[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81529.1

[Show Plain Result]


## Summary of Sequence Search
    1::503
    1::503       0.0 100%  503 aa  GUAA_THET2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::503       0.0 100%  503 aa  GUAA_THET8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::511     e-159  58%  511 aa  GUAA_DEIDV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::506     e-157  57%  506 aa  GUAA_DEIRA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::505     e-155  56%  505 aa  GUAA_DEIGD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::516     e-132  51%  516 aa  GUAA_MOOTA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-128  49%  513 aa  GUAA_THEAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::509     e-128  50%  509 aa  GUAA_CARHZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::513     e-126  50%  513 aa  GUAA_SYMTH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-126  49%  513 aa  GUAA_THEM4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::510     e-124  47%  510 aa  GUAA_AQUAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::527     e-124  50%  527 aa  GUAA_THERP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::535     e-124  47%  535 aa  GUAA_THEEB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-123  47%  512 aa  GUAA_THETN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   37::551     e-123  48%  551 aa  GUAA_GLOVI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-123  49%  528 aa  GUAA_THEFY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::534     e-123  50%  534 aa  GUAA_FRASN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-121  49%  525 aa  GUAA_ALHEH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-120  47%  528 aa  GUAA_SYNPX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-120  46%  528 aa  GUAA_SYNS9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::513     e-120  47%  513 aa  GUAA_HELMI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::511     e-120  46%  511 aa  GUAA_ANATD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::516     e-120  46%  516 aa  GUAA_LACAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-120  47%  528 aa  GUAA_PROM3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::506     e-120  46%  506 aa  GUAA_PORG3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::511     e-120  47%  511 aa  GUAA_CALS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::511     e-120  47%  511 aa  GUAA_CLOTH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::516     e-120  49%  516 aa  GUAA_CHLTE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::506     e-119  46%  506 aa  GUAA_PORGI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::512     e-119  47%  512 aa  GUAA_CLONN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::530     e-119  47%  530 aa  GUAA_PROAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-119  46%  517 aa  GUAA_LACGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-119  47%  510 aa  GUAA_GEOKA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-119  47%  528 aa  GUAA_PROMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-118  47%  517 aa  GUAA_VIBVU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::542     e-118  46%  542 aa  GUAA_SYNY3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-118  47%  517 aa  GUAA_VIBVY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::524     e-118  48%  524 aa  GUAA_METCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::542     e-118  45%  542 aa  GUAA_CYAP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-118  46%  528 aa  GUAA_SYNSC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-118  45%  528 aa  GUAA_PROM0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::511     e-118  46%  511 aa  GUAA_CLOCE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::540     e-118  46%  540 aa  GUAA_ANASP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-118  45%  528 aa  GUAA_PROMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-118  47%  520 aa  GUAA_GEOMG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::525     e-117  47%  525 aa  GUAA_STRAW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-117  46%  517 aa  GUAA_LACJO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::540     e-117  46%  540 aa  GUAA_ANAVT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::526     e-117  47%  526 aa  GUAA_STRCO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-117  45%  510 aa  GUAA_FINM2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-117  46%  517 aa  GUAA_VIBPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-117  45%  528 aa  GUAA_PROMP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-117  47%  528 aa  GUAA_PROMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::516     e-117  46%  516 aa  GUAA_NITSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::510     e-117  45%  510 aa  GUAA_HALOH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-117  46%  517 aa  GUAA_VIBCM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-117  46%  517 aa  GUAA_VIBCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-117  46%  517 aa  GUAA_VIBC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-117  48%  513 aa  GUAA_PELPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-116  50%  520 aa  GUAA_THIDA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-116  47%  520 aa  GUAA_GEOSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  44%  510 aa  GUAA_NATTJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::542     e-116  45%  542 aa  GUAA_CYAA5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  46%  510 aa  GUAA_CLOAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-116  48%  513 aa  GUAA_CHLPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::540     e-116  46%  540 aa  GUAA_NOSP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-116  46%  525 aa  GUAA_MYCPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-116  46%  517 aa  GUAA_VIBHB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-116  46%  517 aa  GUAA_LACDB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-116  46%  517 aa  GUAA_LACDA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  45%  510 aa  GUAA_CLOB6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-116  46%  525 aa  GUAA_LEGPH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::526     e-116  46%  526 aa  GUAA_THICR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-116  47%  520 aa  GUAA_PELPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-116  45%  528 aa  GUAA_PROM5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-116  46%  513 aa  GUAA_STACT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-116  46%  525 aa  GUAA_SHEDO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  44%  510 aa  GUAA_CLOK5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  44%  510 aa  GUAA_CLOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  45%  510 aa  GUAA_CLOBH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-116  45%  510 aa  GUAA_CLOB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-116  48%  513 aa  GUAA_CHLL2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::550     e-116  46%  550 aa  GUAA_ACIAD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-115  48%  513 aa  GUAA_PROVI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-115  44%  528 aa  GUAA_PROM2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-115  44%  510 aa  GUAA_CLOBL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-115  44%  510 aa  GUAA_CLOBK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-115  51%  521 aa  GUAA_AZOSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-115  48%  513 aa  GUAA_PELLD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-115  44%  510 aa  GUAA_CLOBJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::511     e-115  47%  511 aa  GUAA_CHLCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::514     e-115  45%  514 aa  GUAA_BRAHW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAA9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::514     e-115  48%  514 aa  GUAA_EXIS2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-115  44%  510 aa  GUAA_CLOBM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-115  47%  525 aa  GUAA_SHESW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-115  47%  525 aa  GUAA_SHEPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-115  47%  525 aa  GUAA_SHEON RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-115  47%  525 aa  GUAA_MARAV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-115  46%  525 aa  GUAA_LEGPL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAA8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-115  45%  513 aa  GUAA_STAA3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-115  47%  520 aa  GUAA_GEOSF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-115  46%  528 aa  GUAA_PROMT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::524     e-115  50%  524 aa  GUAA_NITOC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::539     e-115  49%  539 aa  GUAA_MICLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-115  46%  525 aa  GUAA_LEGPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-114  46%  528 aa  GUAA_PROM1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-114  45%  513 aa  GUAA_STAAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-114  46%  525 aa  GUAA_PSEA6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_LEGPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-114  45%  512 aa  GUAA_BACCN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-114  46%  525 aa  GUAA_ENTS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::506     e-114  44%  506 aa  GUAA_PARD8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-114  47%  521 aa  GUAA_AZOSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-114  44%  517 aa  GUAA_LACRJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-114  44%  517 aa  GUAA_LACRD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-114  46%  525 aa  GUAA_HAMD5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-114  45%  513 aa  GUAA_STAS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  47%  525 aa  GUAA_SHEPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_SHEB9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_SHEB8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_SHEB5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_SHEB2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-114  47%  520 aa  GUAA_PELCD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515     e-114  47%  515 aa  GUAA_DESVV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515     e-114  47%  515 aa  GUAA_DESVH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-114  46%  517 aa  GUAA_VIBF1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-114  46%  525 aa  GUAA_SHISS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-114  46%  525 aa  GUAA_SHIF8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::512     e-114  46%  512 aa  GUAA_OPITP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-114  45%  523 aa  GUAA_HAEDU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-114  46%  525 aa  GUAA_CITK8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_SHESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-114  46%  525 aa  GUAA_SHESA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-114  46%  517 aa  GUAA_ALISL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-113  46%  525 aa  GUAA_SHESR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_PHOLL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-113  47%  513 aa  GUAA_MACCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-113  45%  512 aa  GUAA_BACC1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::526     e-113  46%  526 aa  GUAA_AERS4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-113  45%  517 aa  GUAA_VIBFM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SHIFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::526     e-113  47%  526 aa  GUAA_SALRD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ESCF3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO27 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::509     e-113  43%  509 aa  GUAA_CLOPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACHK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::513     e-113  44%  513 aa  GUAA_BACHD RecName: Full=Putative GMP synthase
