1296 aa  PUR4_YERPE RecName: Full=Phosphoribosylformylglycinamidine
  196::568     6e-22  33% 1296 aa  PUR4_YERPA RecName: Full=Phosphoribosylformylglycinamidine
  198::569     8e-22  33% 1297 aa  PUR4_HAES1 RecName: Full=Phosphoribosylformylglycinamidine
  191::800     8e-22  28% 1294 aa  PUR4_ERWCT RecName: Full=Phosphoribosylformylglycinamidine
  199::572     2e-21  32% 1320 aa  PUR4_COLP3 RecName: Full=Phosphoribosylformylglycinamidine
  195::647     6e-21  30% 1298 aa  PUR4_PSEPF RecName: Full=Phosphoribosylformylglycinamidine
  196::589     9e-20  30% 1303 aa  PUR4_VIBF1 RecName: Full=Phosphoribosylformylglycinamidine
  199::554     3e-19  33% 1297 aa  PUR4_HAEIN RecName: Full=Phosphoribosylformylglycinamidine
  199::554     3e-19  33% 1297 aa  PUR4_HAEI8 RecName: Full=Phosphoribosylformylglycinamidine
  212::704     1e-18  29% 1369 aa  PUR4_RALSO RecName: Full=Phosphoribosylformylglycinamidine
  216::729     2e-18  29% 1358 aa  PUR4_YEAST RecName: Full=Phosphoribosylformylglycinamidine
  176::689     9e-17  30% 1322 aa  PUR4_XYLFT RecName: Full=Phosphoribosylformylglycinamidine
  176::543     1e-16  32% 1322 aa  PUR4_XYLFA RecName: Full=Phosphoribosylformylglycinamidine
  369::1054    1e-16  25% 1387 aa  PUR4_ARATH RecName: Full=Probable phosphoribosylformylglycinamidine
  308::685     2e-16  27% 1355 aa  PUR4_DICDI RecName: Full=Phosphoribosylformylglycinamidine
  191::774     5e-15  27% 1314 aa  PUR4_NEIG1 RecName: Full=Phosphoribosylformylglycinamidine
  304::751     3e-14  27% 1338 aa  PUR4_HUMAN RecName: Full=Phosphoribosylformylglycinamidine
  195::778     6e-14  26% 1320 aa  PUR4_NEIMB RecName: Full=Phosphoribosylformylglycinamidine
  195::553     3e-13  31% 1320 aa  PUR4_NEIMA RecName: Full=Phosphoribosylformylglycinamidine
  298::726     3e-13  24% 1343 aa  PUR4_CAEEL RecName: Full=Probable phosphoribosylformylglycinamidine
  304::750     2e-11  26% 1337 aa  PUR4_MOUSE RecName: Full=Phosphoribosylformylglycinamidine
  183::543     1e-10  31% 1348 aa  PUR4_XANCP RecName: Full=Phosphoribosylformylglycinamidine
  183::552     1e-09  31% 1348 aa  PUR4_XANAC RecName: Full=Phosphoribosylformylglycinamidine
  311::590     3e-09  27% 1354 aa  PUR4_DROME RecName: Full=Phosphoribosylformylglycinamidine
   41::288     4e-08  28%  335 aa  Y676_METJA RecName: Full=Putative hydrogenase expression/formation
   15::285     4e-08  29%  327 aa  THIL_METTH RecName: Full=Probable thiamine-monophosphate kinase;   
   17::256     2e-07  28%  347 aa  SELD_ENTS8 RecName: Full=Selenide, water dikinase;       
   12::122     5e-07  27%  319 aa  THIL_METJA RecName: Full=Probable thiamine-monophosphate kinase;   
   40::254     1e-06  25%  345 aa  SELD_GEOSL RecName: Full=Selenide, water dikinase;       
   71::255     3e-06  33%  344 aa  SELD_PSEPK RecName: Full=Selenide, water dikinase;       
   53::260     3e-06  28%  351 aa  SELD_PASMU RecName: Full=Selenide, water dikinase;       
  850::963     8e-06  31% 1299 aa  VP75_SHV21 RecName: Full=Probable membrane antigen 75;AltName:
   87::336     1e-05  27%  343 aa  SELD_SULDN RecName: Full=Selenide, water dikinase;       
   89::305     1e-05  27%  334 aa  PUR5_PYRKO RecName: Full=Phosphoribosylformylglycinamidine
   18::314     1e-05  27%  336 aa  PUR5_THETN RecName: Full=Phosphoribosylformylglycinamidine
   59::292     1e-05  27%  346 aa  PUR5_BACP2 RecName: Full=Phosphoribosylformylglycinamidine
  314::479     1e-05  33%  484 aa  COR1B_RAT RecName: Full=Coronin-1B;AltName: Full=Coronin-2;
   89::256     2e-05  29%  348 aa  SELD_DECAR RecName: Full=Selenide, water dikinase;       
   87::254     2e-05  26%  344 aa  SELD_COLP3 RecName: Full=Selenide, water dikinase;       
   38::252     2e-05  27%  343 aa  SELD_GEOMG RecName: Full=Selenide, water dikinase;       
  632::724     2e-05  31% 1168 aa  RPOB_CORK4 RecName: Full=DNA-directed RNA polymerase subunit beta; 
  137::239     3e-05  32%  452 aa  Y1416_METJA RecName: Full=Uncharacterized protein MJ1416;
   49::344     3e-05  25%  346 aa  SELD_HAEDU RecName: Full=Selenide, water dikinase;       
   38::315     4e-05  24%  333 aa  PUR5_METMA RecName: Full=Phosphoribosylformylglycinamidine
   79::292     5e-05  28%  341 aa  HYPE_AZOVI RecName: Full=Hydrogenase expression/formation protein
   79::292     5e-05  28%  341 aa  HUPE_AZOCH RecName: Full=Hydrogenase expression/formation protein
   48::254     6e-05  27%  346 aa  SELD_PHOPR RecName: Full=Selenide, water dikinase;       
   50::256     1e-04  25%  348 aa  SELD_YERPE RecName: Full=Selenide, water dikinase;       
   48::258     1e-04  24%  345 aa  SELD_AERS4 RecName: Full=Selenide, water dikinase;       
   48::258     1e-04  24%  345 aa  SELD_AERHH RecName: Full=Selenide, water dikinase;       
   25::137     2e-04  35%  322 aa  Y787_SYNY3 RecName: Full=Uncharacterized protein sll0787;
   50::256     2e-04  25%  348 aa  SELD_YERPS RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_SHISS RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_SHIDS RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_SHIBS RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_ECOL6 RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_ECOL5 RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_ECO57 RecName: Full=Selenide, water dikinase;       
   17::256     2e-04  25%  347 aa  SELD_ECO24 RecName: Full=Selenide, water dikinase;       
   34::245     2e-04  29%  338 aa  PUR5_METTH RecName: Full=Phosphoribosylformylglycinamidine
   38::268     2e-04  25%  333 aa  PUR5_METBF RecName: Full=Phosphoribosylformylglycinamidine
   49::256     3e-04  24%  346 aa  SELD_HAEIN RecName: Full=Selenide, water dikinase;       
   50::257     3e-04  24%  347 aa  SELD_HAEIG RecName: Full=Selenide, water dikinase;       
   50::257     3e-04  24%  347 aa  SELD_HAEI8 RecName: Full=Selenide, water dikinase;       
   47::254     4e-04  27%  343 aa  SELD_CARHZ RecName: Full=Selenide, water dikinase;       
   34::121     4e-04  29%  339 aa  PUR5_METS3 RecName: Full=Phosphoribosylformylglycinamidine
   38::285     4e-04  26%  333 aa  PUR5_METAC RecName: Full=Phosphoribosylformylglycinamidine
   17::256     5e-04  25%  347 aa  SELD_SHIFL RecName: Full=Selenide, water dikinase;       
   17::256     5e-04  25%  347 aa  SELD_SHIF8 RecName: Full=Selenide, water dikinase;       
   49::263     5e-04  30%  348 aa  SELD_PORG3 RecName: Full=Selenide, water dikinase;       
   49::259     5e-04  25%  347 aa  SELD_PHOLL RecName: Full=Selenide, water dikinase;       
   17::256     5e-04  25%  347 aa  SELD_ENT38 RecName: Full=Selenide, water dikinase;       
   17::256     5e-04  25%  347 aa  SELD_ECOLI RecName: Full=Selenide, water dikinase;       
   17::256     5e-04  25%  347 aa  SELD_ECOHS RecName: Full=Selenide, water dikinase;       
   90::270     5e-04  26%  349 aa  PUR5_LACDB RecName: Full=Phosphoribosylformylglycinamidine
   90::270     5e-04  26%  349 aa  PUR5_LACDA RecName: Full=Phosphoribosylformylglycinamidine
   86::254     7e-04  28%  341 aa  PUR5_SYNP2 RecName: Full=Phosphoribosylformylglycinamidine
   49::138     7e-04  31%  351 aa  PUR5_LYSSC RecName: Full=Phosphoribosylformylglycinamidine
   88::259     7e-04  24%  345 aa  PUR5_LACRJ RecName: Full=Phosphoribosylformylglycinamidine
   88::259     7e-04  24%  345 aa  PUR5_LACRD RecName: Full=Phosphoribosylformylglycinamidine
   38::162     0.001  29%  336 aa  PUR5_THEP3 RecName: Full=Phosphoribosylformylglycinamidine
   88::276     0.001  23%  349 aa  PUR5_LACH4 RecName: Full=Phosphoribosylformylglycinamidine
   87::260     0.001  27%  339 aa  PUR5_FUSNN RecName: Full=Phosphoribosylformylglycinamidine
  138::319     0.001  23%  389 aa  PUR5_ARATH RecName: Full=Phosphoribosylformylglycinamidine
  117::205     2e-04  30%  452 aa  Y1416_METJA RecName: Full=Uncharacterized protein MJ1416;(query 67->159)
    1::725

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
PURL_THET8      MEALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
PURL_THET2      MEALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
PURL_THETN      MNKIWRELGLTDEEYEKIISILGREPNITELGMYSVMWSEHCSYKNSKPLLKYLPTKGERVIQGPGENAG
PURL_THEP3      MDKIWRELGLTDEEYEKIISILGREPNITEIGMYSVMWSEHCAYKNSKPLLKYLPTKGERVIQGPGENAG
PURL_THEPX      MDKIWRELGLTDEEYEKIISILGREPNITEIGMYSVMWSEHCAYKNSKPLLKYLPTKGERVIQGPGENAG
PURL_GEOSW      -EKLYREMGLTDEEFAMIEKILGRLPNYTETGIFSVMWSEHCSYKNSKPVLKKFPTEGKHVLQGPGEGAG
PURL_EXISA      -ERIYATMGLSDDEYALVVSLLGREPNYTEIGLFSVMWSEHCSYKNSKPVLRKFPTTGKHVLQGPGEGAG
PURL_ANOFW      -QKMYRDMGLTDEEFAMIERILGRLPNYTETGIFSVMWSEHCSYKNSKPVLKKFPTEGKHVLQGPGEGAG
PURL_THEEB      --------GLKPQEYTEIVRRLGRHPNRAELGMFGVMWSEHCCYKNSRLLLKQFPTQGPRVLVGPGENAG
PURL_GEOTN      -QKLYREMGLTDEEFARIEAILGRLPNYTETGIFSVMWSEHCSYKNSKPVLKKFPTDGPHVLQGPGEGAG
PURL_GEOKA      -QKLYREMGLTDEEFARIEAILGRLPNYTETGIFAVMWSEHCSYKNSKPVLKKFPTDGPHVLQGPGEGAG
PURL_DEIRA      ----AATFGLTTEEYDLFVSQLGREPNALEAAIVGAMWSEHCGYKNSRPLFRAFPTTGPQVLQGPGENAG
PURL_THERP      ---ILREVALTEEEYARAVALLGREPNLIELGMIGALWSEHCGYKHSRPLLRKLPTSGPHVVQGPGENAG
PURL_MOOTA      -----RRMGLTDAEFEKVKAILGREPNYVELGMFAVMWSEHCGYKSSRSVLKLFPTKAPWVLQGPGENAG
PURL_OCEIH      -DRLYLDMGLSDEEFQRIKQILGRHPNFTETGIFSVMWSEHCSYKTSKPLLKKFPTDGPHVLQGPGEGAG
PURL_LISMF      -QKIYQEMGLTDSEYELVCSILGREPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAG
PURL_BACSU      -EKLYQQMGVSDDEFALIESILGRLPNYTEIGIFSVMWSEHCSYKNSKPILRKFPTSGERVLQGPGEGAG
PURL_ANADF      --------GLTQAEYDEVKRHLGREPNLTELGVFSVMWSEHCSYKSSRVHLKTFPTSGPRVLQGPGENAG
PURL_BACLD      -EKLYQQMGVSDDEFAMIESILGRLPNYTEIGIFSVMWSEHCSYKNSKPILKKFPTKGERVLQGPGEGAG
PURL_ALKMQ      -------VGLKAKEYEGIVEMLGREPNELELNLYGVMWSEHCSYKHSRSMFKHFPTSGPSVLQGPGENAG
PURL_NOSP7      --------GLKPEEYAEIVRRLGRHPNKAELGMFGVMWSEHCCYKNSRPLLKQFPTEGPRILVGPGENAG
PURL_GLOVI      -------------EYRRITELIGRHPNLNELGMFSVMWSEHCCYKNSRPLLKGFPTTGPRVLVGPGENAG
PURL_BACP2      -EKLYQQMGLSDEEFALIESIIGRLPNYTETGIFSVMWSEHCSYKNSKPVLSKFPTKGEHVLQGPGEGAG
PURL_LISW6      -QKIYQEMGLTDSEYELVCSILGREPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAG
PURL_BACCN      -ERIYAEMGLTDEEFAMIEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_ANAVT      --------GIKPEEYAEIVRRLGRHPNKAELGMFGVMWSEHCCYKNSRPLLKQFPTTGPRILVGPGENAG
PURL_BACA2      -EKLYQQMGVSDDEFALIESIIGRLPNYTEIGIFSVMWSEHCSYKNSKPVLRKFPTSGERVLQGPGEGAG
PURL_BACCZ      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_ANASK      --------GLKPDEYQRILEHLGRTPTLTELGVFSVMWSEHCSYKSSRVHLKTFPTSGPRVLQGPGENAG
PURL_BACHK      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_LISIN      -QKIYQEMGLTDSEYELVCSILGREPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAG
PURL_LISMC      -QKIYQEMGLTDSEYELVCSILGREPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAG
PURL_BACCQ      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACC7      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACC3      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACC1      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACC0      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACAN      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACAH      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACAC      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACAA      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_SYNY3      --------GIKPEEYEDIVQRLGRHPNKAELGMFGVMWSEHCCYKNSRPLLSNFPTEGERILVGPGENAG
PURL_BACC4      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_BACC2      -ERIYAEMGLTDEEFAMVERILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_ANADE      --------GLKPDEYQRILEHLGRVPTLTELGVFSVMWSEHCSYKSSRVHLKTFPTSGPRVLQGPGENAG
PURL_LISMH      -QKIYQEMGLTDSEYELVCSILGREPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAG
PURL_ENTFA      ---LYAEWGLTDEEYHQIETILQREPNYTETGLFSVMWSEHCSYKNSKPVLKKFPTEGPQVLQGPGEGAG
PURL_BACSK      -ERLYREMGLTDDEFALAEKIVGRPLNFTETGLFSVMWSEHCSYKNSKVLLKKFPTDGENVLQGPGEGAG
PURL_BACWK      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_LISMO      -QKIYQEMGLTDSEYELVCSILGREPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTEGKQVLQGPGEGAG
PURL_BACCR      -ERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAG
PURL_ANASP      --------GIKPEEYAEIVRRLGRHPNKAELGMFGVMWSEHCCYKNSRPLLKQFPTTGPRILVGPGENAG
PURL_THELT      -----RDLGLTDKEYEKIVELLHREPNEVELGMFSVMWSEHCSYKHTKHLLRDLPTSGERVIQGPGENAG
PURL_CARHZ      -----REMGLTDEEYRRIVEYLGREPNEVELGMCAVMWSEHCSYKSSKIHLKKLPTRGPAVVQGPGENAG
PURL_ACAM1      -EEIATE-GLKPEEYDDIVQRLGRHPNRAELGMFGVMWSEHCCYKNSRPLLSQFPTEGKHVLVGPGENAG
PURL_SYNJA      -----KAHGLSPEEYRQIQQQLGRDPNPTELAMFGVMWSEHCCYKNSRPLLKHFPTTGERVVVGPGENAG
PURL_SYNP6      --------GIKPEEYDAIVERLGRHPNKAELGMFGVMWSEHCCYKNSRPLLSQFPTEGLRILVGPGENAG
PURL_SYNE7      --------GIKPEEYDAIVERLGRHPNKAELGMFGVMWSEHCCYKNSRPLLSQFPTEGLRILVGPGENAG
PURL_SYNJB      -----KAHGLSPAEYQQIQQQLGRDPNPNELAMFGVMWSEHCCYKNSRPLLKNFPTTGERVVVGPGENAG
PURL_ANAD2      --------GLKPEEYQRILEHLGRTPTLTELGVFSVMWSEHCSYKSSRVHLKTFPTSGPRVLQGPGENAG
PURL_SYMTH      -------VGLTEAEYRRVVEILGREPNPTELHMFGVMWSEHCAYKHSKAALRRLPTRGEHVLQGPGENAG
PURL_SYNPX      --AALKQEGLKPSDWQEICRRLGREPNRAELGMFGVMWSEHCCYRNSRPLLRGFPTEGPRILVGPGENAG
PURL_LACLS      -----REWGLTDEEYLKIKDEIGRLPNFTETGMYAVMWSEHCCYKNSKPVLKKFPTTGPQVLMGPGEGAG
PURL_LACLM      -----REWGLTDEEYLKIKDEIGRLPNFTETGMYAVMWSEHCCYKNSKPVLKKFPTTGPQVLMGPGEGAG
PURL_LACLC      -----REWGLTDEEYLKIKDEIGRLPNFTETGMYAVMWSEHCCYKNSKPVLKKFPTTGPQVLMGPGEGAG
PURL_BACHD      -QKIYREMGLTDEEFALVESILGRLPNYTETGLFSVMWSEHCSYKNSKVLLKKFPIDGDKVLQXXXXXXX
PURL_SYNPW      MASALRQEGLTQEDYIEIQRRLGRDPNRAELGMFGVMWSEHCCYRNSRPLLRGFPTDGPRILVGPGENAG
PURL_PROMM      --AALRHEGLKPHDYDEICRRLQRAPNRVELGMFGVMWSEHCCYRNSRPLLSSFPTSGHRILVGPGENAG
PURL_METSB      --------GLKPDEYQRILDLIGRVPTFTELGIFSAMWNEHCSYKSSRLHLRALPTKAPWVIQGPGENAG
PURL_LACLA      -----REWGLTDEEYLKIKDEIGRLPNFTETGMYAVMWSEHCCYKNSKPVLKKFPTTGPQVLMGPGEGAG
PURL_AZOC5      ---LVAEHGLKPDEYQRFVELIGREPTITELGIVSAMWNEHCSYKSSKVWLRTLPTKGPRVIQGPGENAG
PURL_ZYMMO      --------GLSPEEYDTIKQALGRTPNLVELGIFSAMWSEHCSYKSSRKHLRELPTTGSQVICGPGENAG
PURL_PROM3      --AALRHEGLKPDDYDEICRRLQRAPNRVELGMFGVMWSEHCCYRNSRPLLSSFPTTGHRILVGPGENAG
PURL_CYAP4      --------GLKPEEYAEIVQRLGRHPNLAELGMFGVMWSEHCCYKNSRPLLKQFPTQGQRVLVGPGENAG
PURL_PROMA      VELALKKEGLTKADYIEICNRLKRSPNRTELGMFGVMWSEHCCYRNSRSLLSNFPTTGKNILVGPGENAG
PURL_RHOPB      --------GLKPDEYQRILKLIGREPSLTELGIFSAMWNEHCSYKSSRLHLKGLPTKAPWVLQGPGENAG
PURL_STAHJ      LEKLYQDMGLSDAEYNKVCEILGREPNFTEVGIFSVMWSEHCSYKHSKPFLKQFPTTGEHVLMGPGEGAG
PURL_RHORT      ---IVAEHGLTEAEYAKVLAIMGREPNLVELGIFSVMWSEHCSYKSSKKWLKTLPTTAPWVIQGPGENAG
PURL_SYNS9      VSAALKQEGLKSSDWDEICRRLGREPNRAELGMFGVMWSEHCCYRNSRPLLSGFPTEGPRILVGPGENAG
PURL_BRASB      --------GLKPDEYERILKLIGRVPTFTELGIFSAMWNEHCSYKSSRIHLRGLPTKAPWVIQGPGENAG
PURL_PROMT      --ALEQE-GLKQSDYAEICRRLNRAPNRNELGMFGVMWSEHCCYRNSRPLLKNFPTTGSRILVGPGENAG
PURL_PROM1      MSALKQE-GLKQSDYVEICRRLNRGPNRNELGMFGVMWSEHCCYRNSRPLLKNLPTTGSRILVGPGENAG
PURL_STAAN      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_STAAM      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_STAA9      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_STAA2      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_STAA1      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_PROM2      -EALKVE-NLTLNDYEEICKRLKRKPNRTELGMFGVMWSEHCCYRNSKPLLSKFPTEGKHVLVGPGENAG
PURL_STAES      LEKLYQDMGLSDKEYDKVVEILGREPNFTEVGIFSVMWSEHCSYKHSKPFLKQFPTTGEHVLMGPGEGAG
PURL_STAEQ      LEKLYQDMGLSDKEYDKVVEILGREPNFTEVGIFSVMWSEHCSYKHSKPFLKQFPTTGEHVLMGPGEGAG
PURL_ERYLH      --------GLSSEEYDVILKALGREPNLVELGIFSVMWSEHCSYKSSRLHLKKLPTEAPWVICGPGENAG
PURL_STAAW      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_STAAT      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_STAAS      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_STAAE      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_STAAC      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_STAA8      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_STAA3      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGDHVLMGPGEGAG
PURL_PROM0      -EALQVE-NLTLNDYEEICKRLKKKPNRTELGMFGVMWSEHCCYRNSKPLLSKFPTKGKNVLVGPGENAG
PURL_PARL1      ---LIAEHGLKPDEYQRILDLIGREPTLTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPRVICGPGENAG
PURL_PROMS      -EALKVE-NLTLNDYEEICKRLKRKPNRTELGMFGVMWSEHCCYRNSKPLLSKFPTKGKNVLVGPGENAG
PURL_STAS1      IEQLYKDMGLSDEEYAKVCDILGREPNFTEIGIFSVMWSEHCSYKHSKPFLTQFPTSGEHVLMGPGEGAG
PURL_STAAR      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_LACPL      -----RDWGLTDAEYQLLTDKLQRLPNETETGLFSGMWSEHCSYKNSKPVLKKFWTQGEQVLXXXXXXXX
PURL_BRASO      --------GLKPDEYERILKLIGREPTFTELGIFSAMWNEHCSYKSSRIHLKGLPTKAPWVIQGPGENAG
PURL_RHOPT      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSRIHLKGLPTKAPWVLQGPGENAG
PURL_STACT      -EKLYSDMGLTDAEYDKVVDILGREPNFTEVGIFSVMWSEHCSYKHSKPFLKQFPTTSEHVLMGPGEGAG
PURL_CHLTE      ---LAQEHGLNEEEYAKICEILGRTPSFTELGIYSVMWSEHCSYKNSIAVLKTLPRDGASLLTQAGENAG
PURL_RHOPA      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSRIHLKGLPTKAPWVLQGPGENAG
PURL_PROM9      -EALKVE-NLTINDYEEICKRLKRKPNRTELGMFGVMWSEHCCYRNSKPLLSNFPTKGKNILVGPGENAG
PURL_WOLSU      LASLLKSHKLSQADYEHIVQILGREPNLVELGVFSAMWSEHCSYKSSKKYLRGFPTEAAWVIQGPGENAG
PURL_STAAB      LEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHSKPFLKQFPTSGEHVLMGPGEGAG
PURL_RHOP2      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSRIHLKGLPTKAPWVLQGPGENAG
PURL_PROMP      -------------DYEEICKRLGRKPNRTELGMFGVMWSEHCCYRNSKPLLANFPTTGKNVLVGPGENAG
PURL_AQUAE      MERVWEAYGLTEEEYRKILKTLKREPNHVELGVLGALWSEHCSYKSSKKHLKKFPTKAEWVVQGPGENAG
PURL_RHOPS      --------GLKPDEYQRILDLIGREPSFTELGIFSAMWNEHCSYKSSRIHLRGLPTKAPWVLQGPGENAG
PURL_LACS1      ------EWGLTQKEYEYICDKLGRLPNYTETGLFSVMWSEHCSYKKSKPVLKLFPNKNERVLQGPGEGAG
PURL_SALRD      ---LALDHGLTDDEYDEILDRLGRTPTFTELGIYSVMWSEHCSYKNSTALLKTLPTEGDQLLAEVGENAG
PURL_MACCJ      ---LYQDMGLSDKEYDKVVDILGRMPNYTEIGIFSVMWSEHCSYKHSKPFLKQFPTTGERVLMGPGEGAG
PURL_LEUMM      ------EWGLTEQEYDLIVKELKRLPNFTETGIFSGMWSEHVSYKKSKPILRKFWSSNERVLQGPGEGAG
PURL_RHOP5      --------GLKPDEYERILKLIGREPSLTELGIFSAMWNEHCSYKSSRIHLKGLPTKAPWVLQGPGENAG
PURL_NOVAD      --------GLSEEEYQRVLHALGREPNLVELGIFSVMWSEHCSYKSSRIHLKKLPTSAPWVICGPGENAG
PURL_JANSC      ---IIKAHGFTDDEYAEVNKILGRAPNYTEMGIFSAMWNEHCSYKSSKKWLRTLPTEGPQVICGPGENAG
PURL_LACSS      ---LYQQWGLTDSEYELICTKLKRLPNYTETGLFSVMWSEHCSYKNSKPILKKFPTNGPHVLQGPGEGAG
PURL_BRUSU      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUSI      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUO2      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUC2      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BEII9      --------GLKPDEYQRILTLIGREPSFTELGIFSAMWNEHCSYKSSRIHLRKLPTKAPWVIQGPGENAG
PURL_CAUCR      MAEMAAEFGLKPAEYDVVLKRLGREPNLVELGVFSVMWSEHCSYKSSKNQLKKFPIDGPRVICGPGENXX
PURL_BRUME      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUMB      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUAB      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUA2      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_BRUA1      --------GLKPDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPRVIQGPGENAX
PURL_SYNSC      --AALKQEGLKPSDWDEICRRLGREPNRAELGMFGVMWSEHCCYRNSRPLLSGFPTEGPRILVGPGENAG
PURL_THEGJ      -------------EEKLIRERLGREPNELEWAMLEVMWSEHASYKSSRPWLKLLPTENEHVILGPGEDAG
PURL_OCHA4      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPRVIQGPGENAX
PURL_GRABC      --SLAQEFGLDAAEYQRVLDIMGRTPSFTELGIFSVMWSEHCSYKSSRHWLKQLPTKAPWVIHGPGENAG
PURL_GLUOX      ---LAQSFGLTGEEYDKLVTIMGRTPSFTELGIFSVMWSEHCSYKSSRIHLKTLPTKAPWVIHGPGENAG
PURL_RHOS4      --------GLKPDEYQRILEIIGRAPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPQVICGPGENAG
PURL_PROM5      -------------DYEEICKRLGRKPNRTELGMFGVMWSEHCCYRNSKPLLANFPTTGKNVLVGPGENAG
PURL_AGRT5      --------GLKPDEYQRILDLIGREPSFTELGIFSAMWNEHCSYKSSKKWLKTLPTTGPRVIQGPGENAX
PURL_RHOSK      --------GLKPDEYQRILEIIGRAPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPQVICGPGENAG
PURL_BARQU      ---LIAQHGLKSDEYQHILTLIGREPTFTELGIFSAMWNEHCSYKSSKKWLKTLPIKGKCVIQGPGENAG
PURL_BARHE      ---LIAQHGLKNDEYQHILTLIGREPTFTELGIFSAMWNEHCSYKSSKKWLKTLPTKGNCVIQGPGENAG
PURL_CHLCH      ----AEEHGLSAEEFSQICTILGRTPTITELGIFSVMWSEHCSYKNSIAVLKTLPREGGALLTSAGENAG
PURL_NITHX      --------GLKPDEYERILKLIGRVPTFTELGIFSAMWNEHCSYKSSRIHLRGLPTKAPWVIQGPGENAG
PURL_MESSB      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSKRWLRTLPTSGPQVIQGPGENAG
PURL_RHOS5      --------GLKPDEYERILGIIGREPSFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPQVICGPGENAG
PURL_LACC3      ------DLGLTEAEYDRFAELIGHQPNDTEIGLASGMWSEHCAYKYSKPVLRQFWTKNERVLMGPGEGAG
PURL_NITWN      --------GLKPDEYERILKLLGRTPTFTELGIFSAMWNEHCSYKSSRIHLRGLPTKAPWVIQGPGENAG
PURL_NOCSJ      ------DLGLKADEYARIREILGRRPTSSELAMYSVMWSEHCSYKSSKVHLKQFSELAEVLAQGIGENAG
PURL_SILST      --------GLKPDEYDLILEIIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPQVICGPGENAG
PURL_PYRKO      -------------EEKLIRERLGREPNEVEKAMLEVMWSEHASYKSSRPFLKLLPTENEHVVLGPGEDAG
PURL_PELUB      -EQLAIDHGLKKDEYKKICDLLKRVPNITELGIFSAMWNEHCSYKSSRFHLKNLPTKGKNVIQGPGENXX