   10::525     e-113  46%  525 aa  GUAA_YERE8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_TOLAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  45%  525 aa  GUAA_IDILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOUT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOSM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOLI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOL6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOL5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOHS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECODH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOBW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO8A RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO81 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO7I RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO5E RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO57 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO55 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO45 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECO24 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-113  45%  512 aa  GUAA_BACC2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SHIBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-113  46%  525 aa  GUAA_SHEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-113  45%  512 aa  GUAA_BACWK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACCZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-113  45%  512 aa  GUAA_BACC0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-113  45%  512 aa  GUAA_BACAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACAH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACAA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-113  46%  522 aa  GUAA_XYLFM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-113  46%  517 aa  GUAA_VIBSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-113  46%  525 aa  GUAA_SHEHH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALTY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALTI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALHS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALG2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALEP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALDC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALA4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-113  45%  510 aa  GUAA_ALKMQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-113  46%  522 aa  GUAA_XYLFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SHIB3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-113  46%  525 aa  GUAA_SHEAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::522     e-113  50%  522 aa  GUAA_NITMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_KLEP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_ECOLU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::513     e-113  46%  513 aa  GUAA_BACSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::529     e-113  46%  529 aa  GUAA_AERHH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_TERTT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-113  46%  528 aa  GUAA_SYNS3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-113  45%  513 aa  GUAA_STAEQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SHIDS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SERP5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-113  46%  525 aa  GUAA_SALSV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::525     e-113  47%  525 aa  GUAA_CHRVO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::514     e-113  47%  514 aa  GUAA_CHLPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::512     e-113  45%  512 aa  GUAA_BACC4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::507     e-113  44%  507 aa  GUAA_PETMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-113  45%  523 aa  GUAA_HAEIG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-113  44%  510 aa  GUAA_CLOTE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::515     e-113  45%  515 aa  GUAA_BACCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-112  45%  513 aa  GUAA_STAES RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  46%  525 aa  GUAA_PROMH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::519     e-112  49%  519 aa  GUAA_NITEU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515     e-112  46%  515 aa  GUAA_DESVM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::510     e-112  46%  510 aa  GUAA_SYNWW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::512     e-112  44%  512 aa  GUAA_FUSNN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  46%  525 aa  GUAA_EDWI9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515     e-112  45%  515 aa  GUAA_DESAD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::524     e-112  45%  524 aa  GUAA_COXBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::510     e-112  44%  510 aa  GUAA_CLOB8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512     e-112  48%  512 aa  GUAA_CHLFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  45%  525 aa  GUAA_KLEP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-112  45%  523 aa  GUAA_HAEIE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::513     e-112  46%  513 aa  GUAA_BACLD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::542     e-112  46%  543 aa  GUAA_USTMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-112  46%  525 aa  GUAA_SHEFN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  48%  525 aa  GUAA_ENT38 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::507     e-112  45%  507 aa  GUAA_BACFR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::507     e-112  45%  507 aa  GUAA_BACFN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-112  47%  520 aa  GUAA_RHIL3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  46%  525 aa  GUAA_PSEMY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-112  48%  520 aa  GUAA_PHEZH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::524     e-112  46%  524 aa  GUAA_NOCFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-112  46%  520 aa  GUAA_RHIEC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-112  45%  523 aa  GUAA_HAEIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  45%  525 aa  GUAA_ALTMD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-112  46%  520 aa  GUAA_SINMW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-112  46%  525 aa  GUAA_SHELP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-112  46%  520 aa  GUAA_RHIME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-112  46%  525 aa  GUAA_ERWCT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::511     e-112  49%  511 aa  GUAA_CLOD6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-112  45%  511 aa  GUAA_OCEIH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-112  46%  525 aa  GUAA_MYCTU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-112  46%  525 aa  GUAA_MYCTA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-112  46%  525 aa  GUAA_MYCBT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-112  46%  525 aa  GUAA_MYCBP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-112  46%  525 aa  GUAA_MYCBO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-112  50%  516 aa  GUAA_FRAP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::514     e-112  45%  514 aa  GUAA_CHLT3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::527     e-112  50%  527 aa  GUAA_BURPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::527     e-112  50%  527 aa  GUAA_BURP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-112  45%  523 aa  GUAA_ACTSZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::534     e-111  44%  534 aa  GUAA_SYNP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-111  43%  528 aa  GUAA_PROM9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-111  45%  525 aa  GUAA_MYCMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-111  45%  523 aa  GUAA_HAEI8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::507     e-111  45%  507 aa  GUAA1_BACTN RecName: Full=GMP synthase [glutamine-hydrolyzing] 1;  
   10::522     e-111  45%  522 aa  GUAA_XYLFT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-111  45%  522 aa  GUAA_XYLF2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-111  45%  525 aa  GUAA_SODGM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::527     e-111  45%  527 aa  GUAA_PHOPR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::529     e-111  45%  529 aa  GUAA_MYCLE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::529     e-111  45%  529 aa  GUAA_MYCLB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::516     e-111  46%  516 aa  GUAA_DESDG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::540     e-111  44%  540 aa  GUAA_SYNP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-111  45%  525 aa  GUAA_SHEWM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-111  46%  520 aa  GUAA_RHIE6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-111  50%  516 aa  GUAA_FRATW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-111  50%  516 aa  GUAA_FRATT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-111  50%  516 aa  GUAA_FRATN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-111  50%  516 aa  GUAA_FRATM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-111  50%  516 aa  GUAA_FRAT1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512     e-111  48%  512 aa  GUAA_CHLCV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::527     e-111  50%  527 aa  GUAA_BURXL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-111  46%  520 aa  GUAA_AGRVS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-111  45%  525 aa  GUAA_PECCP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-111  44%  523 aa  GUAA_MANSM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-111  46%  520 aa  GUAA_AGRRK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-111  46%  520 aa  GUAA_RHILW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-111  45%  521 aa  GUAA_NEIMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-111  44%  523 aa  GUAA_HAES1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-111  46%  520 aa  GUAA_RHISN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::526     e-111  49%  526 aa  GUAA_METFK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::515     e-111  43%  515 aa  GUAA_BACSK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-111  46%  523 aa  GUAA_ALCBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-111  45%  520 aa  GUAA_RHILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-111  45%  523 aa  GUAA_PASMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::513     e-111  45%  513 aa  GUAA_BACA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-111  46%  521 aa  GUAA_STRMK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-111  46%  521 aa  GUAA_STRM5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   30::540     e-111  45%  540 aa  GUAA_RHOPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-111  45%  521 aa  GUAA_NEIMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512     e-111  48%  512 aa  GUAA_CHLMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::518     e-111  45%  518 aa  GUAA_BARBK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_PSEF5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-110  45%  521 aa  GUAA_NEIMB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-110  45%  521 aa  GUAA_NEIG2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-110  45%  521 aa  GUAA_NEIG1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::509     e-110  45%  509 aa  GUAA_GRAFK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::542     e-110  44%  542 aa  GUAA_CYAP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::523     e-110  45%  523 aa  GUAA_COREF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::525     e-110  45%  525 aa  GUAA_CORDI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::527     e-110  46%  527 aa  GUAA_YARLI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::529     e-110  45%  529 aa  GUAA_CORJK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::506     e-110  45%  506 aa  GUAA_BDEBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_PSEFS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-110  49%  516 aa  GUAA_FRATO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-110  49%  516 aa  GUAA_FRATF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-110  45%  525 aa  GUAA_YERP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::540     e-110  45%  540 aa  GUAA_NITHX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::503     e-110  46%  503 aa  GUAA_LEIXX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::535     e-110  45%  535 aa  GUAA_BIFLO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::518     e-110  47%  518 aa  GUAA_RHOS5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-109  45%  525 aa  GUAA_PSEU2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-109  44%  523 aa  GUAA_HAES2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::536     e-109  45%  536 aa  GUAA_PSYA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::535     e-109  45%  535 aa  GUAA_NITWN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::509     e-109  43%  509 aa  GUAA_CYTH3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::518     e-109  45%  518 aa  GUAA_BARQU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-109  44%  523 aa  GUAA_ACTPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-109  44%  523 aa  GUAA_ACTP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-109  45%  525 aa  GUAA_PSESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::523     e-109  44%  523 aa  GUAA_CORGL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::513     e-109  44%  513 aa  GUAA_BACP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-109  45%  525 aa  GUAA_PSE14 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-109  49%  516 aa  GUAA_FRATH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::524     e-109  44%  524 aa  GUAA_COXBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::524     