PURL_LACRJ      ---------LTEAEYDYITQLLGRLPNYTETGLFSAMWSEHCSYKKSKPVLRLFPNKNERVLQGPGEGAG
PURL_LACRD      ---------LTEAEYDYITQLLGRLPNYTETGLFSAMWSEHCSYKKSKPVLRLFPNKNERVLQGPGEGAG
PURL_ACICJ      --ALARSFGLAAEEYDRVLAIMGRVPTLTELGIFSVMWSEHCSYKSSRIWLKTLPTTAPWVIHGPGENAG
PURL_SULDN      -------------DYAHIKQILGREPNLVEIGIFSAMWSEHCSYKSSKVHLSGFPTKAPWVIQGPGENAG
PURL_NITSB      IEEILKAHKLTMEDYEHIKKILGREPNLVEIGIFSAMWSEHCSYKSSKKYLKGFPTEAPWVIQGPGENAG
PURL_LACF3      ---------LSEREYDYISEKLGRLPNFTETGLFSAMWSEHCSYKKSKPVLRLFPNQNDRVLQGPGEGAG
PURL_LACDB      ---------LSEEEYDYICDKLHRLPNYTETGLFAAMWSEHCSYKKSKSVLRLFPTKGPRILQGPGEGAG
PURL_LACDA      ---------LSEEEYDYICDKLHRLPNYTETGLFAAMWSEHCSYKKSKSVLRLFPTKGPRILQGPGEGAG
PURL_CAMJJ      ---------ISDEEYAQILEILGREPNLLELGVISAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_CAMJD      ---------ISDEEYTQILEILGREPNLLELGVISAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_SILPO      --------GLKPEEYDMILEIIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTSGPQVICGPGENAG
PURL_CAMJ8      ---------ISDEEYAQILEILGREPNLLELGVISAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_AGRVS      --------GLKPEEYDRILQLIGREPTFTELGIFSAMWNEHCSYKSSKRWLRTLPTTGARVIQGPGENAX
PURL_SULNB      LDEVLKNHKLSKEEYEDILRILGRHPNIVEIGIFSAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_CAMJE      ---------ISDEEYAQILEILGREPNLLELGVISAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_CAMJR      ---------ISDEEYTQILEILGREPNLLELGVISAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_LEPBL      ----ALEHGLTAEEFQKIQEILGRIPNSTELGIFSAMWSEHCSYKNSVLKLKTLPTSSDKLLAKAGENAG
PURL_LEPBJ      ----ALEHGLTAEEFQKIQEILGRIPNSTELGIFSAMWSEHCSYKNSVLKLKTLPTSSDKLLAKAGENAG
PURL_BRAJA      --------GLKPDEYERILKLIGREPTFTELGIFSAMWNEHCSYKSSRIHLRGLPTKAPWVIQGPGENAG
PURL_LEPBP      ----AKEHGLTETEFVEIQKILGRIPNSTELGIFSAMWSEHCSYKNSILKLKTLPTKSDKLLXXXXXXXX
PURL_LEPBA      ----AKEHGLTETEFVEIQKILGRIPNSTELGIFSAMWSEHCSYKNSILKLKTLPTKSDKLLXXXXXXXX
PURL_THESM      -------------EEKLIKERLGREPNEVEKAMLEVMWSEHASYKSSRKWLKLLPTENEHVILGPGEDAG
PURL_RHIFR      --------GLKPDEYERILSLIRREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_PARDP      -EELIAAHGLKPDEYQRILEIIGREPSFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPQVICGPGENAG
PURL_LEPIN      ----ALEHGLTKEEFQKIQEILGRIPNSTELGIFSAMWSEHCSYKNSILKLKTLPTTSDKLLAKAGENAG
PURL_FRASC      -----QELGLTDDEYARIIATLGRRPSDAELAMYSVMWSEHCSYKSSKVHLRQFRDTPDRLLVGMGENAG
PURL_LACH4      ---------LTEHEYDYICDKLKRLPNYTEIGLFSAMWSEHCSYKKSKPVLRLFPTKGKRVVQGPGEGAG
PURL_LEPIC      ----ALEHGLTKEEFQKIQEILGRIPNSTELGIFSAMWSEHCSYKNSILKLKTLPTTSDKLLAKAGENAG
PURL_BART1      --------GLKEDEYQRILTLIGREPTFTELGIFSAMWNEHCSYKSSKKWLKTLPTEGKCVIQGPGENAG
PURL_AGRRK      --------GLKPDEYQRILDLIGREPSFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_RHIME      --------GLKPDEYERILNLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_ROSDO      --------GLSPDEYDRILNIVGRTPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPQVICGPGENAG
PURL_BARBK      --------GLKIDEYQRILELIGREPTFTELGIFSAMWNEHCSYKSSKKWLKTLPTKGKCVIQGPGENAG
PURL_LACCA      ------DLGLTEAEYDRFAELIGHQPNDTEIGLASGMWSEHCAYKYSKPVLRQFWTKNERVLMGPGEGAG
PURL_FRASN      -----RELGLTDDEYERIVATLGRVPTDAELAMYSVMWSEHCSYKSSKVHLRQFTPATDRLLVGMGENAG
PURL_PETMO      IKEIALELGISREEFDLIEEKLGRIPNEFETYLFSAQWSEHCGYKHSKHYLKKINESYES------ENAG
PURL_TROWT      -------LGLTESEYTQICSLLKRSPTKSELAIYSVLWSEHCSYKSSRRHLRQLADLTEVLLVGIGQNAG
PURL_TROW8      -------LGLTESEYTQICSLLKRSPTKSELAIYSVLWSEHCSYKSSRRHLRQLADLTEVLLVGIGQNAG
PURL_RHILO      --------GLKPDEYQRILDLVGREPSFTELGIFSAMWNEHCSYKSSKKWLRTLPTTGPQVIQGPGENAX
PURL_SINMW      --------GLKPDEYERILNLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_CAMLR      ---IIKQHKISDEEYQEILNILGREPNLLELGVISAMWSEHCSYKSSKKYLSGFPTKAPWVIQGPGENAG
PURL_CAMHC      ---------ISDSEYKKILEILGREPNLLELGIFSSMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENAG
PURL_RHIEC      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_RHIE6      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_RHIL3      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_PELLD      --ALAAEHGLNAEEYQKIQEVLGRTPTFTELGIFSVMWSEHCSYKNSIAVLKTLPRXXXXXXXXXXXXXX
PURL_PYRAB      -------------EEKIIRERLGREPNEVEKAMLEVMWSEHVSYKSSRKWLKLLPTKNEHVILGPGEDAG
PURL_LACAC      ---------LSEHEYDYICDHLHRLPNYTEIGLFSAMWSEHCSYKKSKPVLKLFPTKGKRVVQGPGEGAG
PURL_RHISN      --------GLKPDEYERILNLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRMLPTKGPRVIQGPGENAX
PURL_HELHP      -------------DYEEILKILKRPPNLIELGIFAAMWSEHCSYKSSKKYLNGFPTKAPWVVQGPGENAG
PURL_RHILW      --------GLKPDEYQRILDLIGREPTFTELGIFSAMWNEHCSYKSSKKWLRTLPTKGPRVIQGPGENAX
PURL_CORA7      LEQPYRELGLKDDEYAHIREILGRRPTDAELTMYSVMWSEHCSYKSSKTHLRYFGETGSKILAGIGENAG
PURL_RENSM      ------ELGLKDNEFARINEILGRRPTAAELAMYSVMWSEHCSYKSSKVHLKVTEEMKKHLLVGIGENAG
PURL_CAMC5      -KATIKAHKINEQEYEEILKILGREPNLLELGIFSAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENXX
PURL_THEFY      ------ELGMKDEEYARVREILGRRPTSAELAIYSVMWSEHCSYKSSKVHLRQFGEKADVLLVGIGENAX
PURL_MYCA9      ------ELGLKDDEYARIREILGRRPTDAELAMYSVMWSEHCSYKSSKVHLRTTEEMRSAMLAGIGENAG
PURL_METTH      ---------LTDSEMEFIRKELGRDPNPLEYGMLDVMFSEHCSYKSSRPVLGLFPTEGEDVIIGPGDDAG
PURL_PYRHO      -------------EEKLIRERLGREPNDVERAMLEVMWSEHVSYKSSRKWLKLLPTKNEHVVLGPGEDAG
PURL_MYCVP      -----RELGLKDDEYERIREILGRRPTDAELAMYSVMWSEHCSYKSSKVHLRTTEKMRETMLAGIGENAG
PURL_CORAM      -----EELGLKQDEYDKIVGILGRRPTDAELTVYSVMWSEHCSYKSSKTHLRTTEEMASKILAGIGENAG
PURL_CALMQ      -------MGLTSDEAKIIINTLGRNPTEAEWLIFEAEWSEHCSYKSSRAWIRLLPSKSPLVIRGSGLDAP
PURL_PYRFU      -------------EEKLIREKLGREPNDLEKAMLEVMWSEHVSYKSSRKWLKLLPTKNEHVILGPGEDAG
PURL_CAMC1      ---------ISDEEYEEILKILGREPNLLELGIFSAMWSEHCSYKSSKKYLNGFPTKAPWVIQGPGENXX
PURL_MYCGI      -----RELGLKDDEYERIREILGRRPTDAELAMYSVMWSEHCSYKSSKVHLRTTEKMREIMLAGIGENAG
PURL_METJA      -----------ENDLKYIEKVLGRKPNHIELAMFENLWSEHCAYRTSKKLLRMFAKTSKNIVVGIGDDAA
PURL_METKA      -------------------------PNATERAMFENMWSEHCAYRSTRHLLRQLPSEADHVIVGPGDDAA
PURL_STRCO      ------ELGLKKDEYERVVEILGRRPTGAELAMYSVMWSEHCSYKSSKVHLRQFGEQSDAMLVGIGENAG
PURL_STRAW      ------ELGLKKDEYERVVEILGRRPTGAELAMYSVMWSEHCSYKSSKVHLRQFGEQSDALLVGIGENAG
PURL_LEIXX      -------LGLKPDEYASIREILGRRPTNGELAMYSVMWSEHCSYKSSKIYLKVTPAMKKNLMVGMGENAG
PURL_MYCTU      ------ELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGETTSAMLAGIGENAG
PURL_MYCTA      ------ELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGETTSAMLAGIGENAG
PURL_MYCBT      ------ELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGETTSAMLAGIGENAG
PURL_MYCBP      ------ELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGETTSAMLAGIGENAG
PURL_MYCBO      ------ELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGETTSAMLAGIGENAG
PURL_MYCPA      ------ELGLKDDEYQRIREILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRTTDEMRAGMLAGIGENAG
PURL_MYCA1      ------ELGLKDDEYQRIREILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRTTDEMRAGMLAGIGENAG
PURL_RHOE4      -----KELGLKDDEYARIKEILGRRPTDAELAMYSVMWSEHCSYKSSKVHLKTTTDEMRAMLAGIGENAG
PURL_METAC      ---------LPEEDLKIIRKELGREPTLVEQGCFLNLWSEHCSYRSSAPLLKTFTSTGENVLIGPGDDAA
PURL_CORJK      ------ELGLKDDEYARIKELLGRRPTDAELAMYSVMWSEHCSYKSSKTHLRTTEEMKSKMLAGIGENAG
PURL_RHOSR      -----KELGLKDDEYARIKEILGRRPTEAELAMYSVMWSEHCSYKSSKVHLKTTDEMRSSMLAGIGENAG
PURL_METMA      ---------LPEEDLKIIKKELGREPTLVEQGCFLNLWSEHCSYRSSAPLLKTFTTTGENVIIGPGDDAA
PURL_MYCLE      ------ELGLREDEYQRVREILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGXXXXGMLAGIGENAG
PURL_MYCLB      ------ELGLREDEYQRVREILGRRPTDTELAMYSVMWSEHCSYKSSKVHLRYFGXXXXGMLAGIGENAG
PURL_NOCFA      -----KELGLKDDEYARIKEILGRRPTDAELAMYSVMWSEHCSYKSSKVHLRTTEEMRKSMLAGIGENAX
PURL_RHOOB      -----KELGLKDDEYARIKEILGRRPTEAELAMYSVMWSEHCSYKSSKVHLRTTDEMRSSMLAGIGENAG
PURL_PYRAE      -------MALSPGELELIRSALGREPTEVEYALFRSHWSEHCSYKSTRMWLRRLPSKAPWVVRGPGTDAP
PURL_COREF      ------ELGLKDDEYARIKEILGRRPTDAELTVYSVMWSEHCSYKSSKVHLRTTPEMAEKILAGIGENAG
PURL_PROAC      ------ELGLSADEYQRIREILGRRPTGGELAMYSVMWSEHCSYKSSKKYLRRLPQQTPLLLAGIGDNAG
PURL_METS3      -----------EMEYIEGI--LGRKMNELEEGMLDVMFSEHCSYKSSRPILGTFPTEGENIILGPGDDAG
PURL_META3      -----------------IEEQLGRKPNDVEIGMFENLWSEHCSYRSTKKLLSMFGKENQNIVVGPGDDAA
PURL_CORGB      -------LGLKDDEYARIKEILGRRPTDAELTVYSVMWSEHCSYKSSKVHLRTTEEMASKILAGIGENAG
PURL_CORGL      -------LGLKDDEYARIKEILGRRPTDAELTVYSVMWSEHCSYKSSKVHLRTTEEMASKILAGIGENAG
PURL_PYRCJ      -------MALTAAELEAIRRGLGRGPTPVELALFTAHWSEHCAYKSTRGRLSRLPSKAPWVVKGPGTDAP
PURL_METST      ---------LTDDELKYIEEVLGRKPNELELGMMDVMFSEHCSYKSSKPILRNFPTDGPDVILGPGDDAG
PURL_HALMA      -------MSLSDADHELVVEEIGREPTRAEAALFENLWSEHCAYRSSRPLLSAFDSEGDQVVIGPGDDAA
PURL_PYRAR      -------------EELEVIERLGRPPSEVELALFRSHWSEHCSYKSTRMWLRRLPSRAPWVVRGPGTDAP
PURL_METBF      ---------LPEEDLKIIKKELGREPTLVEQGCFLNLWSEHCSYRSSAPLLKTFTSKGENVIIGPGDDAA
PURL_METTP      -------IGMSASEARSIASILGRDPTLAELFCYDAMWSEHCSYKSSRAVLRELPTEGPNVVLGPVEDAG
PURL_ARCFU      ---------------QDYFRQKGRNPYDIELQSLAQAWSEHCCYKSSKYYLRQYLLEADYVISAIEEDAG
PURL_IGNH4      ----------------------GRKPNQVELAMFEAQWSEHCSYKSSRKHLRKLKMDSPWVVKGG--DAA
PURL_THENV      ----------------ELIRRLGREPTAAELAFFTSHWSEHCSYKSTRRWLRELPGSAPWVVRGRGTDAP
PURL_THEMA      -------------------EKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTG---FEG---NAG
PURL_PYRIL      -------------------------PTAAELAFFTSHWSEHCSYKSTKMWLRELPGSAPWVVRGRGTDAP
PURL_HALWD      ---------LSDSDLELITTELGRELTPAEAALFENLWSEHCAYRSSRPLLQSFTTEGEHVVIGPGDDAA
PURL_SULAC      ----------------ELVRKLGREPKEEEWLVVDALWSEHCSYKSSKIFLRSFPSEGERVVMGDWQDAG
PURL_SULTO      ------KITLSSYEMELVRKKLAREPNEAEWLTIDALWSEHCSYKSSKVFLRSFPSEGEKVLMGDWQDAG
PURL_NATPD      ---------------RELVEELGREPTPAEEALFENLWSEHCAYRSSQPLLSAFESEXXXXLPDPGENSD
PURL_HALLT      -------MSLSEPDHELVVAELGREPTAAEVALFENLWSEHCAYRSSRPLLSAFESEGDQVVVGPGDDAA
PURL_SULIA      -------------EMDDIRKRLDREPNEIEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_SULIM      -------------EMDDIRKRLDREPNEIEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_SULIK      -------------EMDDIRKRLDREPNEIEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_SULIY      -------------EMDDIRKRLDREPNEIEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_SULIN      -------------EMDDIRKRLDREPNEIEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_SULIL      -------------EMDDIRKRLDREPNEIEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_SULSO      -------------EMDEIRKRLGREPNETEWRVIDAVWSEHCXXXXXXXXXXXXXXXXPNVIMGDWQDAG
PURL_METS5      ----------------EVVRRLGREPKEAEWKLVDALWSEHCSYKSSKVFLRSLPSTGPNVIMSDWQDAG
PURL_HALSA      -------MSLGDSDRERVVAALGRDPTPAEAALFENLWSEHCAYRSSRSLLSAFDSDSEXXXXXXXXXXX