e-109  44%  524 aa  GUAA_COXB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::525     e-109  46%  525 aa  GUAA_ASHGO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-109  45%  521 aa  GUAA_XANOR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-109  45%  521 aa  GUAA_XANOM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-109  44%  513 aa  GUAA_STAHJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-109  44%  525 aa  GUAA_PSEPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-109  49%  539 aa  GUAA_JANMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::524     e-109  44%  524 aa  GUAA_COXB2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-109  44%  523 aa  GUAA_HAEPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::523     e-109  44%  523 aa  GUAA_CORGB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-109  45%  521 aa  GUAA_XANOP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-109  45%  520 aa  GUAA_BRUSI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-109  45%  520 aa  GUAA_BRUMB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-109  45%  520 aa  GUAA_BRUAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-109  45%  520 aa  GUAA_BRUA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-109  45%  520 aa  GUAA_BRUA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-109  45%  521 aa  GUAA_XANCP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-109  45%  521 aa  GUAA_XANCB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-109  45%  521 aa  GUAA_XANC8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-109  45%  521 aa  GUAA_NEIM0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-108  44%  525 aa  GUAA_PSEHT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-108  44%  523 aa  GUAA_ACTP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-108  45%  521 aa  GUAA_XANC5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::501     e-108  46%  501 aa  GUAA_THESQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::501     e-108  46%  501 aa  GUAA_THEMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::531     e-108  45%  531 aa  GUAA_OLICO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::518     e-108  45%  518 aa  GUAA_BARHE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-108  45%  508 aa  GUAA_HELPY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-108  45%  508 aa  GUAA_HELPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::524     e-108  44%  524 aa  GUAA_COXBN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::530     e-108  45%  530 aa  GUAA_CANAL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-108  45%  508 aa  GUAA_HELPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::525     e-108  45%  525 aa  GUAA_CANGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-108  44%  520 aa  GUAA_BRUO2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::501     e-108  46%  501 aa  GUAA_THEP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::518     e-108  48%  518 aa  GUAA_RHOSK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::518     e-108  48%  518 aa  GUAA_RHOS4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::518     e-108  48%  518 aa  GUAA_RHOS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-108  43%  525 aa  GUAA_COLP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-108  44%  520 aa  GUAA_BRUSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-108  44%  520 aa  GUAA_BRUC2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   41::551     e-108  43%  551 aa  GUAA_BRAJA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-108  44%  525 aa  GUAA_PSEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-108  49%  539 aa  GUAA_HERAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-108  45%  525 aa  GUAA_MARMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-108  45%  508 aa  GUAA_HELAH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-108  45%  508 aa  GUAA_HELPH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::525     e-107  44%  525 aa  GUAA_YEAST RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::512     e-107  43%  512 aa  GUAA_SPIKU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::517     e-107  44%  517 aa  GUAA_BACV8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::525     e-107  47%  525 aa  GUAA_RHORT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   30::540     e-107  45%  540 aa  GUAA_RHOP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::518     e-107  43%  518 aa  GUAA_LISIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::524     e-107  44%  524 aa  GUAA_KLULA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-107  45%  508 aa  GUAA_HELP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-107  44%  511 aa  GUAA_ARCB4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::521     e-107  45%  521 aa  GUAA_XANAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::529     e-107  45%  529 aa  GUAA_DEBHA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::516     e-107  44%  516 aa  GUAA_SULDN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   80::587     e-107  43%  587 aa  GUAA_RHOBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::519     e-107  48%  519 aa  GUAA_NITEC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::535     e-107  45%  535 aa  GUAA_RHOPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::526     e-107  44%  526 aa  GUAA_PSYIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-107  45%  508 aa  GUAA_HELPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-106  44%  525 aa  GUAA_PSEPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-106  44%  525 aa  GUAA_PSEPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::531     e-106  49%  531 aa  GUAA_BORPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-106  44%  525 aa  GUAA_PSEP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::533     e-106  46%  533 aa  GUAA_EMENI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-106  44%  525 aa  GUAA_PSEE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::535     e-106  47%  535 aa  GUAA_POLSQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::518     e-106  43%  518 aa  GUAA_LISMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::526     e-106  44%  526 aa  GUAA_HAHCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::513     e-106  42%  513 aa  GUAA_CLOBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-106  45%  520 aa  GUAA_CAUCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-106  45%  520 aa  GUAA_CAUCN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::514     e-106  43%  514 aa  GUAA_LISMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::518     e-106  43%  518 aa  GUAA_LISW6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::516     e-106  44%  516 aa  GUAA_DESPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::516     e-106  47%  516 aa  GUAA_DESMR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-105  44%  525 aa  GUAA_CELJU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::533     e-105  42%  533 aa  GUAA_DEHSC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::526     e-105  45%  526 aa  GUAA_BAUCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-105  44%  525 aa  GUAA_SHESH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-105  49%  530 aa  GUAA_BORBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::522     e-105  45%  522 aa  GUAA_ROSDO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::533     e-105  45%  533 aa  GUAA_GLUOX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::513     e-105  42%  513 aa  GUAA_CLOBB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::503     e-105  43%  505 aa  GUAA_PYRAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::523     e-104  42%  523 aa  GUAA_TREDE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::511     e-104  46%  511 aa  GUAA_MYCPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURA4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::535     e-104  46%  535 aa  GUAA_POLNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURCM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-104  49%  530 aa  GUAA_BORPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-104  49%  530 aa  GUAA_BORPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  45%  539 aa  GUAA_CUPTR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURCC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURVG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURM1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::521     e-104  42%  521 aa  GUAA_VESOH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::544     e-104  46%  544 aa  GUAA_DECAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-104  46%  539 aa  GUAA_BURS3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::535     e-104  43%  535 aa  GUAA_BRASO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::533     e-104  42%  533 aa  GUAA_DEHE1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::510     e-104  43%  510 aa  GUAA_CAMFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::525     e-104  43%  525 aa  GUAA_BLOPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-104  43%  525 aa  GUAA_PSEAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-104  43%  525 aa  GUAA_PSEA8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::509     e-104  43%  509 aa  GUAA_FLAJ1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-104  49%  530 aa  GUAA_BORA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-103  45%  539 aa  GUAA_RALME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-103  43%  525 aa  GUAA_PSEAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-103  45%  525 aa  GUAA_AGRT5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::510     e-103  43%  510 aa  GUAA_ELUMP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::524     e-103  43%  524 aa  GUAA_CORAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-103  45%  539 aa  GUAA_RALEH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-103  44%  539 aa  GUAA_RALEJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-103  45%  539 aa  GUAA_BURCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::539     e-103  43%  539 aa  GUAA_SCHPO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::526     e-103  44%  526 aa  GUAA_ZYMMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513     e-102  42%  513 aa  GUAA_SULNB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_RALPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513     e-102  43%  513 aa  GUAA_MESFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::536     e-102  48%  536 aa  GUAA_RHOFD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::518     e-102  42%  518 aa  GUAA_LACPL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_BURP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_BURP0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_BURMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_BURMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_BURM9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-102  45%  539 aa  GUAA_BURM7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::529     e-102  44%  529 aa  GUAA_ANAMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::529     e-102  44%  529 aa  GUAA_ANAMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::519     e-102  44%  519 aa  GUAA_SILPO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::547     e-102  45%  547 aa  GUAA_BURPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::547     e-102  45%  547 aa  GUAA_BURP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::520     e-101  44%  520 aa  GUAA_SILST RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::547     e-101  46%  547 aa  GUAA_RALSO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::528     e-101  40%  528 aa  GUAA_BORGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     e-101  43%  520 aa  GUAA_ENTFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::520     e-101  44%  520 aa  GUAA_DINSH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-101  41%  511 aa  GUAA_CAMHC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-101  42%  517 aa  GUAA_LACRH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::512     e-101  46%  512 aa  GUAA_AERPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-101  42%  517 aa  GUAA_LACSS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-101  42%  517 aa  GUAA_LACCB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-101  42%  517 aa  GUAA_LACC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::509     e-100  43%  509 aa  GUAA_FLAPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::524     e-100  42%  524 aa  GUAA_EUBR3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::534     e-100  45%  534 aa  GUAA_METPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-100  42%  513 aa  GUAA_LACLM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-100  42%  513 aa  GUAA_LACLA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::503     e-100  43%  503 aa  GUAA_TROW8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::527     e-100  43%  527 aa  GUAA_STRT2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::521     e-100  43%  521 aa  GUAA_WOLSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRZT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRZP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRR6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRPN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRPI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRP4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     e-100  43%  520 aa  GUAA_STRP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::513     e-100  42%  513 aa  GUAA_LACLS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::527     e-100  43%  527 aa  GUAA_STRT1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::518     e-100  42%  518 aa  GUAA_LACS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::541     e-100  44%  541 aa  GUAA_ASPOR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-100  41%  517 aa  GUAA_PEDPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::503     1e-99  42%  503 aa  GUAA_TROWT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::526     1e-99  44%  526 aa  GUAA_BLOFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRU0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRPZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRPM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-99  42%  520 aa  GUAA_STRP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     3e-99  42%  520 aa  GUAA_STRP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     3e-99  42%  520 aa  GUAA_STRA5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     3e-99  42%  520 aa  GUAA_STRA3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     3e-99  42%  520 aa  GUAA_STRA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     5e-99  43%  520 aa  GUAA_STRZJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::520     5e-99  43%  520 aa  GUAA_STRPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::557     1e-98  45%  557 aa  GUAA_ASPFU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-98  42%  520 aa  GUAA_STRPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     2e-98  42%  520 aa  GUAA_STRPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::541     2e-98  43%  541 aa  GUAA_PHANO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::521     3e-98  41%  521 aa  GUAA_RUTMC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::524     3e-98  42%  524 aa  GUAA_EUBE2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     3e-98  42%  520 aa  GUAA_STRS7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     8e-98  40%  511 aa  GUAA_CAMLR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     1e-97  42%  517 aa  GUAA_STRMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::520     1e-97  42%  520 aa  GUAA_STRE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::526     1e-96  41%  526 aa  GUAA_EHRCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     2e-96  40%  511 aa  GUAA_CAMJ8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::528     3e-96  41%  528 aa  GUAA_BORBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::526     5e-96  42%  526 aa  GUAA_EHRCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     7e-96  40%  511 aa  GUAA_CAMJJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     2e-95  40%  511 aa  GUAA_CAMJR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     2e-95  40%  511 aa  GUAA_CAMJE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     2e-95  40%  511 aa  GUAA_CAMJD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::513     3e-95  43%  513 aa  GUAA_GEMAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     2e-92  42%  520 aa  GUAA_WOLWR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     2e-92  42%  520 aa  GUAA_WOLPM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::522     5e-91  41%  522 aa  GUAA_WIGBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::522     5e-87  43%  522 aa  GUAA_GIBZE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::456     2e-86  42%  507 aa  GUAA_BRUME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::528     9e-86  40%  528 aa  GUAA_EHRRG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::528     1e-85  40%  528 aa  GUAA_EHRRW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     4e-85  40%  520 aa  GUAA_WOLPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::521     1e-83  37%  521 aa  GUAA_PELUB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     3e-82  41%  520 aa  GUAA_WOLTR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::482     9e-67  36%  603 aa  GUAA_LEPIN RecName: Full=Probable GMP synthase
    7::482     9e-67  36%  603 aa  GUAA_LEPIC RecName: Full=Probable GMP synthase
   19::308     1e-61  50%  308 aa  GUAAB_PYRAB RecName: Full=GMP synthase [glutamine-hydrolyzing]
   18::307     4e-61  50%  307 aa  GUAAB_PYRKO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::308     6e-61  49%  308 aa  GUAAB_PYRHO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   24::313     1e-60  48%  313 aa  GUAAB_PYRFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    8::585     8e-60  49% 1375 aa  GUAA_HELHP RecName: Full=Probable GMP synthase
   28::562     8e-58  38%  693 aa  GUAA_MOUSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::562     1e-57  38%  693 aa  GUAA_RAT RecName: Full=GMP synthase [glutamine-hydrolyzing];       
   21::305     2e-57  45%  305 aa  GUAAB_PICTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::310     2e-57  46%  310 aa  GUAAB_METJA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   28::562     5e-57  37%  693 aa  GUAA_PONAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::562     7e-57  37%  693 aa  GUAA_HUMAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::307     1e-56  44%  308 aa  GUAAB_METTH RecName: Full=GMP synthase [glutamine-hydrolyzing]
   22::303     1e-56  46%  303 aa  GUAAB_ARCFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::310     2e-55  43%  310 aa  GUAAB_METVS RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::305     5e-55  48%  305 aa  GUAAB_METMJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
  117::435     1e-54  40%  435 aa  GUAA2_BACTN RecName: Full=Putative GMP synthase
   23::305     5e-54  47%  305 aa  GUAAB_METMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::310     7e-54  44%  310 aa  GUAAB_THEAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::305     2e-53  46%  305 aa  GUAAB_METAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::305     3e-53  46%  305 aa  GUAAB_UNCMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::305     3e-53  46%  305 aa  GUAAB_METBF RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::310     4e-53  42%  310 aa  GUAAB_THEVO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::310     6e-53  43%  310 aa  GUAAB_METM7 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::305     2e-52  47%  305 aa  GUAAB_METPE RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::304     2e-52  43%  304 aa  GUAAB_METBU RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::310     2e-52  42%  310 aa  GUAAB_METMP RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::305     2e-52  45%  305 aa  GUAAB_METB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   11::206     6e-52  45%  429 aa  GUAA_CHLPN RecName: Full=Putative GMP synthase
  108::662     2e-50  36%  792 aa  GUAA_CAEEL RecName: Full=Probable GMP synthase
   20::305     7e-49  43%  305 aa  GUAAB_NATPD RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::305     7e-49  44%  305 aa  GUAAB_HALSA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::305     7e-49  44%  305 aa  GUAAB_HALS3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::305     3e-48  43%  305 aa  GUAAB_HALMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   43::584     6e-48  34%  718 aa  GUAA_DICDI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::305     9e-46  42%  305 aa  GUAAB_HALLT RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::314     4e-44  46%  314 aa  GUAAB_METKA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     2e-41  40%  367 aa  GUAAB_SULSO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     3e-37  38%  367 aa  GUAAB_SULIY RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     3e-37  38%  367 aa  GUAAB_SULIN RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     3e-37  38%  367 aa  GUAAB_SULIM RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     3e-37  38%  367 aa  GUAAB_SULIL RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     3e-37  38%  367 aa  GUAAB_SULIK RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::367     3e-37  38%  367 aa  GUAAB_SULIA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::370     1e-32  38%  370 aa  GUAAB_SULTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     6e-32  38%  188 aa  GUAAA_PYRKO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    2::187     8e-31  37%  189 aa  GUAAA_PYRHO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     2e-30  36%  188 aa  GUAAA_PYRFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     4e-30  37%  188 aa  GUAAA_PYRAB RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::185     2e-28  37%  188 aa  GUAAA_SULAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::184     1e-27  37%  188 aa  GUAAA_SULTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    8::183     4e-27  41%  188 aa  GUAAA_SULSO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     4e-27  38%  188 aa  GUAAA_METJA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     5e-25  36%  189 aa  GUAAA_METMP RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     5e-25  36%  189 aa  GUAAA_METM5 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::183     9e-25  35%  186 aa  GUAAA_METTH RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     1e-24  35%  189 aa  GUAAA_METM7 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     1e-24  35%  189 aa  GUAAA_METM6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     3e-24  36%  189 aa  GUAAA_METVS RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::179     4e-24  32%  186 aa  GUAAA_METST RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     3e-23  35%  188 aa  GUAAA_META3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   38::180     6e-23  42%  184 aa  GUAAA_HALWD RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::185     1e-22  40%  189 aa  GUAAA_METBF RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::185     2e-22  35%  187 aa  GUAAA_METKA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   46::181     2e-22  41%  183 aa  GUAAA_HALSA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::185     3e-22  35%  188 aa  GUAAA_IGNH4 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   28::178     7e-22  37%  181 aa  GUAAA_METTP RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::185     2e-21  39%  189 aa  GUAAA_METAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::185     2e-21  39%  189 aa  GUAAA_METMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::180     4e-21  34%  184 aa  GUAAA_NATPD RecName: Full=GMP synthase [glutamine-hydrolyzing]
   28::178     8e-21  36%  184 aa  GUAAA_METB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   70::182     1e-20  39%  190 aa  GUAAA_METS3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::189     1e-20  32%  189 aa  GUAAA_UNCMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   45::174     1e-19  40%  178 aa  TRPG_ARCFU RecName: Full=Anthranilate synthase component 2;        
   45::180     2e-19  39%  189 aa  GUAAA_HALMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::181     3e-19  36%  188 aa  GUAAA_METHJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::185     4e-19  34%  189 aa  GUAAA_METBU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::184     1e-18  31%  188 aa  GUAAA_PICTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   68::180     1e-17  37%  183 aa  GUAAA_ARCFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::185     7e-17  31%  187 aa  PABA_ECOLI RecName: Full=Para-aminobenzoate synthase glutamine
   36::186     7e-17  34%  194 aa  PABA_BACSU RecName: Full=Para-aminobenzoate/anthranilate synthase
   75::197     2e-16  34%  200 aa  GUAAA_THEAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   68::178     4e-16  38%  184 aa  GUAAA_METMJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
   49::188     6e-16  37%  723 aa  PABS_STRGR RecName: Full=Para-aminobenzoate synthase;       
   83::234     2e-15  28%  589 aa  TRPG_THEMA RecName: Full=Anthranilate synthase component II;       
   37::198     5e-15  32%  765 aa  TRPG_PHYBL RecName: Full=Anthranilate synthase component 2;        
   44::185     5e-15  33%  187 aa  PABA_SALTY RecName: Full=Para-aminobenzoate synthase glutamine
   36::189     8e-15  37%  191 aa  PABA_SERMA RecName: Full=Para-aminobenzoate synthase glutamine
    1::185     8e-15  29%  187 aa  PABA_KLEAE RecName: Full=Para-aminobenzoate synthase glutamine
   36::186     1e-14  36%  196 aa  TRPG_AZOBR RecName: Full=Anthranilate synthase component 2;        
   27::189     2e-14  31%  192 aa  TRPG_PYRKO RecName: Full=Anthranilate synthase component II;       
   42::196     3e-14  31%  367 aa  TRPG_PICAN RecName: Full=Anthranilate synthase component 2;        
   48::199     7e-14  33%  204 aa  TRPG_THET8 RecName: Full=Anthranilate synthase component II;       