PURL_HALS3      -------MSLGDSDRERVVAALGRDPTPAEAALFENLWSEHCAYRSSRSLLSAFDSDSEXXXXXXXXXXX
PURL_PICTO      LDLIGKSLALSHDEMKKYFTEIKRNPSDVELQAIAQSWSEHSCXXXXXXXXXXXXXRNERTILAMEDDAG
PURL_THEVO      ---------------RDYFIKEGRDPIDAEIHAIAQSWSEHCXXXXXXXXXXXXXTKTDYTILAMEDDAG
PURL_THEAC      ---------------RSYFERLGRDPIDAEIHAVAQSWSEHCXXXXXXXXXXXXXXXXDYTILAMEDDAG
PURL_METTM      ---------LTDSEIEFIRKELGRDPNPLEYGMLDVMFSEHCSYKSSRPVLGFFPTEGEGVIIGPGDDAG
PUR4_MANSM      ---------------------LGRNPNDIELYMFAQANSEHCRHKQEKSLFKMIKKTPDHVLSAYKDNAA
PUR4_PHOLL      -------------------QKLGRNPTDVELYMFAQANSEHCRHKQPKSLFKMIKNTYEQVLSAYKDNAA
PUR4_PSEA6      -------------------EKLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTYEKVHSAYADNAA
PUR4_SCHPO      -----------------------REPTDVELFMFGQVNSEHCRHKKDYSLFKMIRKNPQYTISAYSDNAA
PUR4_SODGM      --------------------RLGRNPSDVELYMFAQANSEHCRHKDGQPQAKSLFKTPEYVLSAYKDNAS
PUR4_HAHCH      ---------------------LGRNPTDVELMMFAQANSEHCRHKQSHSLFGMIEQGGQDVLSAYCDNAA
PUR4_SHESR      -------LALAEDEIDYLVERLNRNPNDIELMMFAQANSEHCRHKQPKSLFKMIKKDNAAVMEGPDPNGV
PUR4_SHESM      -------LALAEDEIDYLVERLNRNPNDIELMMFAQANSEHCRHKQPKSLFKMIKKDNAAVMEGPDPNGV
PUR4_PASMU      -------LALAEDEIDYLVENLGRNPNDIELYMFAQANSEHCRHKQEKSLFKMIKKTPDHVLSAYKDNAA
PUR4_PSEHT      --------------------KLGRNPNDIELFMFAQANSEHCRHKQPKSLFKMIKKNPENVLSAYKDNAA
PUR4_SHEDO      --------------------RLKRNPNDIELMMFAQANSEHCRHKQDKSLFKMIKKDNAAVMTGPDETGV
PUR4_PSEAE      ---------------------LGRNPHDVELMMFAQANSEHCRHKQDKSLFGMIKNNREGVLSAYKDNAA
PUR4_ECOUT      --------------------RLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_SHEON      -------LALAEDEIDYLVERLNRNPNDIELMMFAQANSEHCRHKQPKSLFKMIKKDNAAVMEGPDPNGV
PUR4_PSEPK      -DALAKALALAEDEIDYLVQGLKRNPNDIELMMFAQANSEHCRHKDGQAQEKSLQMHNEGVLSAYKDNAS
PUR4_VIBVY      -------LALAEDEIDYLVEKLGRNPNDIELMMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_VIBVU      -------LALAEDEIDYLVEKLGRNPNDIELMMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_SALTY      ---------------QEAFTKLGRNPNDIELYMFAQANSEHCRHKDGKPQPKSLFKTPDYVLSAYKDNAA
PUR4_SALTI      ---------------QEAFTKLGRNPNDIELYMFAQANSEHCRHKDGKPQPKSLFKTPDYVLSAYKDNAA
PUR4_SALCH      ---------------QEAFTKLGRNPNDIELYMFAQANSEHCRHKDGKPQPKSLFKTPDYVLSAYKDNAA
PUR4_MYXXD      ---------------------LKRNPTDVELMMFAQANSEHCRHKQERSLFQAIKQHKEGVLGAYKDNAA
PUR4_ECOLI      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_VIBCH      ----------------ESFTKLGRNPNDIELMMFAQANSEHCRHKQDKSLFKMIKNTFEQVLSAYKDNAA
PUR4_SHISS      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_SHIDS      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_PSESM      ---------------------LGRNPHDIELMMFAQANSEHCRHKDGQSQEKSLEMHSEGVLSAYKDNAS
PUR4_ECOL6      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_ECOL5      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_ECO57      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_SHEFN      --------------------RLKRNPNDIELMMFAQANSEHCRHKQLKSLFKMIKNTFEVVLSAYKDNAA
PUR4_PSEU2      ---------------------LGRNPHDIELMMFAQANSEHCRHKDGQSQEKSLQMHSEGVLSAYKDNAS
PUR4_METFK      LEAANAEMGLAEVDYLENFQRMGRNPTDVELMMFAQANSEHCRHKNADWVIDGVAQAGKTVV-AYADNAS
PUR4_IDILO      ----------------ENFRKLDRNPNDIELYMFAQANSEHCRHKQPKSLFKMIKNTFETVLSAYKDNAA
PUR4_SHIBS      --------------------KLGRNPNDIELYMFAQANSEHCRHKQPKSLFRMIKNTFETVLSAYKDNAA
PUR4_SALPA      ---------------QEAFTKLGRNPNDIELYMFAQANSEHCRHKDGKPQPKSLFKTPDYVLSAYKDNAA
PUR4_PSE14      ---------------------LGRNPHDIELMMFAQANSEHCRHKDGQSQEKSLQMHSEGVLSAYKDNAS
PUR4_PHOPR      -------LALAEDEIDYLVENLGRNPNDIELMMFAQANSEHCRHKQEKSLFKMIKKNHEHVLSAYKDNAA
PUR4_VIBPA      -------LALAEDEIDYLVEKLGRNPNDIELMMFAQANSEHCRHKQEKSLFKMIKNTFETVLSAYKDNAA
PUR4_PSEF5      -------------------QGLKRNPHDIELMMFAQANSEHCRHKDGQSQEKSLQMHNEGVLSAYKDNAA
PUR4_YERPS      ---------------------LGRNPTDIELYMFAQANSEHCRHKQPKTLFKMIKNTFEHVLSAYKDNAA
PUR4_YERPN      ---------------------LGRNPTDIELYMFAQANSEHCRHKQPKTLFKMIKNTFEHVLSAYKDNAA
PUR4_YERPE      ---------------------LGRNPTDIELYMFAQANSEHCRHKQPKTLFKMIKNTFEHVLSAYKDNAA
PUR4_YERPA      ---------------------LGRNPTDIELYMFAQANSEHCRHKQPKTLFKMIKNTFEHVLSAYKDNAA
PUR4_HAES1      ---------------------LGRNPTDVELYMFAQANSEHCRHKQDKSLFKMIKKTPDYVLSAYKDNAA
PUR4_ERWCT      ----------------EAFNNLGRNPTDIELYMFAQANSEHCRHKQPKSLFKMIKNTFEHVLSAYKDNAA
PUR4_COLP3      --------------------KLGRNPHDIELYMFAQANSEHCRHKQEKSLFKMIRNTHEIVLSAYKDNAA
PUR4_PSEPF      ---------------------LKRNPHDIELMMFAQANSEHCRHKQEKSLFGMIKNHSEGVLSAYKDNAS
PUR4_VIBF1      -------------------EKLERNPTDIELMMFAQANSEHCRHKQEKSLFKMIKNTFEVVLSAYKDNAA
PUR4_HAEIN      ---------------------LKRNPQDVELYMFAQANSEHCRHKQDKSLFKMIKNTFEQVLSAYKDNAA
PUR4_HAEI8      ---------------------LKRNPQDVELYMFAQANSEHCRHKQDKSLFKMIKNTFEQVLSAYKDNAA
PUR4_RALSO      -------------------RKLGRNPTDVELMMFAQANSEHCRHKQDKSLFAMIRNTHQLAPQGTSDNAA
PUR4_YEAST      ---LALDSGEMEYLIHAFVETMKRDPTDVELFMFAQVNSEHCRHKNADWTIDGIKQQPEYTISAYSDNAA
PUR4_XYLFT      ----ADEIDYLRTRYTE----LNRVPSDVELMMFAQANSEHCRHKIFNATWTIDDKEQQYTLSAYADNAA
PUR4_XYLFA      ----ADEIDYLRTRYTE----LNRVPSDVELMMFAQANSEHCRHKIFNATWTINDKEQQHTLSAYADNAA
PUR4_ARATH      ----------------------------------------------------------------------
PUR4_DICDI      ----------------------------------------------------------------------
PUR4_NEIG1      ----------------ENYQALQRNPSDVELMMFAQANSEHCRHKNGEKQPKSLYKDNSSVIKGAAENQG
PUR4_HUMAN      ----------------------------------------------------------------------
PUR4_NEIMB      ----------------ENYQALQRNPSDVELMMFAQANSEHCRHKNGEKQPKSLYKDNSSVIEGAAENQG
PUR4_NEIMA      ----------------ENYQALQRNPSDVELMMFAQANSEHCRHKNGEKQPKSLYKDNSSVIEGAAENQG
PUR4_CAEEL      ----------------------------------------------------------------------
PUR4_MOUSE      ----------------------------------------------------------------------
PUR4_XANCP      ---------------RERFAALGRDPADVELMMFAQANSEHCRHKNASWTIDGKPQERQHTLSAYSDNAA
PUR4_XANAC      ---------------RERFGALGRDPADVELMMFAQANSEHCRHKNATWTIDGKPQERQHTLSAYSDNAA
PUR4_DROME      ----------------------------------------------------------------------
Y676_METJA      ------------------------------------------------------------------DDSA
THIL_METTH      ----------------------------------------------SRIISRARSVFGSSEVMGLGDDAA
SELD_ENTS8      -----------------------------------------CGCKISPKVLETILHSDQAKFIDPNDDAA
THIL_METJA      ---------------------------------------------------KTLKFSNENIVKGIDDDCA
SELD_GEOSL      ------------------------------------------------------------LLVGPADDAG
SELD_PSEPK      ----------------------------------------------------------------------
SELD_PASMU      ------------------------------------------------------------------DDAA
VP75_SHV21      ----------------------------------------------------------------------
SELD_SULDN      ----------------------------------------------------------------------
PUR5_PYRKO      ----------------------------------------------------------------------
PUR5_THETN      --------------------------------------------KMIKPFAEKTIKEG--VLEGIG----
PUR5_BACP2      --------------------------------------------------------------------SG
COR1B_RAT       ----------------------------------------------------------------------
SELD_DECAR      ----------------------------------------------------------------------
SELD_COLP3      ----------------------------------------------------------------------
SELD_GEOMG      ------------------------------------------------------------LLVGPADDAG
RPOB_CORK4      ---IARRSGVVETVCADFITTLGDDGQRDTFLLRKFERTNQGTCYNQKPLVEAGDREGQALADGPGTENG
Y1416_METJA     ----------------------------------------------------------------------
SELD_HAEDU      ------------------------------------------------------------------DDAA
PUR5_METMA      -----------------------------------------------------------APLTGIGHYAG
HYPE_AZOVI      ----------------------------------------------------------------------
HUPE_AZOCH      ----------------------------------------------------------------------
SELD_PHOPR      ------------------------------------------------------------------DDAA
SELD_YERPE      ------------------------------------------------------------------DDAA
SELD_AERS4      ------------------------------------------------------------------DDAA
SELD_AERHH      ------------------------------------------------------------------DDAA
Y787_SYNY3      ----------------------------------------------SRQGQQRLIGDGEAIRLGPDENGY
SELD_YERPS      ------------------------------------------------------------------DDAA
SELD_SHISS      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_SHIDS      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_SHIBS      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_ECOL6      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_ECOL5      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_ECO57      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_ECO24      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
PUR5_METTH      ------------------------------------------------------------VITGAGHFAA
PUR5_METBF      -----------------------------------------------------------APLTGIGHYAG
SELD_HAEIN      ------------------------------------------------------------------DDAA
SELD_HAEIG      ------------------------------------------------------------------DDAA
SELD_HAEI8      ------------------------------------------------------------------DDAA
SELD_CARHZ      ------------------------------------------------------------------DDAA
PUR5_METS3      ------------------------------------------------------------IITDSGHYAA
PUR5_METAC      -----------------------------------------------------------APLTGIGHYAG
SELD_SHIFL      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_SHIF8      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_PORG3      ------------------------------------------------------------------DDAG
SELD_PHOLL      ------------------------------------------------------------------DDAA
SELD_ENT38      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_ECOLI      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
SELD_ECOHS      -----------------------------------------CGCKISPKVLETILHSEQAKFVDPNDDAA
PUR5_LACDB      ----------------------------------------------------------------------
PUR5_LACDA      ----------------------------------------------------------------------
PUR5_SYNP2      ----------------------------------------------------------------------
PUR5_LYSSC      ----------------------------------------------------------ELNLKEPVLISG
PUR5_LACRJ      ----------------------------------------------------------------------
PUR5_LACRD      ----------------------------------------------------------------------
PUR5_THEP3      ----------------------------------------------------------------------
PUR5_LACH4      ----------------------------------------------------------------------
PUR5_FUSNN      ----------------------------------------------------------------------
PUR5_ARATH      ----------------------------------------------------------------------
Y1416_METJA     ------------------------------------------------------------------DDAG


                         .         .         *         .         .         .         .:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
PURL_THET8      VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
PURL_THET2      VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
PURL_THETN      VLDIGDNLAVVMKIESHNHPSAIEPYQGAATGVGGIIRDIFTMGARPIALLDSLRFGIPDDKRTKYLIEN
PURL_THEP3      VLDIGDNLAVVMKIESHNHPSAIEPYQGAATGVGGIIRDIFTMGARPIALLDSLRFGIPDDKRTKYLIEN
PURL_THEPX      VLDIGDNLAVVMKIESHNHPSAIEPYQGAATGVGGIIRDIFTMGARPIALLDSLRFGIPDDKRTKYLIEN
PURL_GEOSW      IVDIGDGLAVAFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFEH
PURL_EXISA      IVDIGDGQAVAFKIESHNHPSAIEPYQGAATGVGGIIRDIFSMGARPIALLNSLRFGDLNESRVKHLFGH
PURL_ANOFW      IVDIGDGLAVAFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFER
PURL_THEEB      VVDLGDGLRLAFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIALLNALRFGDLKEAKTQQLVKG
PURL_GEOTN      IVDIGDGLAVAFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFEH
PURL_GEOKA      IVDIGDGLAVAFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFEQ
PURL_DEIRA      VVDIGDGWGVAFKMESHNHPSAVEPVQGAATGVGGILRDIFAMGARPFAVLDSLRFGNPDSPRTRFLVNG
PURL_THERP      AVELGDGLVVVLKIESHNHPSAVEPFQGAATGVGGIVRDIFAMGARPIALADSLRFGPLEEPRQQYLFHG
PURL_MOOTA      IVDIGDGQAVVFKIESHNHPSAIEPFQGAATGVGGIVRDIFAMGARPIAVLNSLRFGPLDDSRTRYLMGG
PURL_OCEIH      VIDIGDEQAVVFKIESHNHPSAVEPYQGAATGVGGIIRDVFSMGARPIASLNSLRFGPLTNNRTKYLFSE
PURL_LISMF      IVDIGDGLGVAFKVESHNHPSYVEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHAKYLVSE
PURL_BACSU      IVDIGDNQAVVFKIESHNHPSALEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEE
PURL_ANADF      VVDLGDGLAAAFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIASANSLRFGDPSHPKTAYLLEG
PURL_BACLD      IVDIGDNQAVVFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEE
PURL_ALKMQ      IVDIGDGLAIAMKIESHNHPSAIEPYQGAATGVGGIIRDIFAMGARPIALLNSLRFGELEDARVKYLLEG
PURL_NOSP7      VVDLGDGLQLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNSLRFGSLEDAKTQRLFQG
PURL_GLOVI      VIDIGDGLRVAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIASLNSLRFGPLEDARNRALFRG
PURL_BACP2      IVDIGDNQAVVFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEE
PURL_LISW6      IVDIGDGLGVAFKVESHNHPSYVEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHSKYLVSE
PURL_BACCN      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDIFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_ANAVT      VVDLGEGLQLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNSLRFGSLEDPKTQRLFSG
PURL_BACA2      IVDIGDNQAVVFKIESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEE
PURL_BACCZ      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_ANASK      VVDLGDGLAAAFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIASLNALRFGDPSHPRTAYLLEG
PURL_BACHK      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_LISIN      IVDIGDGLGVAFKVESHNHPSYVEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHAKYLVSE
PURL_LISMC      IVDIGDGLGVAFKVESHNHPSYVEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHAKYLVSE
PURL_BACCQ      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACC7      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACC3      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACC1      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACC0      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACAN      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACAH      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACAC      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACAA      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_SYNY3      VVDLGDGLRLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIAILNSLRFGNLDDARNRRIFTG
PURL_BACC4      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_BACC2      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_ANADE      VVDLGDGLAAAFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIASLNALRFGDPSHPRTAYLLEG
PURL_LISMH      IVDIGDGLGVAFKVESHNHPSYVEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHAKYLVSE
PURL_ENTFA      IVDIGDGLAVVFKAESHNHPSAVEPYEGAATGVGGIIRDIFSMGARPIALLDSLRFGELTDARTRYLFQE
PURL_BACSK      IIDIKDEQAVVFKIESHNHPSAIEPYQGAATGVGGILRDVFSMGARPVALLNSLRFGELESKKVKYLFEE
PURL_BACWK      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_LISMO      IVDIGDGLGVAFKVESHNHPSYVEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELDTPHAKYLVSE
PURL_BACCR      IVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEE
PURL_ANASP      VVDLGEGLQLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNSLRFGSLEDPKTQRLFSG
PURL_THELT      VVDIGDNLVIVFKMESHNHPSAIEPFQGAATGIGGIVRDIFAMGARPIALLDSLRFGDLKSAKVKYLFSG
PURL_CARHZ      VVDIGDGLGIAFKIESHNHPSAIEPYQGAATGVGGIIRDIFAMGARPIALLDSLRFGKLHSPRVRHLFTG
PURL_ACAM1      VVDLGNGLQLAFKVESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGDLDDARTRRLFSG
PURL_SYNJA      VVDLGDGDWLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTLGARPIALLNSLRFGPLTDPRNRRLMAR
PURL_SYNP6      VVDLGDGLHLAFKVESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIAILNSLRFGDLEQPRTRRLFHG
PURL_SYNE7      VVDLGDGLHLAFKVESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIAILNSLRFGDLEQPRTRRLFHG
PURL_SYNJB      VVDLGEGDWLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTLGARPIALLNSLRFGPLTDPRNRRLMAR
PURL_ANAD2      VVDLGDGLAAAFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIASLNALRFGDPSHPRTAYLLEG
PURL_SYMTH      VVRIDDDLAVAFKLESHNHPSFVDPFNGAATGVGGILRDVFTMGARPVATLNSLRFGPLDEPKQRELLRG
PURL_SYNPX      VVDLGEGHRLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLEDPVNVGLIEG
PURL_LACLS      VVDIGDDLAVVFKAESHNHPSYVEPYEGAATGSGGIIRDIFSMGARPIAILDSLRFGPIDNGKTRHIVDQ
PURL_LACLM      VVDIGDDLAVVFKAESHNHPSYVEPYEGAATGSGGIIRDIFSMGARPIAILDSLRFGPIDNGKTRHIVDQ
PURL_LACLC      VVDIGDDLAVVFKAESHNHPSYVEPYEGAATGSGGIIRDIFSMGARPIAILDSLRFGPIDNGKTRHIVDQ
PURL_BACHD      XXXXXXXQAVVFKIESHNHPSAIEPYQGAATGVGGILRDVFSMGARPISLLNSLRFGELTSPKVRYLFEE
PURL_SYNPW      VVDLGEGHRLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDEPATQGLVEG
PURL_PROMM      VVDLGDGQSLAFKIESHNHPSALEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLEDERNVGLMEG
PURL_METSB      VIDIGDGEACVFKMESHNHPSYIEPFQGAATGVGGILRDVFTMGARPVACLNLLRFGAPEHPKTRHLVSG
PURL_LACLA      VVDIGDDLAVVFKAESHNHPSYVEPYEGAATGSGGIIRDIFSMGARPIAILDSLRFGPIDNGKTRHIVDQ
PURL_AZOC5      VVDIGDGLAVVFKMESHNHPSFIEPYQGAGTGVGGILRDVFTMGARPIAALNALRFGDPHHPRTRRLLAG
PURL_ZYMMO      VVDIGDGQAAIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVANLNALRFGSPKHPKTPHLVSG
PURL_PROM3      VVDLGDGQSLAFKIESHNHPSALEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLEDERNVGLIEG
PURL_CYAP4      VVDLGEGLRLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNSLRFGSLDDPRTRRLFSG
PURL_PROMA      VVDLGEGQRLAFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIALLNSLRFGPLDTPINVGLLEG
PURL_RHOPB      VIDIGDNEAIVFKMESHNHPSFIEPYQGAATGVGGILRDVFTMGARPIACLNALSFGAPEHPKTRHLXXX
PURL_STAHJ      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELSVKQNQRLLKG
PURL_RHORT      VIDIGDGLTAIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVANLNALRFGDPSDPRTRHLISG
PURL_SYNS9      VVDLGDGHRLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDDSANVGLMEG
PURL_BRASB      VIDIGDGQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGAPEHPKTRHLVSG
PURL_PROMT      VVDIGFGQRLVFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDDEKNISLLEG
PURL_PROM1      VVDIGFGQRLVFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDDEKNISLLEG
PURL_STAAN      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAAM      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAA9      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAA2      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAA1      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_PROM2      VIDVGNNQKLVFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKSSNVDLLRG
PURL_STAES      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELTVKQNQRLLKG
PURL_STAEQ      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELTVKQNQRLLKG
PURL_ERYLH      VIDIGDGHAAIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVANANALRFGRPEHPKMKHLVQG
PURL_STAAW      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAAT      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAAS      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAAE      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAAC      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAA8      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_STAA3      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_PROM0      VIDVGNNQKLVFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKSSNVDLLRG
PURL_PARL1      VVDIGDGQAIIFKMESHNHPSYIEPHEGAATGVGGILRDVFTMGARPVAALNALRFGAPDHPRTRHIVSG
PURL_PROMS      VIDVGNNQKLVFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKSSNVDLLRG
PURL_STAS1      VVDIGDNQAVVFKVESHNHPSAVEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELTEKQNRRLLRG
PURL_STAAR      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_LACPL      XXXXXXXQAVVFKAESHNHPSAVEPYEGAATGVGGIIRDIFSMGARPIALLDSLRFGEPTDAHTKYLISQ
PURL_BRASO      VIDIGDGQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGAPEHPKTRHLVSG
PURL_RHOPT      VIDIGDNQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGDPSHPKTRHLXXX
PURL_STACT      VVDIGDDQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDEIQNRTLTRG
PURL_CHLTE      LVDIGDNLAVAFKIESHNHPSAVEPYQGAATGVGGIHRDIFTMGARPVASLDSLRFGSPRDPRVRYLVDG
PURL_RHOPA      VIDIGDNQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGDPSHPKTRHLXXX
PURL_PROM9      VIDVGNNQKLVFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKTSNMDLLRG
PURL_WOLSU      VIDIGEGYAAVFKMESHNHPSFIEPYQGAATGVGGIMRDVFTMGARPVASLNAIRFGDIRRKKHRYLLKG
PURL_STAAB      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIIRDIVSIGARPINLLNSLRFGELDNKQNQRLLKG