   76::187     9e-14  34%  202 aa  GUAAA_THEVO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   64::216     1e-13  30%  759 aa  TRPG_SCHPO RecName: Full=Anthranilate synthase component 2;        
    1::197     2e-13  28%  198 aa  TRPG_LACLA RecName: Full=Anthranilate synthase component II;       
   36::197     3e-13  31%  201 aa  TRPG_PSEAE RecName: Full=Anthranilate synthase component II;       
   55::222     3e-13  31%  752 aa  TRPG_PENCH RecName: Full=Anthranilate synthase component 2;        
   50::202     4e-13  31%  484 aa  TRPG_YEAST RecName: Full=Anthranilate synthase component 2;        
   39::194     8e-13  30%  197 aa  TRPG_METJA RecName: Full=Anthranilate synthase component II;       
   60::229     8e-13  30%  770 aa  TRPG_ASPNG RecName: Full=Anthranilate synthase component 2;        
   60::219     1e-12  30%  762 aa  TRPG_NEUCR RecName: Full=Anthranilate synthase component 2;        
   84::196     1e-12  39%  196 aa  TRPG_METTH RecName: Full=Anthranilate synthase component II;       
   35::197     1e-12  31%  201 aa  TRPG_SHIDY RecName: Full=Anthranilate synthase component II;       
   40::195     2e-12  32%  204 aa  TRPG_HALVO RecName: Full=Anthranilate synthase component II;       
   35::197     2e-12  32%  531 aa  TRPG_SALTY RecName: Full=Anthranilate synthase component II;       
   51::218     2e-12  28%  768 aa  TRPG_EMENI RecName: Full=Anthranilate synthase component 2;        
    1::187     3e-12  28%  189 aa  TRPG_PORYE RecName: Full=Anthranilate synthase component II;       
    1::186     3e-12  26%  190 aa  TRPG_CYAPA RecName: Full=Anthranilate synthase component II;       
  207::375     3e-12  35%  375 aa  CARA_MYCLE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   45::198     4e-12  30%  198 aa  TRPG_PSEPU RecName: Full=Anthranilate synthase component II;       
   35::193     4e-12  33%  531 aa  TRPG_ECOLI RecName: Full=Anthranilate synthase component II;       
   58::227     4e-12  29%  768 aa  TRPG_ASPAW RecName: Full=Anthranilate synthase component 2;        
  219::361     5e-12  35%  383 aa  CARA_SYNPX RecName: Full=Carbamoyl-phosphate synthase small chain; 
   43::204     6e-12  32%  207 aa  TRPG1_HALMA RecName: Full=Anthranilate synthase component II;      
   42::193     1e-11  33%  193 aa  TRPG_SERMA RecName: Full=Anthranilate synthase component II;       
   35::195     1e-11  25%  196 aa  TRPG_VIBPA RecName: Full=Anthranilate synthase component II;       
   61::197     1e-11  35%  198 aa  TRPG_HALSA RecName: Full=Anthranilate synthase component II;       
   52::196     2e-11  36%  196 aa  TRPG_METTM RecName: Full=Anthranilate synthase component II;       
   36::192     2e-11  30%  194 aa  TRPG_ACIAD RecName: Full=Anthranilate synthase component 2;        
  571::715     2e-11  33%  729 aa  TRPE_RHIME RecName: Full=Anthranilate synthase;       
   39::210     2e-11  29%  788 aa  TRPG_PHACH RecName: Full=Anthranilate synthase component 2;        
  205::373     2e-11  35%  373 aa  CARA_MYCPA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   35::190     3e-11  30%  192 aa  TRPG_YERPE RecName: Full=Anthranilate synthase component II;       
   79::191     3e-11  36%  194 aa  TRPG_HELPY RecName: Full=Anthranilate synthase component II;       
   41::188     3e-11  32%  192 aa  TRPG_BUCBP RecName: Full=Anthranilate synthase component 2;        
  227::387     4e-11  33%  391 aa  CARA_SYNP6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   79::184     5e-11  33%  194 aa  TRPG_HELPJ RecName: Full=Anthranilate synthase component II;       
  227::387     7e-11  33%  391 aa  CARA_SYNE7 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUSU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUSI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUO2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUME RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUMB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUC2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUAB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUA2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::399     7e-11  36%  407 aa  CARA_BRUA1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   52::187     9e-11  34%  193 aa  Y1171_HAEIN RecName: Full=Putative anthranilate synthase component
  234::399     9e-11  36%  407 aa  CARA_OCHA4 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  209::370     2e-10  35%  376 aa  CARA_MYCTU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  209::370     2e-10  35%  376 aa  CARA_MYCBO RecName: Full=Carbamoyl-phosphate synthase small chain; 
   36::203     3e-10  32%  208 aa  TRPG_CORGL RecName: Full=Anthranilate synthase component 2;        
   45::210     4e-10  40%  216 aa  HIS5_SYNJA RecName: Full=Imidazole glycerol phosphate synthase
  220::386     4e-10  30%  393 aa  CARA_CORGL RecName: Full=Carbamoyl-phosphate synthase small chain; 
   40::199     5e-10  31%  201 aa  TRPG_LEPBI RecName: Full=Anthranilate synthase component II;       
   51::199     5e-10  29%  752 aa  TRPG_CRYNE RecName: Full=Anthranilate synthase component 2;        
  572::701     5e-10  32%  732 aa  TRPE_AZOBR RecName: Full=Anthranilate synthase;       
   79::192     6e-10  35%  195 aa  TRPG_SULSO RecName: Full=Anthranilate synthase component II;       
   41::188     8e-10  30%  193 aa  TRPG_HAEIN RecName: Full=Anthranilate synthase component II;       
   43::183     8e-10  35%  190 aa  TRPG2_HALMA RecName: Full=Anthranilate synthase component II;      
   75::204     8e-10  46%  204 aa  HIS5_VIBVU RecName: Full=Imidazole glycerol phosphate synthase
   75::204     8e-10  46%  204 aa  HIS51_VIBVY RecName: Full=Imidazole glycerol phosphate synthase
   51::199     1e-09  26%  752 aa  TRPG_CRYNV RecName: Full=Anthranilate synthase component 2;        
  196::352     1e-09  36%  363 aa  CARA_SYMTH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  225::375     2e-09  31%  400 aa  CARA_COREF RecName: Full=Carbamoyl-phosphate synthase small chain; 
  210::378     2e-09  29%  379 aa  CARA_CORDI RecName: Full=Carbamoyl-phosphate synthase small chain; 
   29::191     2e-09  31%  200 aa  PHNB_PSEAE RecName: Full=Anthranilate synthase component II,
   74::203     2e-09  43%  203 aa  HIS5_VIBCH RecName: Full=Imidazole glycerol phosphate synthase
   69::210     2e-09  38%  212 aa  HIS5_PSEPK RecName: Full=Imidazole glycerol phosphate synthase
  228::389     2e-09  36%  398 aa  CARA_RHILO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  227::388     3e-09  32%  388 aa  CARA_CAUCR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::187     5e-09  25%  189 aa  TRPG_PORPU RecName: Full=Anthranilate synthase component II;       
  215::378     5e-09  32%  382 aa  CARA_THEEB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  213::379     7e-09  32%  380 aa  CARA_STRAW RecName: Full=Carbamoyl-phosphate synthase small chain; 
  213::379     9e-09  32%  380 aa  CARA_STRCO RecName: Full=Carbamoyl-phosphate synthase small chain; 
   75::204     1e-08  44%  204 aa  HIS5_VIBPA RecName: Full=Imidazole glycerol phosphate synthase
  232::393     1e-08  34%  401 aa  CARA_RHIME RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::350     2e-08  35%  365 aa  CARA_BACCR RecName: Full=Carbamoyl-phosphate synthase small chain; 
   72::201     3e-08  39%  201 aa  HIS5_PHOLL RecName: Full=Imidazole glycerol phosphate synthase
   71::201     3e-08  34%  202 aa  HIS5_METAC RecName: Full=Imidazole glycerol phosphate synthase
  212::373     4e-08  29%  374 aa  CARA_ZYMMO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  213::374     4e-08  34%  382 aa  CARA_SYNR3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   78::205     6e-08  41%  218 aa  HIS5_SYNJB RecName: Full=Imidazole glycerol phosphate synthase
   77::212     6e-08  37%  212 aa  HIS5_NITEU RecName: Full=Imidazole glycerol phosphate synthase
  195::351     6e-08  32%  364 aa  CARA_BACCL RecName: Full=Carbamoyl-phosphate synthase
   47::193     7e-08  28%  195 aa  TRPG_CYACA RecName: Full=Anthranilate synthase component II;       
   76::197     7e-08  28%  718 aa  PABS_SCHPO RecName: Full=Putative aminodeoxychorismate synthase;   
   71::201     7e-08  33%  202 aa  HIS5_METMA RecName: Full=Imidazole glycerol phosphate synthase
   81::213     7e-08  40%  218 aa  HIS5_HALSA RecName: Full=Imidazole glycerol phosphate synthase
   71::205     1e-07  43%  211 aa  HIS5_GEOKA RecName: Full=Imidazole glycerol phosphate synthase
  190::344     1e-07  27%  355 aa  CARX_LACPL RecName: Full=Carbamoyl-phosphate synthase
  220::362     1e-07  31%  388 aa  CARA_ANASP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   78::193     1e-07  30%  200 aa  TRPG_BUCAI RecName: Full=Anthranilate synthase component 2;        
   73::208     1e-07  38%  211 aa  HIS5_CORGL RecName: Full=Imidazole glycerol phosphate synthase
   70::211     1e-07  36%  213 aa  HIS51_PSEAE RecName: Full=Imidazole glycerol phosphate synthase
  233::394     1e-07  30%  396 aa  CARA_BRAJA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   74::204     2e-07  35%  204 aa  HIS5_BDEBA RecName: Full=Imidazole glycerol phosphate synthase
  197::358     2e-07  30%  363 aa  CARA_LISIN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  214::373     2e-07  33%  374 aa  CARA_XYLFT RecName: Full=Carbamoyl-phosphate synthase small chain; 
  201::355     2e-07  32%  363 aa  CARA_LEPBL RecName: Full=Carbamoyl-phosphate synthase small chain; 
  201::355     2e-07  32%  363 aa  CARA_LEPBJ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  184::367     2e-07  24%  372 aa  CARA_AKKM8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   83::213     3e-07  38%  214 aa  HIS5_RHORT RecName: Full=Imidazole glycerol phosphate synthase
  188::343     3e-07  30%  356 aa  CARA_THETN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::377     3e-07  29%  378 aa  CARA_PSEPK RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::292     3e-07  38%  382 aa  CARA_ERWCT RecName: Full=Carbamoyl-phosphate synthase small chain; 
  195::348     3e-07  30%  349 aa  CARA_CLOPE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  235::384     3e-07  30%  399 aa  CARA_BARHE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  172::351     3e-07  26%  362 aa  CARA_BACHD RecName: Full=Carbamoyl-phosphate synthase
   60::220     4e-07  28%  768 aa  TRPG_COCHE RecName: Full=Anthranilate synthase component 2;        
   47::212     4e-07  36%  212 aa  HIS5_SILPO RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_SHISS RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_SHIFL RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_SHIDS RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_SHIBS RecName: Full=Imidazole glycerol phosphate synthase
   72::205     4e-07  39%  212 aa  HIS5_PSEU2 RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_ECOLI RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_ECOL6 RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-07  37%  196 aa  HIS5_ECO57 RecName: Full=Imidazole glycerol phosphate synthase
   72::196     5e-07  38%  196 aa  HIS5_YERPS RecName: Full=Imidazole glycerol phosphate synthase
   72::196     5e-07  38%  196 aa  HIS5_YERPE RecName: Full=Imidazole glycerol phosphate synthase
  227::371     5e-07  26%  390 aa  CARA_MARMM RecName: Full=Carbamoyl-phosphate synthase small chain; 
   69::205     6e-07  39%  212 aa  HIS5_PSE14 RecName: Full=Imidazole glycerol phosphate synthase
   62::202     6e-07  36%  211 aa  HIS5_CYAP7 RecName: Full=Imidazole glycerol phosphate synthase
   74::203     6e-07  42%  207 aa  HIS5_BACSK RecName: Full=Imidazole glycerol phosphate synthase
  214::373     6e-07  28%  374 aa  CARA_XYLFA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  220::374     6e-07  30%  384 aa  CARA_SYNY3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::358     6e-07  30%  363 aa  CARA_LISMO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::358     6e-07  30%  363 aa  CARA_LISMF RecName: Full=Carbamoyl-phosphate synthase small chain; 
  195::349     6e-07  30%  364 aa  CARA_BACSU RecName: Full=Carbamoyl-phosphate synthase
   75::204     8e-07  39%  217 aa  HIS5_SYNP6 RecName: Full=Imidazole glycerol phosphate synthase
   75::204     8e-07  39%  217 aa  HIS5_SYNE7 RecName: Full=Imidazole glycerol phosphate synthase
   69::205     8e-07  39%  212 aa  HIS5_PSESM RecName: Full=Imidazole glycerol phosphate synthase
   64::203     8e-07  39%  206 aa  HIS5_PELCD RecName: Full=Imidazole glycerol phosphate synthase
   32::203     8e-07  33%  212 aa  HIS5_MICAN RecName: Full=Imidazole glycerol phosphate synthase
  202::356     8e-07  30%  363 aa  CARA_LEPIN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  202::356     8e-07  30%  363 aa  CARA_LEPIC RecName: Full=Carbamoyl-phosphate synthase small chain; 
   72::196     1e-06  37%  196 aa  HIS5_SALTY RecName: Full=Imidazole glycerol phosphate synthase
   72::196     1e-06  37%  196 aa  HIS5_SALTI RecName: Full=Imidazole glycerol phosphate synthase
   72::196     1e-06  37%  196 aa  HIS5_SALPA RecName: Full=Imidazole glycerol phosphate synthase
   72::196     1e-06  37%  196 aa  HIS5_SALCH RecName: Full=Imidazole glycerol phosphate synthase
   69::205     1e-06  37%  212 aa  HIS5_PSEPF RecName: Full=Imidazole glycerol phosphate synthase
   69::205     1e-06  37%  212 aa  HIS5_PSEF5 RecName: Full=Imidazole glycerol phosphate synthase
  218::378     1e-06  30%  391 aa  CARA_YERPS RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::378     1e-06  30%  391 aa  CARA_YERPE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  226::367     1e-06  32%  389 aa  CARA_RHOBA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  221::381     1e-06  28%  381 aa  CARA_HALER RecName: Full=Carbamoyl-phosphate synthase small chain; 
   41::193     1e-06  25%  196 aa  TRPG_BUCAP RecName: Full=Anthranilate synthase component 2;        
  218::373     1e-06  30%  379 aa  CARA_VIBPA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  169::328     1e-06  32%  348 aa  CARA_THEAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
  215::376     1e-06  28%  377 aa  CARA_NEIMB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  223::383     1e-06  30%  386 aa  CARA_HYPNA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  222::377     2e-06  29%  386 aa  CARA_TERTT RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::373     2e-06  26%  382 aa  CARA_SALTY RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::398     2e-06  30%  407 aa  CARA_BIFLO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::398     2e-06  30%  407 aa  CARA_BIFLD RecName: Full=Carbamoyl-phosphate synthase small chain; 
  233::382     2e-06  31%  399 aa  CARA_BARBK RecName: Full=Carbamoyl-phosphate synthase small chain; 
  189::369     2e-06  25%  371 aa  CARA_AQUAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   77::210     2e-06  41%  210 aa  HIS5_PHOPR RecName: Full=Imidazole glycerol phosphate synthase
   71::201     2e-06  30%  202 aa  HIS5_METBF RecName: Full=Imidazole glycerol phosphate synthase
   70::192     2e-06  38%  194 aa  HIS5_MANSM RecName: Full=Imidazole glycerol phosphate synthase
  218::373     2e-06  25%  382 aa  CARA_SALTI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::398     2e-06  30%  407 aa  CARA_BIFLI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::390     2e-06  30%  398 aa  CARA_BART1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   39::202     3e-06  33%  211 aa  HIS5_ANAVT RecName: Full=Imidazole glycerol phosphate synthase
  174::346     3e-06  29%  366 aa  CARA_STAEQ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  222::377     3e-06  28%  386 aa  CARA_SHEON RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::350     3e-06  33%  365 aa  CARA_BACC1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::368     4e-06  27%  391 aa  CARA_THET8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::368     4e-06  27%  391 aa  CARA_THET2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::346     4e-06  29%  366 aa  CARA_STAES RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::357     4e-06  27%  366 aa  CARA_OCEIH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::350     4e-06  33%  365 aa  CARA_BACHK RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::350     4e-06  33%  365 aa  CARA_BACCZ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::350     4e-06  33%  365 aa  CARA_BACAN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::381     4e-06  32%  401 aa  CARA_AGRT5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   39::202     5e-06  33%  211 aa  HIS5_ANASP RecName: Full=Imidazole glycerol phosphate synthase
  218::378     5e-06  27%  378 aa  CARA_PSEAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  215::376     5e-06  28%  377 aa  CARA_NEIMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   81::220     7e-06  39%  222 aa  HIS5_STRCO RecName: Full=Imidazole glycerol phosphate synthase
   81::210     7e-06  36%  213 aa  HIS5_CAUCR RecName: Full=Imidazole glycerol phosphate synthase
  216::371     7e-06  30%  379 aa  CARA_THISH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::356     7e-06  28%  360 aa  CARA_STRP6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::356     7e-06  28%  360 aa  CARA_STRP3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::356     7e-06  28%  360 aa  CARA_STRP1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  248::385     7e-06  32%  388 aa  CARA_SILPO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::373     7e-06  28%  384 aa  CARA_PHOPR RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::373     7e-06  31%  382 aa  CARA_ECOLI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::373     7e-06  31%  382 aa  CARA_ECO57 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  234::383     7e-06  33%  398 aa  CARA_BARQU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  217::378     7e-06  27%  379 aa  CARA_ACIAD RecName: Full=Carbamoyl-phosphate synthase small chain; 
   86::229     9e-06  36%  229 aa  HIS5_ZYMMO RecName: Full=Imidazole glycerol phosphate synthase
   74::204     9e-06  35%  206 aa  HIS5_MYCPA RecName: Full=Imidazole glycerol phosphate synthase
   81::215     9e-06  39%  215 aa  HIS5_DEIRA RecName: Full=Imidazole glycerol phosphate synthase
  213::287     9e-06  32%  374 aa  CARA_DESAD RecName: Full=Carbamoyl-phosphate synthase small chain; 
   72::203     1e-05  36%  210 aa  HIS5_SYNY3 RecName: Full=Imidazole glycerol phosphate synthase
   77::207     1e-05  37%  209 aa  HIS5_NITOC RecName: Full=Imidazole glycerol phosphate synthase
   74::212     1e-05  41%  213 aa  HIS5_GEOTN RecName: Full=Imidazole glycerol phosphate synthase
   70::203     1e-05  33%  214 aa  HIS5_ACAM1 RecName: Full=Imidazole glycerol phosphate synthase
  218::373     1e-05  27%  379 aa  CARA_VIBVU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::375     1e-05  28%  384 aa  CARA_PORPU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  200::343     1e-05  30%  356 aa  CARA_METTH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::349     1e-05  30%  353 aa  CARA_HALSA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::349     1e-05  30%  353 aa  CARA_HALS3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   51::198     2e-05  38%  200 aa  HIS5_XANC5 RecName: Full=Imidazole glycerol phosphate synthase
   70::199     2e-05  38%  201 aa  HIS5_STRMU RecName: Full=Imidazole glycerol phosphate synthase
   72::196     2e-05  36%  196 aa  HIS5_ERWCT RecName: Full=Imidazole glycerol phosphate synthase
   71::196     2e-05  38%  211 aa  HIS5_DESHY RecName: Full=Imidazole glycerol phosphate synthase
  218::373     2e-05  27%  379 aa  CARA_VIBVY RecName: Full=Carbamoyl-phosphate synthase small chain; 
   75::204     2e-05  42%  204 aa  HIS5_VIBF1 RecName: Full=Imidazole glycerol phosphate synthase
   48::194     2e-05  35%  194 aa  HIS5_PYRFU RecName: Full=Imidazole glycerol phosphate synthase
   76::210     2e-05  36%  215 aa  HIS5_NATPD RecName: Full=Imidazole glycerol phosphate synthase
   70::202     2e-05  38%  211 aa  HIS5_CYAP4 RecName: Full=Imidazole glycerol phosphate synthase
  218::373     2e-05  34%  387 aa  CARA_PHOLL RecName: Full=Carbamoyl-phosphate synthase small chain; 
  207::349     2e-05  26%  368 aa  CARA_METMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  199::340     2e-05  27%  358 aa  CARA_ARCFU RecName: Full=Carbamoyl-phosphate synthase small chain; 
   72::180     3e-05  35%  195 aa  PDXT_MYCVP RecName: Full=Glutamine amidotransferase subunit pdxT;  
   51::198     3e-05  38%  200 aa  HIS5_XANOR RecName: Full=Imidazole glycerol phosphate synthase
   51::198     3e-05  38%  200 aa  HIS5_XANOM RecName: Full=Imidazole glycerol phosphate synthase
   74::212     3e-05  36%  215 aa  HIS5_STRAW RecName: Full=Imidazole glycerol phosphate synthase
   71::202     3e-05  36%  212 aa  HIS5_DESVM RecName: Full=Imidazole glycerol phosphate synthase
   66::196     3e-05  35%  196 aa  HIS5_BUCBP RecName: Full=Imidazole glycerol phosphate synthase
   72::202     3e-05  41%  214 aa  HIS5_BACHD RecName: Full=Imidazole glycerol phosphate synthase
   72::195     3e-05  41%  209 aa  HIS5_BACC2 RecName: Full=Imidazole glycerol phosphate synthase
  174::346     3e-05  31%  366 aa  CARA_STAHJ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  222::364     3e-05  31%  384 aa  CARA_PSEST RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::375     3e-05  27%  384 aa  CARA_PORYE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  215::365     3e-05  27%  377 aa  CARA_NEIGO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  193::371     3e-05  27%  394 aa  CARA_DEIGD RecName: Full=Carbamoyl-phosphate synthase small chain; 
   44::206     3e-05  34%  209 aa  HIS5_THEEB RecName: Full=Imidazole glycerol phosphate synthase
   67::202     3e-05  36%  213 aa  HIS5_DESVV RecName: Full=Imidazole glycerol phosphate synthase
  173::351     3e-05  26%  359 aa  CARA_STRR6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::351     3e-05  26%  359 aa  CARA_STRPN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  218::292     3e-05  32%  382 aa  CARA_ECOL6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   51::198     4e-05  38%  200 aa  HIS5_XANCP RecName: Full=Imidazole glycerol phosphate synthase
   51::198     4e-05  38%  200 aa  HIS5_XANC8 RecName: Full=Imidazole glycerol phosphate synthase
   51::198     4e-05  37%  200 aa  HIS5_XANAC RecName: Full=Imidazole glycerol phosphate synthase
   78::209     4e-05  39%  228 aa  HIS5_THIDA RecName: Full=Imidazole glycerol phosphate synthase
   42::202     4e-05  30%  211 aa  HIS5_NOSP7 RecName: Full=Imidazole glycerol phosphate synthase
   77::209     4e-05  39%  217 aa  HIS5_METCA RecName: Full=Imidazole glycerol phosphate synthase
   71::196     4e-05  38%  211 aa  HIS5_DESHD RecName: Full=Imidazole glycerol phosphate synthase
   72::195     4e-05  38%  209 aa  HIS5_BACCR RecName: Full=Imidazole glycerol phosphate synthase
   72::195     4e-05  38%  209 aa  HIS5_BACC4 RecName: Full=Imidazole glycerol phosphate synthase
  193::371     4e-05  27%  394 aa  CARA_DEIRA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   66::202     6e-05  35%  214 aa  HIS5_TRIEI RecName: Full=Imidazole glycerol phosphate synthase
   80::210     6e-05  37%  212 aa  HIS5_NEIMA RecName: Full=Imidazole glycerol phosphate synthase
   80::210     6e-05  37%  212 aa  HIS5_NEIG1 RecName: Full=Imidazole glycerol phosphate synthase
   67::202     6e-05  36%  213 aa  HIS5_DESVH RecName: Full=Imidazole glycerol phosphate synthase
   77::181     8e-05  32%  205 aa  YL716_MIMIV RecName: Full=Putative glutamine amidotransferase-like
   70::199     8e-05  32%  208 aa  HIS5_LISMH RecName: Full=Imidazole glycerol phosphate synthase
   71::199     8e-05  36%  208 aa  HIS5_LISIN RecName: Full=Imidazole glycerol phosphate synthase
   75::202     8e-05  37%  202 aa  HIS52_METMP RecName: Full=Imidazole glycerol phosphate synthase
  193::259     8e-05  36%  359 aa  CARX_BACHD RecName: Full=Carbamoyl-phosphate synthase
  224::298     8e-05  32%  384 aa  CARA_RHOGE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  203::350     8e-05  28%  371 aa  CARA_PROA2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   35::171     1e-04  30%  189 aa  PDXT_METLZ RecName: Full=Glutamine amidotransferase subunit pdxT;  
   72::199     1e-04  32%  203 aa  HIS5_THETN RecName: Full=Imidazole glycerol phosphate synthase
   15::195     1e-04  34%  209 aa  HIS5_BACCQ RecName: Full=Imidazole glycerol phosphate synthase
   15::195     1e-04  34%  209 aa  HIS5_BACC7 RecName: Full=Imidazole glycerol phosphate synthase
   75::201     1e-04  33%  201 aa  HIS51_CAMJR RecName: Full=Imidazole glycerol phosphate synthase
   75::201     1e-04  34%  201 aa  HIS51_CAMJJ RecName: Full=Imidazole glycerol phosphate synthase
  198::360     1e-04  30%  369 aa  CARA_METVS RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::338     1e-04  25%  357 aa  CARA_LACLA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  228::376     1e-04  26%  389 aa  CARA_HAEDU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  130::201     1e-04  32%  210 aa  HIS5_MOOTA RecName: Full=Imidazole glycerol phosphate synthase
   70::198     1e-04  33%  198 aa  HIS5_METTH RecName: Full=Imidazole glycerol phosphate synthase
   41::204     1e-04  31%  204 aa  HIS5_LEPBO RecName: Full=Imidazole glycerol phosphate synthase
   66::208     1e-04  37%  209 aa  HIS5_GEOSL RecName: Full=Imidazole glycerol phosphate synthase
   71::202     1e-04  33%  213 aa  HIS5_DESDG RecName: Full=Imidazole glycerol phosphate synthase
  196::337     1e-04  26%  358 aa  CARA_STRA5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  196::337     1e-04  26%  358 aa  CARA_STRA3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  207::349     1e-04  25%  368 aa  CARA_METAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::39      2e-04  49%  380 aa  MNMA_SULMW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   70::207     2e-04  33%  207 aa  HIS5_SULDN RecName: Full=Imidazole glycerol phosphate synthase
   74::209     2e-04  39%  211 aa  HIS5_NOCFA RecName: Full=Imidazole glycerol phosphate synthase
   74::199     2e-04  35%  208 aa  HIS5_LISW6 RecName: Full=Imidazole glycerol phosphate synthase
   70::199     2e-04  32%  208 aa  HIS5_LISMO RecName: Full=Imidazole glycerol phosphate synthase
  218::373     2e-04  25%  379 aa  CARA_VIBCH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  182::350     2e-04  22%  367 aa  CARA_SULSO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::354     2e-04  27%  362 aa  CARA_STRMU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::338     2e-04  24%  357 aa  CARA_LACLM RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::363     2e-04  27%  395 aa  CARA_GRATL RecName: Full=Carbamoyl-phosphate synthase small chain; 