PURL_RHOP2      VIDIGDNQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGDPSHPKTRHLXXX
PURL_PROMP      VIDVGNDQKLVFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKLSNISLLRG
PURL_AQUAE      VVKIDEKVWVAFKVESHNHPSYIEPFHGAATGVGGIIRDVLSMGARPIALADSLRFGEFNYHETKRLVKG
PURL_RHOPS      VIDIGDNQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGAPEHPKTRHLXXX
PURL_LACS1      IVDIGDNQAVVFKAESHNHPSAVEPYEGAATGVGGILRDIFSMGARPIASLDSLHFGEIDNARTKYLINE
PURL_SALRD      LVDVGDGKAVAFKIESHNHPSAVEPYEGAATGVGGIHRDIFTMGARPICALDSLRFGSLEESRVRYLFDG
PURL_MACCJ      VVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGIVRDIVSIGARPIQLLNSLRFGELTEKQNQRLFKG
PURL_LEUMM      ILDIGDNQAVVFKAESHNHPSFVEPYEGAATGVGGILRDIFSMGAQPIAVLDSLRFGELDNAHTKHIVDG
PURL_RHOP5      VIDIGDNQAVVFKMESHNHPSFIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGAPEHPKTRRLXXX
PURL_NOVAD      VIDIGDGQAAIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVANMNALRFGRPDHPKMKHLVQG
PURL_JANSC      IVDIGDGQCVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNSLSFGEVAHPKTRQLXXX
PURL_LACSS      ILDIGDGQAVVFKAESHNHPSAVEPYEGAATGVGGIIRDIFSMGATPIAILDSLRFGELNDNQTKYLVQE
PURL_BRUSU      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUSI      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUO2      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUC2      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BEII9      VIDIGDGEACIFKMESHNHPSYIEPHQGAATGVGGILRDVFTMGARPVASLDLLRFGAPEHPLMRHLIAG
PURL_CAUCR      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGIMRDVFTMGARPIALLNALRFGDPSHPKTKRLVDG
PURL_BRUME      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUMB      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUAB      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUA2      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_BRUA1      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_SYNSC      VVDLGGGHRLAFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLEDPANVGLMEG
PURL_THEGJ      IVKFDDETWVVVGIESHNHPSAVEPYGGAATGVGGIVRDILCMGARPIALLDPIRFGPLEKERNRYLFEY
PURL_OCHA4      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGEPDHPKTRHLXXX
PURL_GRABC      VVDIGDGLAAIFKMESHNHPSFIEPYQGAATGVGGILRDVFTMGARPVANLNALRFGSPDHPATKXXXXX
PURL_GLUOX      VVDIGEGLAAVFKMESHNHPSFIEPYQGAATGVGGILRDVFTMGARPVANLNALRFGDPKHAGTRRIXXX
PURL_RHOS4      VVDIGDGQAVIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALSFGVPDHPKTAHIVKG
PURL_PROM5      VIDVGNDQKLVFKIESHNHPSAIEPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKSSNISLLRG
PURL_AGRT5      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGAPDHPKTRHLXXX
PURL_RHOSK      VVDIGDGQAVIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALSFGEPSHPKTAHIVKG
PURL_BARQU      VIDIGKGQCVVFKMESHNHPSYIEPYQGAATGMGGILRDVFTMGARPVAAMNALRFGSPNHPRTRHLVAG
PURL_BARHE      VVDIGEGQCVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGSPDHPRTRYLVAG
PURL_CHLCH      LVDIGDNLAVAFKIESHNHPSAVEPYQGAATGVGGIHRDIFTMGARPVASLNSLRFGSPKDPRVRYLVDG
PURL_NITHX      VIDIGDGQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGDPSHPKTRHLXXX
PURL_MESSB      VVDIGDGQCVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGAPDHPKTQHLXXX
PURL_RHOS5      VVDIGDGQAVIFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALSFGEPNHSKTAHIVKG
PURL_LACC3      VIDIGEGKAVVFKAESHNHPSAVEPYEGAATGVGGIIRDIFSIGAKPVAMLDSLAFGDIEQPHTQHLVDR
PURL_NITWN      VIDIGDGQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGDPSHPKTRHLXXX
PURL_NOCSJ      VVDIGQGYAVTFKVESHNHPSYVEPYQGAATGVGGIVRDILAMGARPVAVMDPLRFGPLDADDTHRVLPG
PURL_SILST      IVDIGDGDAVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIASMNSLSFGEPAHHKTRQLXXX
PURL_PYRKO      IVKFDDETWIAVGIESHNHPSAVEPYGGAATGVGGIVRDILCMGARPIALLDPIRFGPLEKERNRYLLQG
PURL_PELUB      XXXXXXXXXXXFKIESHNHPSFIEPYQGAATGVGGIMRDVFTMGARPIANLNSIHFGSPQHKKTKNLLRG
PURL_LACRJ      VVDIDDGQAVVFKAESHNHPTTVEPYQGAATGVGGILRDIFSMGARPIASLDSLHFGELDNSTTRMKVTN
PURL_LACRD      VVDIDDGQAVVFKAESHNHPTTVEPYQGAATGVGGILRDIFSMGARPIASLDSLHFGELDNSTTRMKVTN
PURL_ACICJ      VVDIGEGRAAIFKMESHNHPSFIEPYQGAATGVGGILRDVFTMGARPVANLNALRFGDPSLPVTKRXXXX
PURL_SULDN      VIDIGGGYAAVFKMESHNHPSFIEPYQGAATGVGGIMRDVFTMGARPIANLNALRFGDKTSAHQRYLVRG
PURL_NITSB      VIDIGDGMAAVFKMESHNHPSFIEPYQGAATGVGGILRDVFTMGARPVANLNALRFGDVKRAHQRYLVRG
PURL_LACF3      VVDIDDGQAVVFKAESHNHPSTVEPYQGAATGVGGILRDIFSMGARPIASLDSLHFGELDDPKMQMKVAG
PURL_LACDB      VVDIGDGQAVVFKAESHNHPTAVEPYQGAATGVGGILRDVFSMGARPVATLDSLHFGELDDAHTRWLLNE
PURL_LACDA      VVDIGDGQAVVFKAESHNHPTAVEPYQGAATGVGGILRDVFSMGARPVATLDSLHFGELDDAHTRWLLNE
PURL_CAMJJ      VIDIGQGMAAVFKVESHNHPSFIEPFAGAATGVGGILRDVFTMGARVVAGLNSLKFGDIHDEKQKYLVKG
PURL_CAMJD      VIDIGQGMSAVFKVESHNHPSFIEPFAGAATGVGGILRDVFTMGARVVAGLNSLKFGDIHNEKQKYLVKG
PURL_SILPO      VVDIGDGQAVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIASMNALSFGEPSHPKTRQLVNG
PURL_CAMJ8      VIDIGQGMAAVFKVESHNHPSFIEPFAGAATGVGGILRDVFTMGARVVAGLNSLKFGDIHDEKQKYLVKG
PURL_AGRVS      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGAPDHPKTRHLXXX
PURL_SULNB      VIDIGDGMAAVFKMESHNHPSFIEPFQGAATGVGGILRDIFTMGARPVANLNALRFGRVRNKYQRHLVRG
PURL_CAMJE      VIDIGQGMAAVFKVESHNHPSFIEPFAGAATGVGGILRDVFTMGARVVAGLNSLKFGDIHDEKQKYLVKG
PURL_CAMJR      VIDIGQGMAAVFKVESHNHPSFIEPFAGAATGVGGILRDVFTMGARVVAGLNSLKFGNIHNEKQKYLVKG
PURL_LEPBL      AMDIGDGLAVVFKIESHNHPTAVEPYQGAATGVGGIMRDIFTMGARPIVSLNSLRFGNPDEPRNKYLLSR
PURL_LEPBJ      AMDIGDGLAVVFKIESHNHPTAVEPYQGAATGVGGIMRDIFTMGARPIVSLNSLRFGNPDEPRNKYLLSR
PURL_BRAJA      VIDIGDGQAVVFKMESHNHPSYIEPYQGATTGVGGILRDVFTMGARPIACLNALSFGAPEHAKTRHLXXX
PURL_LEPBP      XMDIGDGLAVVFKIESHNHPTAVEPYQGAATGVGGIMRDIFTMGARPITSLNSLRFGDPKEPRNKYLLTR
PURL_LEPBA      XMDIGDGLAVVFKIESHNHPTAVEPYQGAATGVGGIMRDIFTMGARPITSLNSLRFGDPKEPRNKYLLTR
PURL_THESM      VVKFDDNTAIVVGIESHNHPSAVEPYGGAATGVGGIVRDILCMGARPIALLDPIRFGPLGKERNRYLFEY
PURL_RHIFR      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGAPDHPKTRHLXXX
PURL_PARDP      VVDIGDGQAVVFKMESHNHPSYIEPHQGAATGVGGILRDVFTMGARPIAAMDALSFGRPEHPKTAHLVKG
PURL_LEPIN      AMDIGDGLAVVFKIESHNHPTAVEPYQGAATGVGGIMRDIFTMGARPIVSLNSLRFGNPDEPKNKYLLSR
PURL_FRASC      VVDVGEGLAVTFKIESHNHPSFVEPYQGAATGVGGIVRDILTMGARPIGVLDPLRFGEADAADTARVLPG
PURL_LACH4      VVDIDDGQAVVFKAESHNHPTTVEPYQGAATGVGGILRDVFSMGARPVAILDSLHFGEKNNPTMRYKMEE
PURL_LEPIC      AMDIGDGLAVVFKIESHNHPTAVEPYQGAATGVGGIMRDIFTMGARPIVSLNSLRFGNPDEPKNKYLLSR
PURL_BART1      VVDIGEGQCVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGAPDHPRTRHLXXX
PURL_AGRRK      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGEPDHPKTRHLXXX
PURL_RHIME      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPVAAMNALRFGSPDHPKTRHLXXX
PURL_ROSDO      VVDIGDGQAVVFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNSLSFGEISHPKTRQLXXX
PURL_BARBK      VVDIGNGQCVVFKMESHNHPSYIEPYQGAATGIGGILRDIFTMGARPVAAINALRFGSPDHPRTRHLXXX
PURL_LACCA      VIDIGEGKAVVFKAESHNHPSAVEPYEGAATGVGGIIRDIFSIGAKPVAMLDSLAFGDIEQPHTQHLVDR
PURL_FRASN      VVDVGEGLAVTFKVESHNHPSFVEPYQGAATGVGGIVRDILTMGARPIGILDPLRFGAADAPDTARVLPG
PURL_PETMO      YVQIG-GKAVVFKVESHNHPSAVEPYQGAATGIGGIVRDILAMGARPIALLDSLKFGNVFDPKVKNIFEG
PURL_TROWT      VVDIGGGWAAAFKIESHNHPSFIEPFQGAATGIGGIVRDIIAMGAKPVALMDSLRFGAASDPDTQRVADG
PURL_TROW8      VVDIGGGWAAAFKIESHNHPSFIEPFQGAATGIGGIVRDIIAMGAKPVALMDSLRFGAASDPDTQRVADG
PURL_RHILO      XXXXXXXXXXXFKMESHNHPSFIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGAPDHPKTRHLXXX
PURL_SINMW      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGSPDHPKTRHLXXX
PURL_CAMLR      VIDIGKKMAAVFKVESHNHPSFIEPFAGAATGVGGILRDVFTMGARVVAGMNSLKFGNIHDEKQKYLVKG
PURL_CAMHC      VIDIGDGMAAVFKMESHNHPSYIEPFQGAATGVGGILRDIFTMGARVEVNMNSLRFGDKVNRYQRYLVKG
PURL_RHIEC      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGEPDHPKTRHLXXX
PURL_RHIE6      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGEPDHPKTRHLXXX
PURL_RHIL3      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGEPDHPKTRHLXXX
PURL_PELLD      XVDIGDNLAVAFKIESHNHPSAVEPYQGAATGVGGIHRDIFTMGARPVASLNSLRFGSPKDPRVRYLVDG
PURL_PYRAB      VVKFDESTWIVIGIESHNHPSAVEPYGGAATGIGGIVRDILCMGARPIALLDPIRFGPLEKEKNRYLFEY
PURL_LACAC      VVDIDDGQAVVFKAESHNHPTTVEPYQGAATGVGGILRDVFSMGARPVAILDSLHFGEKDNPTMRYKMEE
PURL_RHISN      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGSPDHPKTRHLXXX
PURL_HELHP      IIDIGENLCAVFKIESHNHPSFIEPHAGAATGVGGIMRDIFTMGARPVASLNSIRFGDISDKKHRYLLRG
PURL_RHILW      XXXXXXXXXXXFKMESHNHPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGEPDHPKTRHLXXX
PURL_CORA7      VVDIGDGNAVTFRVESHNHPSYVEPHQGAATGVGGIVRDIMAMGARPIAVMDQLRFGPADAPDTKRVLPG
PURL_RENSM      VVDIGDGWAVTFKVESHNHPSFVEPYQGAATGIGGIVRDIISMGARPVAVMDPLRFGAIDHPDTARLVHG
PURL_CAMC5      XXXXXXXXXXXFKMESHNHPSFIEPFQGAATGVGGILRDVFTMGARVVANMNSLRFGESENARKRYLLKG
PURL_THEFY      XXXXXXXYAVTFKIESHNHPSYVEPHQGAATGVGGIVRDILSMGARPVAVMDSLRFGPADAPDTQRVLPG
PURL_MYCA9      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPIAVMDQLRFGAADAPDTRRVFDG
PURL_METTH      VVEITDELALVIGIESHNHPSAIEPYXXXXXXXXXXLRDIISMGAMPVALLDSLRFGYLEDQKSRYLFEH
PURL_PYRHO      IIKFDDKTWIVIGIESHNHPSAVEPYGGAATGVGGIVRDILCMGARPIALLDPIRFGPLEKEKNRYLFEY
PURL_MYCVP      VVDIGDGWAATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_CORAM      VVDIGDGDAVTFRVESHNHPSFVEPYQGAATGVGGIVRDIMAMGARPIAVMDQLRFGPADAPDTARVLPG
PURL_CALMQ      IIRINN-IAVTFKIESHNHPSAVDPYDGAATGVGGIVRDILTTGLRPIALLDNLHLGSLDNQRSLWLSRN
PURL_PYRFU      IIKFDDKTWIVIGIESHNHPSAVEPYGGAATGVGGIVRDILCMGARPIALLDPIRFGPLEKEKNRYLFEY
PURL_CAMC1      XXXXXXXXXXXFKMESHNHPSFIEPFQGAATGVGGILRDVFTMGARVVANMNSLRFGEIRAKKHRYLLKG
PURL_MYCGI      VVDIGDGWAATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_METJA      VIRLKNDICLAIAMESHNHPSYIDPYNGAATGVGGIVRDVLSMGAKPIALLDPLRFGDKEGDKVRWLIEG
PURL_METKA      VVAIDDEWAVVVGIESHNHPSYVDPYNGAATGVGGIVRDVLSMGAFPIALLDPLRFGPLDGERVPYLVDG
PURL_STRCO      VVDVGQGYAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIIAMGARPVAVVDPLRFGAADHPDTKRVLPG
PURL_STRAW      VVDVGQGYAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIIAMGARPVAVVDPLRFGAADHPDTKRVLPG
PURL_LEIXX      VVDIGEGWAVTFKVESHNHPSYIEPFQGAATGVGGIVRDIISMGARPVAVMDQLRFGAIDEPDTAHVVHG
PURL_MYCTU      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_MYCTA      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_MYCBT      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_MYCBP      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_MYCBO      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_MYCPA      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_MYCA1      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDG
PURL_RHOE4      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPIAVMDQLRFGAADAPDTXXXXXX