   75::203     2e-04  32%  206 aa  HIS5_MYCLE RecName: Full=Imidazole glycerol phosphate synthase
   73::208     2e-04  32%  211 aa  HIS5_COREF RecName: Full=Imidazole glycerol phosphate synthase
   72::209     2e-04  35%  210 aa  HIS5_CORDI RecName: Full=Imidazole glycerol phosphate synthase
   70::195     2e-04  33%  209 aa  HIS5_BACWK RecName: Full=Imidazole glycerol phosphate synthase
   74::195     2e-04  37%  209 aa  HIS5_BACCZ RecName: Full=Imidazole glycerol phosphate synthase
   74::195     2e-04  37%  209 aa  HIS5_BACC3 RecName: Full=Imidazole glycerol phosphate synthase
   74::195     2e-04  37%  209 aa  HIS5_BACAH RecName: Full=Imidazole glycerol phosphate synthase
   75::201     2e-04  33%  201 aa  HIS51_CAMJE RecName: Full=Imidazole glycerol phosphate synthase
  258::412     2e-04  26%  453 aa  CARA_TRIVE RecName: Full=Carbamoyl-phosphate synthase
  196::338     2e-04  35%  351 aa  CARA_CLOAB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  211::360     2e-04  33%  366 aa  CARA_CHLTE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  229::384     2e-04  27%  397 aa  CARA_BUCBP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   73::208     3e-04  37%  211 aa  HIS5_THEFY RecName: Full=Imidazole glycerol phosphate synthase
   75::207     3e-04  36%  224 aa  HIS5_SHELP RecName: Full=Imidazole glycerol phosphate synthase
   85::217     3e-04  37%  217 aa  HIS5_HELHP RecName: Full=Imidazole glycerol phosphate synthase
  202::265     3e-04  40%  392 aa  CARA_THEMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::343     3e-04  27%  354 aa  CARA_METJA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   50::203     4e-04  31%  237 aa  YHE5_SCHPO RecName: Full=Putative glutamine amidotransferase
   70::199     4e-04  32%  208 aa  HIS5_LISMF RecName: Full=Imidazole glycerol phosphate synthase
   70::199     4e-04  32%  208 aa  HIS5_LISMC RecName: Full=Imidazole glycerol phosphate synthase
   66::206     4e-04  33%  211 aa  HIS5_CHLAD RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-04  36%  196 aa  HIS5_BACFR RecName: Full=Imidazole glycerol phosphate synthase
   72::196     4e-04  36%  196 aa  HIS5_BACFN RecName: Full=Imidazole glycerol phosphate synthase
   74::195     4e-04  36%  209 aa  HIS5_BACC0 RecName: Full=Imidazole glycerol phosphate synthase
  194::249     4e-04  43%  353 aa  CARX_BACSU RecName: Full=Carbamoyl-phosphate synthase
  211::353     4e-04  25%  371 aa  CARA_SULAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
   14::50      5e-04  51%  507 aa  TILS_THET8 RecName: Full=tRNA(Ile)-lysidine synthase;       
   14::50      5e-04  51%  507 aa  TILS_THET2 RecName: Full=tRNA(Ile)-lysidine synthase;       
  243::355     5e-04  36% 2225 aa  PYR1_MESAU RecName: Full=CAD protein;Includes:  RecName:
   47::182     5e-04  33%  197 aa  PDXT_THEON RecName: Full=Glutamine amidotransferase subunit pdxT;  
    3::36      5e-04  47%  378 aa  MNMA_OPITP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    2::34      5e-04  55%  375 aa  MNMA_ACHLI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::46      5e-04  67%  372 aa  MNMA1_SYNAS RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   45::213     5e-04  30%  217 aa  HIS5_RALEJ RecName: Full=Imidazole glycerol phosphate synthase
   74::195     5e-04  36%  209 aa  HIS5_BACHK RecName: Full=Imidazole glycerol phosphate synthase
   74::195     5e-04  36%  209 aa  HIS5_BACAN RecName: Full=Imidazole glycerol phosphate synthase
   74::195     5e-04  36%  209 aa  HIS5_BACAC RecName: Full=Imidazole glycerol phosphate synthase
   74::195     5e-04  36%  209 aa  HIS5_BACAA RecName: Full=Imidazole glycerol phosphate synthase
   72::195     5e-04  34%  195 aa  HIS52_CAMJR RecName: Full=Imidazole glycerol phosphate synthase
   72::195     5e-04  34%  195 aa  HIS52_CAMJE RecName: Full=Imidazole glycerol phosphate synthase
  218::378     5e-04  23%  378 aa  CARA_PSESM RecName: Full=Carbamoyl-phosphate synthase small chain; 
  220::366     6e-04  30% 2224 aa  PYR1_DROME RecName: Full=CAD protein;AltName: Full=Protein
   79::190     6e-04  36%  201 aa  PDXT_CENSY RecName: Full=Glutamine amidotransferase subunit pdxT;  
   16::44      6e-04  62%  390 aa  MNMA_AZOC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   68::202     6e-04  33%  208 aa  HIS5_LACPL RecName: Full=Imidazole glycerol phosphate synthase
   68::200     6e-04  32%  205 aa  HIS5_DEHSC RecName: Full=Imidazole glycerol phosphate synthase
  233::393     6e-04  26%  397 aa  CARA_POLSQ RecName: Full=Carbamoyl-phosphate synthase small chain; 
   24::58      8e-04  54%  319 aa  TILS_CHLPN RecName: Full=tRNA(Ile)-lysidine synthase;       
  268::399     8e-04  29% 2214 aa  PYR1_YEAST RecName: Full=Protein URA1;Includes:  RecName:
  178::355     8e-04  30% 2225 aa  PYR1_HUMAN RecName: Full=CAD protein;Includes:  RecName:
   72::176     8e-04  34%  193 aa  PDXT_MYCA9 RecName: Full=Glutamine amidotransferase subunit pdxT;  
    3::35      8e-04  55%  399 aa  MNMA_RHOBA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACWK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACHK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACCZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACCR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACCQ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACCN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACC1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACAN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    9::39      8e-04  52%  371 aa  MNMA_BACAH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   70::205     8e-04  37%  210 aa  HIS5_GEOMG RecName: Full=Imidazole glycerol phosphate synthase
   43::198     8e-04  29%  207 aa  HIS5_AQUAE RecName: Full=Imidazole glycerol phosphate synthase
  198::353     8e-04  29%  366 aa  CARA_STAS1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  213::372     8e-04  25%  376 aa  CARA_PELCD RecName: Full=Carbamoyl-phosphate synthase small chain; 
  198::260     8e-04  30%  366 aa  CARA_METM7 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  222::375     8e-04  26%  409 aa  CARA_KLULA RecName: Full=Carbamoyl-phosphate synthase
    1::503

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
GUAA_THET2      MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
GUAA_THET8      MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
GUAA_DEIDV      -VVILDFGSQFTRLIARRFRELGAYSVILPGTASLERIGQENPQGIVLSGGPSSVYDERAPRPAPGVLEL
GUAA_DEIRA      -IVILDFGSQFTRLITRRFRELGAYSVILPGTASLERIQQENPQGIVLSGGPSSVYDEGAPRPAPGVLDL
GUAA_DEIGD      -VVILDFGSQFTRLIARRLRELGAYSVILPGTASLERIAQENPQGIVLSGGPSSVYDANAPRPAPGVLDL
GUAA_MOOTA      IVLVLDFGGQYNQLIARRVREAGVYSEMIPYNTPLEKILARRPRGIIFSGGPASVYSLGAPRIDRALYES
GUAA_THEAB      -VVVLDYGSQYTQLIVRRVREKGYYAELLPWDASKEEVQNLNPAAIILSGGPASVFEKDAPFVPDYILEL
GUAA_CARHZ      -VIVLDFGGQYSQLIARRIRELKVYCEMLPYNTPLEKIVQENPGGIVFSGGPSSVYGEGAPTVDPEIYRL
GUAA_SYMTH      LIVVVDFGGQYSHLIARRVREAQVYCEIWPFTAPVQRYREAGVKGIIFSGGPASVEQADAPRIDPAIYEL
GUAA_THEM4      -VVVLDYGSQYTQLIVRRVREKGYYAELLPWDAKEEEVKRLNPTAIILSGGPSSVYEKDAPFVPEYVLHL
GUAA_AQUAE      -ILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKKNPYGIIFSGGPASVYAEGAPLPDKRIYEL
GUAA_THERP      -VVILDYGSQYAQLIARRVRDAHVYCELVPYDTDWSALKHLSPKGIILSGGPASVYEPDAPQLPSWVLES
GUAA_THEEB      LIVILDFGSQYSELIARRIRETQVYSEVISYRTTAEQLAQLAPKGIILSGGPNSVYDENAPQCDPEIWNL
GUAA_THETN      -ILILDFGGQYTQLIARRIREANVYCEIVPYDISPEEIKKIDPKGIVLSGGPASVYVKNAPKCDKEIFEL
GUAA_GLOVI      MVAILDFGSQYSELIARRIRETKVYSEVLSYQTPIAEIRRLAPKGIILSGGPNSVYEAYAPQCDPALWEL
GUAA_THEFY      -VLVVDFGAQYAQLIARRVRECHVYSEIVPPTMPVEEMLAKKPKAIILSGGPSSVYADGAPQAPPGLFDT
GUAA_FRASN      -VLVIDFGAQYAQLIARRVRECHVYSEIVPWDMPVAEILARRPAALILSGGPKSVYSPGAPRVDPALFAA
GUAA_ALHEH      -ILILDFGSQYTQLIARRVREAGVYCEIYAWDAPETAIRDFGAAGFILSGGPESMTVDNGPRVPEAVFQA
GUAA_SYNPX      -IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRAMQPKGIVLSGGPSSVYAEHAPLCDPAIWEL
GUAA_SYNS9      -IVILDFGSQYSELIARRVRETEVFSVVIGYSTTADELRRMAPKGIILSGGPSSVYAEHAPVCDPAIWDL
GUAA_HELMI      -ILVLDFGGQYNQLIARRVRELHVYCEMHPYTISVDAIREMNPKGIIFTGGPASVYEEKAPAVDPAIYDL
GUAA_ANATD      IVIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIISKNPKGIIFTGGPSSVYEPNAPMIDKELFEK
GUAA_LACAC      -IIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKEMNPKGIIFSGGPNSVYDDGALKVDPEIFKL
GUAA_PROM3      -IVILDFGSQYSELIARRVRETEVYSLVMSYSTSADELRQLAPKGIILSGGPSSVYAERAPLCDPNIWDL
GUAA_PORG3      -LIILDFGSQTTQLIARRIRELNTYCEVYPYNKLPEDLSGVR--GIILSGSPYSVYDSKAFRIELSELRG
GUAA_CALS8      IVIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIIEKNPKGIIFTGGPSSVYEENAPVVDKKIFEI
GUAA_CLOTH      LILVLDFGGQYNQLIARRVREANVYCEVLPYNSSIDKIKSKNPKGIIFTGGPASVLDPKAPICDREVFEL
GUAA_CHLTE      -VIVLDFGSQYTQLIARRIREIGIYSEIFPYHTKAETIRAHQPKAIILSGGPNSVYDEKAFMPDPEVFSL
GUAA_PORGI      -LIILDFGSQTTQLIARRIRELNTYCEVYPYNKLPEDLSGVR--GIILSGSPYSVYDSKAFRIELSELRG
GUAA_CLONN      LVLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTPRVEKEIFEL
GUAA_PROAC      VVLVVDFGAQYAQLIARRVREANVYSEIVPHNMPVRDMLAKEPAAIILSGGPASVYVEGAPSVDPALFNA
GUAA_LACGA      -IIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKKMAPKGIIFSGGPNSVYDEGALKVDPEIFKL
GUAA_GEOKA      MIVVLDFGSQYNQLITRRIREFGVYSELHPHTIRAEEIRALNAKGIIFSGGPNSVYDEQAFTCDPAIFEL
GUAA_PROMA      -IVILDFGSQYSELIARRIRETEVYSMVLGYNSSVEELKKLSPQGIILSGGPSSVYEEKAPLCDPSIWDL
GUAA_VIBVU      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRAPQYVFDS
GUAA_SYNY3      IIVILDFGSQYSELIARRIRETEVYSEVLSYRTTAQQLREIKPKGIILSGGPNSVYDQGAPECDPEIFQL
GUAA_VIBVY      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRAPQYVFDS
GUAA_METCA      -ILILDFGSQYTQLIARRVRELGVYSEIHPYDCGDDFITEFAPQGIILSGGPESVTGTGTPRAPASVFTL
GUAA_CYAP7      MIVILDFGSQYSELIARRIRETNVYSEVLSYRTSAEQLRQLAPKGIILSGGPNSVYDKNAPQCTQEIWDL
GUAA_SYNSC      -IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRRMAPKGIILSGGPSSVYAEHAPLCDPGIWDL
GUAA_PROM0      -ILILDFGSQYSELIARRIRETNVFSLVVSNCISIEDINDINPKGIILSGGPNSVYEQNAPKCDKKIFNL
GUAA_CLOCE      MILVLDFGGQYNQLIARRVREANVYCEVIPYNASLERIKSYNAKGIIFTGGPNSVLDEGAPKCDPGVFEL
GUAA_ANASP      IIIILDFGSQYSELIARRIRETQVYSEVLSYRTPAEHLRQLNPKGIILSGGPSSVYSDRAPHCDPEIWNL
GUAA_PROMS      -ILILDFGSQYSELIARRIRETNVFSLVVSNFISIEDINRINPKGIILSGGPNSVYEQNAPRCDEKIFNL
GUAA_GEOMG      -ILILDFGSQYTQLIARRVREAHVYCELHPFDMDLAAIRAFAPRGIILSGGPKSVYEEGAPAVEEALFEL
GUAA_STRAW      -VLVVDFGAQYAQLIARRVREARVYSEIVPSTMPVAEMLAKNPAAIILSGGPSSVYAEGAPRLDREIFEA
GUAA_LACJO      -IIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKEMAPKGIIFSGGPNSVYDKGALKVDPEIFKL
GUAA_ANAVT      IIIILDFGSQYSELIARRIRETQVYSEVLSYRTSAEHLRQLNPKGIILSGGPSSVYSDRAPHCDPEIWNL
GUAA_STRCO      ------FGAQYAQLIARRVREARVYSEIVPSSMPVEEILAKNPAAIILSGGPSSVYEAGAPTLDRSLFEA
GUAA_FINM2      LVIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEKQPIGIIFTGGPNSVYEENSPQIEKEIFEL
GUAA_VIBPA      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDS
GUAA_PROMP      -ILILDFGSQYSELIARRIREADVFSLVVSNFTSVKEIQDINPKGIILSGGPSSVYEDNAPKCDAKIFDL
GUAA_PROMM      -IVILDFGSQYSELIARRVRETEVYSLVMSYCTSADELRQLAPKGIILSGGPSSVYAERAPLCDPNIWDL
GUAA_NITSB      -IVILDFGSQYTQLIARRLREVGVYCEIYPFFEPIENIRAKKPQGIILSGGPASVYEPDAPRVDKAIYEL
GUAA_HALOH      -ILVLDFGGQYSQLIARRVRECNVYSIIKPYNISIDQIKDINPAGIIFSGGPKSVTGPEAPMIDKEVFKL
GUAA_VIBCM      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRAPQYVFDS
GUAA_VIBCH      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRAPQYVFDS
GUAA_VIBC3      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRAPQYVFDS
GUAA_PELPB      -VLVLDFGSQYTQLIARRIRELGIYSEILPYNTTPESIREHNPKAIILSGGPTSVYDASAILPDDGIFSL
GUAA_THIDA      -ILILDFGSQYTQLIARRVREAGVYCELHPNDVSEDFVREFAPQGIILSGGPNSVYEDETPRAPDVVFTL
GUAA_GEOSL      -ILILDFGSQYTQLIARRVREAHVYCELHPFDMGLEAIRAFAPKGIILSGGPKSVYEEGAPAVEEALFDL
GUAA_NATTJ      LVIVLDFGGQYSRLIARRIREHNVYCEIYPYNISINKLKQLSPAAIVLSGGPSSVYQEGSPDLDTEIFEI
GUAA_CYAA5      MIVILDFGSQYSELIARRIRETQVYSEVLSYRTTAQKLRQLNPKGIILSGGPNSVYDDRAPQCDPDIWQL
GUAA_CLOAB      LVLVIDFGGQYNQLIARRVREHNVYCEIVPYTYSIDKIKEKKPSAVIFTGGQNSVYGEDSPRMDKEIFDL
GUAA_CHLPD      -VTVLDFGSQYTQLIARRIRELGIYSEILPYNASPETIREHDPKAIILSGGPTSVYGDSALLPDGGVFML
GUAA_NOSP7      LIIILDFGSQYSELIARRIRETQVYSEVLSYRTTSEQLRQLNPKGIILSGGPSSVYGDNAPHCDPEIWNL
GUAA_MYCPA      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTATIEEIKARQPRALVLSGGPSSVYEPGAPQLDPAVFDL
GUAA_VIBHB      -ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRAPQYVFDS
GUAA_LACDB      -IIVLDFGSQYNQLITRRIRDFGIYSELLPHTITAEEVKKIAPKGIIFSGGPNSVYDENALDVDPEIFEL
GUAA_LACDA      -IIVLDFGSQYNQLITRRIRDFGIYSELLPHTITAEEVKKIAPKGIIFSGGPNSVYDENALDVDPEIFEL
GUAA_CLOB6      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDL
GUAA_LEGPH      -LLILDFGSQYTQLIARRVREMGVYCEIYPYHINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFDS
GUAA_THICR      -ILILDFGSQYTQLIARRIREIGVYCEVEPWDIDVEDIVKFGARGIILSGGPETVTGDNAPVAPVEVFEL
GUAA_PELPD      -ILILDFGSQYTQLIARRVREAHVFCELHPFDMEMAAIRAFNPSGIILSGGPKSVYEPGAPAVAEELFEL
GUAA_PROM5      -ILILDFGSQYSELIARRIREANVFSLVVSNFISTKEIQDINPQGIILSGGPNSVYEDNAPKCDQNIFNL
GUAA_STACT      MILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSYTIDPEIYNL
GUAA_SHEDO      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFNPQGIILAGGPESVTAENSPRAPEYVFNA
GUAA_CLOK5      LVIVVDFGGQYNQLIARRVRENNVYCEIVPYTYSVDKIKEKNPRGIIFTGGPNSVYDDNAPKISEDIFEI
GUAA_CLOK1      LVIVVDFGGQYNQLIARRVRENNVYCEIVPYTYSVDKIKEKNPRGIIFTGGPNSVYDDNAPKISEDIFEI