PURL_METAC      IIKFEDGYVLAIGMESHNHPSYVDPYNGAATGIGGIVRDIISMGARPIALMDPLYFGPLDTPKNLFLFEQ
PURL_CORJK      VIDIGDGHAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGPADLPDTQRVLPG
PURL_RHOSR      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPIAVMDQLRFGAADAPDTXXXXXX
PURL_METMA      IIKFEDGYVLAIGMESHNHPSYVDPYNGAATGVGGIVRDIISMGARPIALMDPLYFGPLDTPKNLFLFEQ
PURL_MYCLE      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADALDTRRVLDG
PURL_MYCLB      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADALDTRRVLDG
PURL_NOCFA      XXXXXXXWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAADHPDTXXXXXX
PURL_RHOOB      VVDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPIAVMDQLRFGAADAPDTXXXXXX
PURL_PYRAE      LVEIAEGLYATFKIESHNHPSAVDPYNGAATGVGGIIRDILTVGARPIALLVNLHFGPPSHPHARWIAVN
PURL_COREF      VVDIGDGNAVTFRVESHNHPSFVEPHQGAATGIGGIVRDIMAMGARPIAVMDQLRFGAMDNPDTQRVLPG
PURL_PROAC      VVDIGNGLAVTFKAESHNHPSYVEPHQGAATGVGGIVRDIMAMGARPVGVMNALAFGPLDAPDTARVLPG
PURL_METS3      LVSVTDKYALAVGMESHNHPSAIEPYXXXXXXXXXXLRDIISMGARPIALLDSLRFGSLDDEKSKYLFEH
PURL_META3      LIKIDDDLCVAMAMESHNHPSYIDPYNGAATGVGGIVRDIISMNAKPIALLNALRFGDEEKDKVRWLVEG
PURL_CORGB      VVDIGDGNAVTFRVESHNHPSFVEPHQGAATGIGGIVRDIMAMGARPIAVMDQLRFGALDNPDTQRVLPG
PURL_CORGL      VVDIGDGNAVTFRVESHNHPSFVEPHQGAATGVGGIVRDIMAMGARPIAVMDQLRFGALDNPDTQRVLPG
PURL_PYRCJ      LVEVAPGLYVTFKIESHNHPSAVDPYNGAATGVGGIIRDILTVGAKPIALLVNLHFGPPQDAHAKWIAQG
PURL_METST      IVSLTDEYALAIGMESHNHPSAVEPYXXXXXXXXXXVRDIISMGAKPVVLLDALRFGHMSNQRSKYIFDY
PURL_HALMA      VVSLGEEMYITMGVESHNHPSYVDPFDGAATGVGGIVRDTLSMGAYPIALADCLYFGDFDREHSRYLFEG
PURL_PYRAR      LVEIAEGLFVTFKIESHNHPSAVDPYNGAATGVGGIIRDILTVGARPVALLVNLHFGPLDHPHARWIASN
PURL_METBF      IIKFDDGYVLAIGMESHNHPSYVDPYNGAATGIGGIVRDIISMGARPIALMDPLYFGPLDTPKNMFLFEQ
PURL_METTP      IVSIDDEWCVVISHESHNHPSQILPNEGAATGIGGIVRDVNCMGARVVATADPLRFGDPESSRVRWVAEG
PURL_ARCFU      VVEFDDEYAYVTAFESHNHPSAIEPYGGAATGIGGILRDVLCMGAQPIALIDPLFFGTPYEKLPRYLLKG
PURL_IGNH4      VVDFGSVY-VAFRIESHNHPSAVDPYNGAATGVGGIIRDILSSGAKPIALLDDLIFGDLDENLVKWHVKG
PURL_THENV      LVEVAPGLYVSFKIESHNHPSAVDPYNGAATGVGGIIRDILTVGATPVALLVNLHFGPPEDPHARWIFSN
PURL_THEMA      VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSR--------IIDG
PURL_PYRIL      LVEVAHGLYVSFKIESHNHPSAVDPYNGAATGVGGIIRDILTVGATPIALLVNLHFGPPEDPHAKWIFSN
PURL_HALWD      VVRVDEASEITMGIESHNHPSYVDPYDGAATGVGGIVRDTLSMGAYPIALADSLYFGSFDRERTQYLLDG
PURL_SULAC      ALDVGDGWAVVLKLESHNHPSAIDPFNGAATGIGGIIRDIISKGARPIALLDMIRVGNLNNSRNRWLLKN
PURL_SULTO      ALDVGDGWAIVLKLESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALLDMIRVGNLSNPRNKWLLKN
PURL_NATPD      TY-------ITMGIESHNHPSYVDPFDGAATGVGGIVRDTMSMGAYPIALADSLYFGDFDREHSKYLFEG
PURL_HALLT      VXXXXXXXXVTFGVESHNHPSFVDPVDGAATGVGGIVRDTMSMGAYPIALLDSLYFGGFDRERSRYLFEG
PURL_SULIA      AVDIGDGWAIVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIRKNVWLLKN
PURL_SULIM      AVDIGDGWAIVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIRKNVWLLKN
PURL_SULIK      AVDIGDGWAIVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIRKNVWLLKN
PURL_SULIY      AVDIGDGWAIVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIRKNVWLLKN
PURL_SULIN      AVDIGDGWAIVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIRKNVWLLKN
PURL_SULIL      AVDIGDGWAIVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIRKNVWLLKN
PURL_SULSO      AVDIGDGWAVVIKVESHNHPSAIDPFNGAATGVGGIIRDIISKGAKPIALMDMIRVGNLKIKKNVWLLKN
PURL_METS5      AVDVGDGLALVLKVESHNHPSAIDPFNGAATGVGGILRDIISKGAKPIALLDMIRV-XXXXXXXXXXXXN
PURL_HALSA      XXXXGTDQLVTVGVESHNHPSYVDPYDGAATGVGGIVRDTLSMGAYPIALADALYFGDFDDEHARYLLDG
PURL_HALS3      XXXXGTDQLVTVGVESHNHPSYVDPYDGAATGVGGIVRDTLSMGAYPIALADALYFGDFDDEHARYLLDG
PURL_PICTO      VVKFNDDYVYVVKMESHNHPSAVEPYGGAATGVGGIIRDVLCMGAQPVALVDSLYFGDPDNKSGRFIING
PURL_THEVO      VVEFDKDYAYVLKMESHNHPSAVEPYGGAATGIGGIVRDVVCMGAQPIALVDSLFMGDVASQKPRYIFQG
PURL_THEAC      VVDFDGEYAYVLKMESHNHPSAVEPYGGAATGIGGIVRDVLCMGAQPVALIDSLFLGDVSSDRPRYIFGG
PURL_METTM      VVEVTDELAMAIGIESHNHPSAIEPYXXXXXXXXXXLRDIISMGAMPIALLDSLRFGYLEDQKSRY----
PUR4_MANSM      VMKVGRFFAILMKVETHNHPTAISPFPGAATGSGGEIRDATGRGAKPKAGLVGFSVSPWENELSKIMIEG
PUR4_PHOLL      VMEVGRFFASAMKVETHNHPTAISPWPGASTGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVSALMMEG
PUR4_PSEA6      VMEGSEDIDILMKVETHNHPTAIAPFSGAATGSGGEIRDATGRGSKPKAGLSNLRYGKPERIVTAFMLNG
PUR4_SCHPO      VFEGNSGWSVEFKVETHNHPTAVSPFPGAATGSGGEIRDEGAVGQGSLSKAGELDVGKPYHATSLDIMLE
PUR4_SODGM      VMEVGEATHILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGRPERIVSALMTDG
PUR4_HAHCH      VIKGGQGGRILMKVETHNHPTAISPFAGASTGSGGEIRDATGIGAKPKAGLTGFTYGKPERIVSQIMLDG
PUR4_SHESR      YSYHTEPMHVLMKVETHNHPTAISPYPGAATGSGGEIRDATGRGSKPKAGLTGFSYGKPDRIVSEIMTEG
PUR4_SHESM      YSYHTEPMHVLMKVETHNHPTAISPYPGAATGSGGEIRDATGRGSKPKAGLTGFSYGKPDRIVSALMTEG
PUR4_PASMU      VMKVGEDAHILMKVETHNHPTAISPFPGAATGSGGEIRDATGRGAKPKAGLVGFSVSPWENPVSKIMIEG
PUR4_PSEHT      VMKGSEDIEILMKVETHNHPTAIAPFSGAATGSGGEIRDATGRGSKPKAGLSNLRFGKPGRIVTALMTEG
PUR4_SHEDO      YAYHVEPCHILMKVETHNHPTAISPYAGAATGSGGEIRDATGRGSKPKAGLVGFQYGKPERIVTEIMLEG
PUR4_PSEAE      VI-VGEPVQILMKVETHNHPTAIAPFPGASTGSGGEIRDATGRGAKPKAGLTEVPYGKPERIVTAIMVEG
PUR4_ECOUT      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_SHEON      YSYHTEPMHVLMKVETHNHPTAISPYPGAATGSGGEIRDATGRGSKPKAGLTGFNYGKPDRIVSAIMTEG
PUR4_PSEPK      VIAVQEPVHILMKVETHNHPTAIAPFSGASTGSGGEIRDATGRGAKPKATVSNLRYGKPERIVDAIMIEG
PUR4_VIBVY      VMKVGEDAHILMKVETHNHPTAISPWPGASTGSGGEIRDATGIGGKPKAGLSNLRFGKPGRIVNALMLEG
PUR4_VIBVU      VMKVGEDAHILMKVETHNHPTAISPWPGASTGSGGEIRDATGIGGKPKAGLSNLRFGKPGRIVNALMLEG
PUR4_SALTY      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_SALTI      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_SALCH      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_MYXXD      VIEVREPAHIMIKVETHNHPTAISPYPGAATGAGGEIRDATGRGARPKAGLTGFSYGKPDRIVSAIMVDG
PUR4_ECOLI      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_VIBCH      VMTVGEDAHILMKVETHNHPTAISPWPGASTGSGGEIRDATGIGGKPKAGLSNLRFGKPSRIVNALMLEG
PUR4_SHISS      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_SHIDS      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_PSESM      VIAVQEPVHILMKVETHNHPTAIAPFPGAATGSGGEIRDATGRGAKPKAGLTEVPYGKPERIVTAIMIEG
PUR4_ECOL6      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_ECOL5      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_ECO57      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_SHEFN      VMTGSEPMHILMKVETHNHPTAISPYPGAATGSGGEIRDATGRGSKPKAGLSGFTYGKPDRIVTEIMLEG
PUR4_PSEU2      VIAVQEPVHILMKVETHNHPTAIAPFPGAATGSGGEIRDATGRGAKPKAGLTEVPYGKPERIVTAIMIEG
PUR4_METFK      IVEGGEDMHFLMKVETHNHPTAISPFAGAATGAGGEIRDATGSGSKPKAGLTGFSVGKPDRIASQIMVDG
PUR4_IDILO      VMEGHEGYSILMKVETHNHPTAISPYPGAATGSGGEIRDATGVGSKPKAGLVGFNYGKPARIVSALMLEG
PUR4_SHIBS      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_SALPA      VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
PUR4_PSE14      VIAVQEPVHILMKVETHNHPTAIAPFPGAATGSGGEIRDATGRGAKPKAGLTEVPYGKPERIVTAIMIEG
PUR4_PHOPR      VMEVGEAAHILMKVETHNHPTAISPWPGASTGSGGEIRDATGLGGKPKAGLSNLRFGKPGRIVNEIMLEG
PUR4_VIBPA      VMKVGEDAHILMKVETHNHPTAISPWPGASTGSGGEIRDATGIGGKPKAGLSNLRFGKPGRIVNAIMLEG
PUR4_PSEF5      VIAVQEPVHILMKVETHNHPTAIAPFPGASTGSGGEIRDATGRGAKPKAGLTEVPYGKPERIVTAIMIEG
PUR4_YERPS      VMQVGRFYATAMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPDRIVTAIMTEG
PUR4_YERPN      VMQVGRFYATAMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPDRIVTAIMTEG
PUR4_YERPE      VMQVGRFYATAMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPDRIVTAIMTEG
PUR4_YERPA      VMQVGRFYATAMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPDRIVTAIMTEG
PUR4_HAES1      VMKVGEDTHILMKVETHNHPTAISPFPGAATGSGGEIRDATGRGAKPKAGLVGFSVSPWENALSKIMIEG
PUR4_ERWCT      VMEVGRFYTILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGSKPKAGLSNLRFGKPDRIVSAIMTEG
PUR4_COLP3      VMVGNKGGRILMKVETHNHPTAISPYPGAATGSGGEIRDATGIGSKPKAGLSNLRFGKPSRIVTAFMIEG
PUR4_PSEPF      VIAVQEPVHILMKVETHNHPTAIAPFPGASTGSGGEIRDATGRGAKPKAGLTEVPYGKPERIVNAIMIEG
PUR4_VIBF1      VMEVGEKTHILMKVETHNHPTAISPWPGASTGSGGEIRDATGIGGKPKAGLVAFSFGKPSRIVTAIMLEG
PUR4_HAEIN      VMKVGEDVHILMKVETHNHPTAISPFPGAATGSGGEIRDATGRGAKPKAGLTGFNFEQPWEASALDIMID
PUR4_HAEI8      VMKVGEDAHILMKVETHNHPTAISPFPGAATGSGGEIRDATGRGAKPKAGLTGFNFEQPWEASALDIMID
PUR4_RALSO      VMEGGERWFTLMKVETHNHPTAISPFPGASTGAGGEIRDATGRGAKPKAGLTGFTVGKPDRIASQIMIEG
PUR4_YEAST      VLSTKERIPLLIKVETHNHPTAVSPFPGAATGSGGEIRDETKCGLSGFSVSDELNIGKPYHIASALIMIE
PUR4_XYLFT      VIETGEPGAFQIKVETHNHPTAIAPFPGASTGAGGEIRDATGRGGKPKAGLSGFALNPRMASALDIMLEG
PUR4_XYLFA      VIETGEPGAFQIKVETHNHPTAIAPFPGASTGAGGEIRDATGRGGKPKAGLSGFALNPRMASALDIMLEG
PUR4_ARATH      ---------ILFTAETHNFPCAVAPYPGAETGAGGRIRDTHATGRGSFVVASTSSYAPWEDSSFQYILID
PUR4_DICDI      ---------IIFTAETHNFPTGIAPFEGAETGTGGRLRDTHATGRGSLVVAGTVGYCPDNMANPLKIEIE
PUR4_NEIG1      YRFHEEDTHIIMKVETHNHXXXXXXXXXXXXXXXXEIRDATGKGSRPKAGLTGFTYGKPEHISSPLMIEG
PUR4_HUMAN      ---------VVFTAETHNFPTGVCPFSGATTGTGGRIRDVQGRGAHVVAGTAGYCFGPGNFARPLEVAIE
PUR4_NEIMB      YRFHEEDTHIIMKVETHNHXXXXXXXXXXXXXXXXEIRDATGKGSRPKAGLTGFTYGKPEHISSPLMIEG
PUR4_NEIMA      YRFHEEDTHIIMKVETHNHXXXXXXXXXXXXXXXXEIRDATGKGSRPKAGLTGFTYGKPEHISSPLMIEG
PUR4_CAEEL      -----------YSAETHNFPTAVCPFQGATTGTGGRIRDIHATGRGAYEIAGTVGYSPTSISEPAKIAIE
PUR4_MOUSE      ---------VVFTAETHNFPTGVAPFSGATTGTGGRIRDVQGRGAHVVAGTAGYCFGPGNFARPLEVAIE
PUR4_XANCP      VVETGEPSAFAIKVETHNHXXXXXXXXXXXXXXXXEIRDATGRGGKPKAGLTGFSVSPWEAPRALIMLDG
PUR4_XANAC      VVETGQPSAFAIKVETHNHXXXXXXXXXXXXXXXXEIRDATGRGGKPKAGLTGFSVSPWEAPRALIMLDG
PUR4_DROME      -----------FTAETHNMPTAVAPFSGATTGTGGRLRDVQGVGRGGVPIAGTAGYQPYEPLDFKYVLIE
Y676_METJA      TIPIGDK-EIVFTVDGHT----VKPFPGGDIGVSGTVNDLAVMGAKPLAL--SLSLIIPEGFNLEDLEK-
THIL_METTH      LIDAGEEFLVLTSLETRHFPDPERPRDMGWKTVTVNMSDLAAMGSRPEGFILSVALPDLELEFFDSLMDG
SELD_ENTS8      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIYAMGGKPIMAIAIL--GWPVNTLAPEIARE
THIL_METJA      IIKIDENFYLVMMVKKAHIPSILSPYEIGGRILTANVSDIASMGAKPLAFLVSISLS-KEEANEKF-IKE
SELD_GEOSL      VYRIGEGLALVETVDIIT-PLVDDPYTFGRIAAANALSDVFAMGGRPVTAMNLVFF--PACALPGSVLSA
SELD_PSEPK      -------------------PIVDDPYDFGRIAATNAISDIYAMGGDPLMAIAILGWPPPEVARE------
SELD_PASMU      VYDIGNGIGIISTTDFFM-PIVDDPFDFGRIAATNAISDIFAMGGKPIMAIAILGFPPPEVAQR------
VP75_SHV21      ----------------------------------------------------------------------
SELD_SULDN      ------------------------------------LSDIYAMGGKPLMAISI--FGWPIEKLSSEVARQ
PUR5_PYRKO      ------------------------------------VNDLLCVGAEPVALVDYLAVKEPDER----VFEG
PUR5_THETN      ------GFAALYEIKNYKNPVLVSSTDGVGTKVAMCVNDVIVVGAKPLFFLDYFATGKLESEKAIQVIKG
PUR5_BACP2      TDGVGTKLKLAFLMDKHDTIGV--------DAVAMCVNDVLAQGAEPLFFLDYLAVGKADPVKIESIVKG
COR1B_RAT       ----------------------------------------------------------------------
SELD_DECAR      ------------------------------------ISDVYAMGGTPLFALALV--GMPVNVLPLETIGQ
SELD_COLP3      ------------------------------------ISDIYAMGGKPIMAIAIL--GWPVNLLAPEIAQQ
SELD_GEOMG      VYRIGEGLALVDTVDIIT-PLVDDPFTFGRIAAANALSDVYAMGGRPVTAM-NLAFFPACTLPGQILADI
RPOB_CORK4      EMALGRNLLVAFPWEGHNYEDAI-----------------------------------------------
Y1416_METJA     ----------------------------------------------------------------------
SELD_HAEDU      VYDIGNGLAIISTTDFFM-PIVDDPFDFGRIAATNALSDIFAMGGKPLMAIAILGF--PIDKLPAEVAQK
PUR5_METMA      LLDFGE-YALAMTTDGVGSKVLIEMQRWNTVGIDCIVNDLLAIGAEPVAFVDYLALEKHEEGFAEQIGEG
HYPE_AZOVI      --------------------------------VHGTINDVAMAGARPCYLAAGFIL---EEGFPLADLAR
HUPE_AZOCH      --------------------------------VHGTINDVAMAGARPCYLAAGFIL---EEGFPLADLAR
SELD_PHOPR      VYDLGNGTA-AISTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGKPIMAIAIL--GWPVNVLAPEIAQQ
SELD_YERPE      VYDIGNGVGIISTTDFFM-PIVDDPFDFGRIAATNAISDVYAMGGKPIMAIAIL--GWPIDKLAPEIAQQ
SELD_AERS4      VVDIGNGQGIVSTTDFFM-PIVDDPFTFGRIAATNAISDIYAMGGKPIVAIAIL--GWPINTLAPEIAQQ
SELD_AERHH      VVDIGNGQGIVSTTDFFM-PIVDDPFTFGRIAATNAISDIYAMGGKPIVAIAIL--GWPINTLAPEVAQQ
Y787_SYNY3      LLLAAEGMA----------PSLIDPWFAGWCSVLVNVSDIYAMGGRPIAVVDALWSKSSDQAQQ------
SELD_YERPS      VYDIGNGVGIISTTDFFM-PIVDDPFDFGRIAATNAISDVYAMGGKPIMAIAIL--GWPIDKLAPEIAQQ
SELD_SHISS      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_SHIDS      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_SHIBS      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_ECOL6      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_ECOL5      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_ECO57      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_ECO24      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
PUR5_METTH      LVRMGDV-AIAMSTDGVGSKILVAEMMNRYDTVGMVVNDILCVGARPAALVDYLAVERPDPEVAGEIGKG
PUR5_METBF      LLDFGE-YALALTTDGVGSKVLIEMQRWNTVGIDCIVNDLLAIGAEPVAFVDYLALEKHEEGFAAQIGEG
SELD_HAEIN      VYDLGNGTAIISTTDFFM-PIVDDPFDFGRIAATNAISDIFAMGGKPIMGIAILGF--PTNVLPAEVAQK
SELD_HAEIG      VYDLGNGTAIISTTDFFM-PIVDDPFDFGRIAATNAISDIFAMGGKPIMGIAILGF--PTNVLPAEVAQK
SELD_HAEI8      VYDLGNGTAIISTTDFFM-PIVDDPFDFGRIAATNAISDIFAMGGKPIMGIAILGF--PTNVLPAEVAQK
SELD_CARHZ      VYRISDEQAIVLTVDYFT-PVVDDPYYFGVIAAANSLSDIYAMGAKPLFALNVVGFPPPE------ILAT
PUR5_METS3      LVRLGDK-AIAMSTDGVGSKILIAEMMNKYDTVGMVVNDILCVGAEPIALVDYLAVEQPDPERAEEIAEG
PUR5_METAC      LLDFGE-YALAMTTDGVGSKVLIEMKRWNTVGIDCIVNDLLAIGAEPVAFVDYLALEKHEEGFAAQIGEG
SELD_SHIFL      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_SHIF8      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_PORG3      VYRLNDDTALIVTTDFFP-PVCSDPYTFGRIAAANALSDVYAMGGRPLLVLNLTMF--PSEGIPVEVLAD
SELD_PHOLL      VYDIGNGTGIISTTDFFM-PIVDDPFDFGRIAATNAISDIYAMGGKPIMAIAIL--GWPIDKLAPEIARK
SELD_ENT38      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINTLAPEIARE
SELD_ECOLI      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
SELD_ECOHS      VYDLGNGTSVISTTDFFM-PIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAIL--GWPINKLSPEIARE
PUR5_LACDB      ------------------------------------VNDVLAQGAEPLFFLDYIACGHNDPA----LLAS
PUR5_LACDA      ------------------------------------VNDVLAQGAEPLFFLDYIACGHNDPA----LLAS
PUR5_SYNP2      ------------------------------------VNDILTSGAEPLFFLDYLATGKLEPEQLAQVVAG
PUR5_LYSSC      TDGVGTKLKLAFMVDKHDTIGV--------DCVAMCVNDIVAQGAEPLYFLDYVALGKAEPAKIEQIVKG
PUR5_LACRJ      ------------------------------------VNDVLAQGAEPITFLDYIATGHNDPAKMAAIVSG
PUR5_LACRD      ------------------------------------VNDVLAQGAEPITFLDYIATGHNDPAKMAAIVSG
PUR5_THEP3      ------GFAALFEIKNYKNPVIVSSTDGVGTKVAMCVNDIIVTGAKPLFFLDYFATGKLKSEVAVEVIKG
PUR5_LACH4      ------------------------------------VNDVLAQGAEPLFFLDYIATGHNDPAKLAQVVHG
PUR5_FUSNN      ------------------------------------VNDVLCHGAKPLFFLDYLACGKLDAEVAAQLVSG
PUR5_ARATH      ------------------------------------VNDIITSGAKPLFFLDYFATSRLDVDLAEKVIKG
Y1416_METJA     IVRADAKYIVAAIDGTHSRLSDF-PFLGGFHVTRAALRDIYVMGAEAVALISDVHLADDGDVGKIF---D


                         +         .         .         .         .         *         .:210
query           VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
PURL_THET8      VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
PURL_THET2      VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
PURL_THETN      VVAGIADYGNCIGIPTVGGDTYFEESYKGNPLVNAMCVGIVEXXXXXXXXXXXXNPVMVVGATTGRDGIG
PURL_THEP3      VVAGIADYGNCIGIPTVGGDTYFEESYKGNPLVNAMCVGIVEXXXXXXXXXXXXNPVMIVGATTGRDGIG
PURL_THEPX      VVAGIADYGNCIGIPTVGGDTYFEESYKGNPLVNAMCVGIVEXXXXXXXXXXXXNPVMIVGATTGRDGIG
PURL_GEOSW      VVAGIAGYGNCVGIPTVGGEVQFDAAYEGNPLVNAMCVGIIRHEDIQRGIASVGNTVMYVGAKTGRDGIH
PURL_EXISA      VVSGIAGYGNCVGIPTVGGEVAFDPAYSGNPLVNAMCVGFIRHEDIQKGIAGVGNSVMYVGATTGRDGIH
PURL_ANOFW      VVAGIAGYGNCVGIPTVGGEVQFDAAYEGNPLVNAMCVGVIRHEDIQKGIASVGNTVMYVGAKTGRDGIH
PURL_THEEB      VVAGIAHYGNCVGVPTVGGEVYFDPCYAGNPLVNAMALGLMETPEIVKSAASIGNPVLYVGSTTGRDGMG
PURL_GEOTN      VVAGIAGYGNCIGIPTVGGEVQFDPAYEGNPLVNAMCVGIIRHEDIQRGVATVGNTVMYVGAKTGRDGIH
PURL_GEOKA      VVAGIAGYGNCVGIPTVGGEVQFDPAYEGNPLVNAMCVGIIRHEDIQRGVATVGNTVMYVGAKTGRDGIH
PURL_DEIRA      VVDGIAHYGNAIGVPTVGGEVTFHPSYQENPLVNVMALGLLRHEDLATTMGEVGNQIVYVGSKTGRDGLG
PURL_THERP      VVGGIGWYGNCLGIPTVAGDVFFAPEYRQNPLVNAMCVGIAERSALIRARATPGNLVVLVGADTGRDGIH
PURL_MOOTA      VVGGIAFYGNCLGLPTVAGEVYFEPSYACNPLVNVMAVGLIEQKNIRRTAAGVGNAVMLIGARTGRDGIH
PURL_OCEIH      VVAGIAGYGNCVGVPTVGGEVQFDESYEDNPLVNAMCVGLINHKDVQKGAAGIGNTILYAGPPTGRDGIH
PURL_LISMF      VVAGIAGYGNSIGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAGIGNPVMYVGAKTGRDGIH
PURL_BACSU      VVAGIAGYGNCIGIPTVGGEVQFDSSYEGNPLVNAMCVGLINHEDIKKGQAGVGNTVMYVGAKTGRDGIH
PURL_ANADF      VVAGIGGYGNCMGVPTVAGEVMFHPSYNGNCLVNAFTLGILPADKILGTAAGVGNPVMYIGAKTGRDGIH
PURL_BACLD      VVAGIAGYGNCIGIPTVGGEVQFDGCYEGNPLVNAMCVGLINHEDIKKGQAGVGNTVMYVGAKTGRDGIH
PURL_ALKMQ      VVEGIAGYGNCMGIPTVGGEVYFNQSYRGNPLVNAMCVGLIEHDAIHRGTASVGNSIMYVGAATGRDGIG
PURL_NOSP7      VVAGISHYGNCVGVPTVGGEVYFDPAYSGNPLVNVMALGLMETQEIVKSGASLGNPVLYVGSTTGRDGMG
PURL_GLOVI      VVHGIGHYGNCVGVPTVGGEVYFDPTYSGNPLVNAMAIGVLETPEIVRSAAGIGNPVLYVGSTTGRDGMG
PURL_BACP2      VVAGIAGYGNCIGIPTVGGEVHFDQSYEGNPLVNAMCVGLINHEDIKKGQAGVGNTVMYVGAKTGRDGIH
PURL_LISW6      VVAGIAGYGNSIGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAGIGNPVMYVGAKTGRDGIH
PURL_BACCN      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLIHHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_ANAVT      VVAGISHYGNCVGVPTVGGEVYFDPAYSGNPLVNVMALGLMETPEIVKSGASIGNPVLYVGSTTGRDGMG
PURL_BACA2      VVAGIAGYGNCIGIPTVGGEVQFDASYEGNPLVNAMCVGLIDHKDIKKGQAGVGNTVMYVGAKTGRDGIH
PURL_BACCZ      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_ANASK      VVAGIGGYGNCMGVPTVGGEVAFHPSYNGNCLVNAFTLGILPADKIFRTAAGVGNPVMYVGAKTGRDGIH
PURL_BACHK      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_LISIN      VVAGIAGYGNSIGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAGIGNPVMYVGAKTGRDGIH
PURL_LISMC      VVAGIAGYGNSIGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAGIGNPVMYVGAKTGRDGIH
PURL_BACCQ      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACC7      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACC3      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACC1      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACC0      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACAN      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACAH      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACAC      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACAA      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_SYNY3      VVDGISHYGNCVGVPTVGGEIYFDPAYSGNPLVNAMALGLMETEEIVKAGASIGNPVLYVGSTTGRDGMG
PURL_BACC4      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_BACC2      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_ANADE      VVAGIGGYGNCMGVPTVGGEVAFHPSYNGNCLVNAFTLGILPADKIFRTAAGVGNPVMYVGAKTGRDGIH
PURL_LISMH      VVAGIAGYGNSIGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAGIGNPVMYVGAKTGRDGIH
PURL_ENTFA      VVAGISGYGNCIGIPTVGGEIAFEPCYQGNPLVNAMCVGLIRHDEIQKGQAGVGNSILYVGAKTGRDGIH
PURL_BACSK      VVAGIAGYGNCVGVPTVGGEVQFDPCYESNPLVNAMCVGLIDHKDIQKGQAGVGNTVMYVGASTGRDGIH
PURL_BACWK      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_LISMO      VVAGIAGYGNSIGIPTVGGEIQFDPCYTKNPLVNAMCVGLIEAKDIQKGQAGIGNPVMYVGAKTGRDGIH
PURL_BACCR      VVAGIAGYGNCIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAGAGNTVMYVGASTGRDGIH
PURL_ANASP      VVAGISHYGNCVGVPTVGGEVYFDPAYSGNPLVNVMALGLMEPEIVKSGAAGIGNPVLYVGSTTGRDGMG
PURL_THELT      VVSGIAHYGNCIGVPTVAGEIYFDDCYTDNPIVNVMCVGIAKKDEIKFARAQFGASVMLVGAMTGRDGIH
PURL_CARHZ      VVAGIAGYGNCIGIPTVAGDVYFQESYEENPLVNAMCVGIVELSKLKKGVATVGNPVLLVGATTGRDGIH
PURL_ACAM1      VVAGIAHYGNCVGVPTVGGEVYFDPAYTGNPLVNAMAMGLMETAEIVKAGASVGNPVLYVGSTTGRDGMG
PURL_SYNJA      VVEGIAHYGNCVGVPTVGGEVAVDPCYSGNPLVNVMALGLLETPAVVKSAAGVGNPILYVGATTGRDGIR
PURL_SYNP6      VVSGISHYGNCVGVPTVGGEVAFDPAYNGNPLVNAMALGLMETDEIVKAGASIGNPVLYVGSTTGRDGMG
PURL_SYNE7      VVSGISHYGNCVGVPTVGGEVAFDPAYNGNPLVNAMALGLMETDEIVKAGASIGNPVLYVGSTTGRDGMG
PURL_SYNJB      VVEGIAHYGNCVGVPTVGGEVAVDPCYSGNPLVNVMALGLLETPAVVKSAAGVGNPVLYVGATTGRDGIR
PURL_ANAD2      VVAGIGGYGNCMGVPTVGGEVAFHPSYNGNCLVNAFTLGILPADKIFRTAAGVGNPVMYVGAKTGRDGIH
PURL_SYMTH      VVAGIGHYGNTVGVPCIGGEVYFDESYRGNCLVNAMCIGILRPDRIHRGAAGPGNAIMVVGNPTGRDGIX
PURL_SYNPX      VVAGIAHYGNCVGVPTVGGEVAFDPSYGGNPLVNAMALGLMETEEIVKSGAGVGNPVVYVGSTTGRDGMG
PURL_LACLS      VTAGIAGYGNCIGIPTVGGEVAFDESYAGNPLVNVMCVGLIEHKHIQKGQAGVGNSIFYVGAKTGRDGIH
PURL_LACLM      VTAGIAGYGNCIGIPTVGGEVAFDESYAGNPLVNVMCVGLIEHKHIQKGQAGVGNSIFYVGAKTGRDGIH
PURL_LACLC      VTAGIAGYGNCIGIPTVGGEVAFDESYAGNPLVNVMCVGLIEHKHIQKGQAGVGNSIFYVGAKTGRDGIH
PURL_BACHD      VVAGIAGYGNCVGVPTVGGEVQFDPCYEGNPLVNAMCVGLIDHKDIQKGQAKVGNTVMYVGASTGRDGIH
PURL_SYNPW      VVAGISHYGNCVGVPTVGGEVAFDPAYRGNPLVNAMALGLMETDDIVKSGASVGNPVVYVGSTTGRDGMG
PURL_PROMM      VVEGIAHYGNCVGVPTVGGEVAFDSSYSGNPLVNAMALGLMETDEIVCSGAGVGYPVIYVGSTTGRDGMG
PURL_METSB      VVAGIGSYGNSFGVPTVGGATAFHMGYDGNILVNAMAVGIARADEIFYAKATIGNPIVYLGSKTGRDGIH
PURL_LACLA      VTAGIAGYGNCIGIPTVGGEVAFDESYAGNPLVNVMCVGLIEHKHIQKGQAGVGNSIFYVGAKTGRDGIH
PURL_AZOC5      VVAGIGGYGNSFGVPTVGGSVGFHERYNGNILVNAMAVGLAKDEIFYAAAAGVGRSIVYLGSKTGRDGIH
PURL_ZYMMO      VVAGIGGYGNCVGVPTVGGEVNFHPAYDGNNLVNAMTVGVAETNKIFYSAASAGNPIVYVGSKTGRDGIH
PURL_PROM3      VVEGIAHYGNCVGVPTVGGEVAFDSSYSGNPLVNAMALGLMETDEIVCSGAGVGYPVVYVGSTTGRDGMG
PURL_CYAP4      VVSGISHYGNCVGV