GUAA_CLOBH      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDL
GUAA_CLOB1      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDL
GUAA_CHLL2      -VLVLDFGSQYTQLIARRIRELGIYSEILPYNTTPETIREHAPKAIILSGGPTSVYGESAILPHEGIFSL
GUAA_ACIAD      -ILILDFGSQYSQLIARRVREAGVYSEMYAFDMSEEDIRAFNPNGIILSGGPESVHEEGSPRAPQVVFEL
GUAA_PROVI      -VLVLDFGSQYTQLIARRIRELGIYSEILPYSTTPETIREHNPRAIILSGGPTSVYGDSAILPHPGIFSL
GUAA_PROM2      -ILILDFGSQYSELIARRIRETNVFSLVVSNCISIKEINNINPKGIILSGGPNSVYEQNAPKCDEKIFNL
GUAA_CLOBL      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDL
GUAA_CLOBK      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDL
GUAA_AZOSE      -ILILDFGSQVTQLIARRVREQQVYCEIHPFDVSDDFVREFAPAGVILSGGPNSVYEAVGWHAPQSVFEL
GUAA_PELLD      -VLVLDFGSQYTQLIARRIRELGIYSEILPYSTTPEAIREHDPKAIILSGGPTSVYGESAILPHPGIFSL
GUAA_CLOBJ      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVQKELFDL
GUAA_CHLCH      -VLVLDFGSQYTQLIARRIRELNIYSEILPYNTPADTIRTHQPKAIILSGGPNSVYDQTAFMPDPAIFSL
GUAA_BRAHW      -VLILDFGSQFTQLITRRIRELNVYSEIHPFHVSIDFIKEFKPKAIILSGGPSSVYEEDAPKVDKQLFEL
GUAA_STAAR      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAAN      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAAM      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAA9      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAA2      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAA1      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_EXIS2      MILVLDFGGQYNQLITRRIRDLGVYSELHSHKITAAEVKDIAPAGIIFSGGPRSVYAEDAYRCDPEIFDL
GUAA_CLOBM      LVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRVRKELFDL
GUAA_STAAW      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAAS      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_SHESW      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFNA
GUAA_SHEPC      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFNA
GUAA_SHEON      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_MARAV      -ILILDFGSQYTQLIARRVREIGVYCEIKAFDITDDELNEFNPKGIILAGGPESVTQLGGPRAPEGLFDR
GUAA_LEGPL      -LLILDFGSQYTQLIARRVREMGVYCEIYPYNINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFES
GUAA_STAAT      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAAE      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAAC      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAA8      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_STAA3      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_GEOSF      -ILILDFGSQYTQLIARRVREAHVYCELHPFDLELAAIRSFAPSGIILSGGPKSVYEEGAPAVAEELFEL
GUAA_PROMT      -IVILDFGSQYSELIARRIRETEVYSLVMSYTTSADQLRSLKPKGIILSGGPGSVYEEGAPYCDPEIFNL
GUAA_NITOC      -ILILDFGSQYTQLIARRVREAGVYCEIHPYDMAESTLRDFAPRGIILSGGPASTVGETAPRLSPLIFEL
GUAA_MICLC      -VLVLDFGAQYAQLIARRVREANVYSEVVPASTPAAQILEREPAALILSGGPSSVYEPGAPQLDPALLEA
GUAA_LEGPA      -LLILDFGSQYTQLIARRVREMGVYCEIYPYNINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFES
GUAA_PROM1      -IVILDFGSQYSELIARRIRETEVYSLVMSYTTSADKLRSLKPKGIILSGGPGSVYEEGAPYCDPEIFNL
GUAA_STAAB      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIGEIKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_PSEA6      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESVHAKDSPRAPQYVFDA
GUAA_LEGPC      -LLILDFGSQYTQLIARRVREMGVYCEIYPYHINHEQFKKLNPCGVILSGGPSTVTHDANPRAPQWLFES
GUAA_BACCN      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGENAFHCDEKIFEL
GUAA_ENTS8      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEEQIRGFNPNGIILSGGPESTTEENSPRAPEYVFNA
GUAA_PARD8      -LIILDFGSQTTQLIGRRVRELNMYCEIVPYNKFPHDATDVK--GVILSGSPYSVYDENAFKADLTEIRG
GUAA_AZOSB      -ILILDFGSQVSQLIARRVREQHVYCELHPYDVSEAFIRDFKPQGIILSGGPNSVYEAVDWRAPQVVFEL
GUAA_LACRJ      -IIALDFGSQYNQLITRRLRDFGIYSELLSHKLTADEIKEINPKGIIFSGGPNSVYDPNAFKVDPEIFKL
GUAA_LACRD      -IIALDFGSQYNQLITRRLRDFGIYSELLSHKLTADEIKEINPKGIIFSGGPNSVYDPNAFKVDPEIFKL
GUAA_HAMD5      -ILILDFGSQYTQLLARRIREMGVYSELWPWDVAAERIQAFHPQGIILSGGPESATENDTPRAPDIIFTL
GUAA_STAS1      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISMEEIKRLNPKGIILSGGPNSVYEEDSFTIDPEIYNL
GUAA_SHEPA      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIREFAPNGIILAGGPESVTAENSPRAPEYVFNA
GUAA_SHEB9      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFTA
GUAA_SHEB8      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFTA
GUAA_SHEB5      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFTA
GUAA_SHEB2      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRAPEYVFTA
GUAA_PELCD      -ILILDFGSQYTQLIARRVREAHVYCELHPFDMDLDAIRAFGPKGIILSGGPKSVYEEGAPVVEEALFEL
GUAA_DESVV      -VIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTAEQVRAMKPAAIILSGGPASVGEKDAPALEKGLLDL
GUAA_DESVH      -VIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTAEQVRAMKPAAIILSGGPASVGEKDAPALEKGLLDL
GUAA_VIBF1      -ILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENSPRAPQYVFDS
GUAA_SHISS      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SHIF8      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_OPITP      -IAVLDFGSQLTQVIARRIRECQVYSKIYHFSTPAAQLREEGVIGIILSGGPQSVYARKAPHPDPAIFEL
GUAA_HAEDU      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEKQIREFNPTGIILSGGPESTTETNSPHAPEYVFKA
GUAA_CITK8      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRAPEYVFEA
GUAA_SHESM      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_SHESA      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_ALISL      -ILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEANSPRAPQYVFDS
GUAA_SHESR      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_PHOLL      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESTTAQGSPRAPEYVFNA
GUAA_MACCJ      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTVDPEIFNL
GUAA_BACC1      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKEINPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_AERS4      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESVTEAGSPRAPEYVFNA
GUAA_VIBFM      -ILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENSPRAPQYVFDS
GUAA_SHIFL      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALRD      -IVVLDFGSQYTQLIARRVRETGVYSEIRPCTVEADAIDALNPSGVILSGGPCSVYDEAGPALDPALLET
GUAA_SALPK      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALPC      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALPB      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALPA      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALNS      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALCH      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ESCF3      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO27      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_CLOPE      LVLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTPTLDKEIFNL
GUAA_BACHK      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACHD      MIVVLDFGGQYNQLITRRIRDLGVYSELHPNTITAEQLKEMKPKGIIFSGGPNSAYAEGAPKCDPAIFDL
GUAA_YERE8      -ILILDFGSQYTQLVARRVREIGVYCELWAWDVTEDQIREFNPSGIILSGGPESTTEHDSPRAPDYVFTA
GUAA_TOLAT      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPDGIILSGGPESVTESDSPRAPEYVFNA
GUAA_IDILO      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVDEADIREFAPKGIILSGGPESVAEEGSPRAPEYVFNA
GUAA_ECOUT      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOSM      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOSE      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOLI      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOLC      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOL6      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOL5      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOK1      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOHS      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECODH      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOBW      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO8A      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO81      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO7I      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO5E      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO57      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO55      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO45      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECO24      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_BACC2      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFEL
GUAA_SHIBS      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SHEPW      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIRGFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_BACWK      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFEL
GUAA_BACCZ      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACC3      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACC0      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACAN      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACAH      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACAC      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_BACAA      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDL
GUAA_XYLFM      -ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAAPQHVFDS
GUAA_VIBSL      -ILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRAPQYVFDS
GUAA_SHEHH      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIREFAPNGIILAGGPESVTAENSPRAPEYVFNA
GUAA_SALTY      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRALQYVFEA
GUAA_SALTI      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALHS      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALG2      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALEP      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALDC      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SALA4      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ALKMQ      LVLILDFGGQYNQLIARRVREHNIYCEVVPYKITAEEIKLKNPKGLILTGGPSSVYGESTPRCEEEIFQL
GUAA_XYLFA      -ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAAPQHVFDS
GUAA_SHIB3      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SHEAM      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIVLAGGPESVTEDNSPRAPEYVFDA
GUAA_SALAR      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_NITMU      -ILILDFGSQYTQLIARRVRESNAYCEIHPFDISSQFIGNFAPAGIILSGGPASVAENETPRAPQIVFEL
GUAA_KLEP3      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_ECOLU      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_BACSU      MILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDENSFRCDEKIFEL
GUAA_AERHH      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQMREFNPSGIILSGGPESVTEAGSPRAPEYVFNA
GUAA_TERTT      -VLILDFGSQYTQLIARRIREVGVFSEIRAFDMTDEEIREYNPKAIILSGGPESVTAGASPRAPEAVFEL
GUAA_SYNS3      -IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRALAPRGIILSGGPSSVYADEAPLCDPAIWDL
GUAA_STAEQ      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_SHIDS      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_SERP5      -ILILDFGSQYTQLVARRVREIGVYCELWAWDVSEEQIREFNPSGIILSGGPESTTEANSPRAPEYVFTA
GUAA_SALSV      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_CHRVO      -ILILDFGSQVTQLIARRVREAHVYCELHSFDMPIEEIQAFAPKAIILSGGPNSVYESDY-QADPKLFEL
GUAA_CHLPB      -VLVLDFGSQYTQLIARRIREIGIYSEIVPYNTPLEKIREHNPGAIILSGGPSSVYGESAFHPDEGIFKL
GUAA_BACC4      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFEL
GUAA_PETMO      -ILVIDYGSQYTQLLAKRIRDLGVFSEVIQYD---DNISLSNVKGIILSGGPDSVYNIDAPDISDEILNA
GUAA_HAEIG      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFAPTGIILSGGPESTTEENSPRAPEYVFNA
GUAA_CLOTE      LVFIIDFGGQYSQLIARRVRENNVYCEIIPYSTSIEKIKEKNPKGIIFSGGPNSVYGENSPRISKEIFEI
GUAA_BACCR      -IIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFEL
GUAA_STAES      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_PROMH      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEDNSPRAPEYVFNA
GUAA_NITEU      -ILILDFGSQYTRLIARRIRETNVYCELHPFDVSPQFIREFAPIGIILSGGPASTFTEDAPRVPQIVFEL
GUAA_DESVM      -VIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTADQVRAMKPAAVILSGGPASVGEADAPTLEKGLLEL
GUAA_SYNWW      -VVVLDFGGQYNQLIARRVRELSVYSEMLPYDTSYEEIVAKKPQAIILTGSPASVHGGEAPGCDPRVFSL
GUAA_FUSNN      -IVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYAEGAPSLDIKLFQN
GUAA_EDWI9      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVSEAQIRDFNPSGIILSGGPESTTEAGSPRAPEYVFQA
GUAA_DESAD      -VIILDFGSQFTQLIARRIREAGVYSEIHPCNVDPQKIKDLNPGALILSGGPSSVLEDESPQLDPSLLEL
GUAA_COXBR      -ILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRAPAFIFEI
GUAA_CLOB8      LVLVVDFGGQYNQLIARRVRECGVYCEIIPYDYTIEKIKAKNPKGIIFTGGPNSVYGEDTPTVEKEVFEL
GUAA_CHLFF      -ILILDFGSQYTNVLAKKIRLLSVFCEVLPWNTPLEDILQESPSGLIFSGGPHSVYQENSPKVDREIYNA
GUAA_KLEP7      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRAPQYVFEA
GUAA_HAEIE      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFAPTGIILSGSPESTTEENSPRAPEYVFNA
GUAA_BACLD      MILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDEGSFRCDEKIFEL
GUAA_USTMA      -ILILDFGSQYSHLITRRCRELNVYCEMLPCTQKIKD-LDWKPKGIILSGSPYSVYDEVAPRVDPDVFTA
GUAA_SHEFN      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_ENT38      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEDNSPRAPQYVFEA
GUAA_BACFR      -IIILDFGSQTTQLIGRRVRELDTYCEIVPYNKKGDETVK----GVILSGSPFSVYDESAFKVDLSEIRG
GUAA_BACFN      -IIILDFGSQTTQLIGRRVRELDTYCEIVPYNKKGDETVK----GVILSGSPFSVYDESAFKVDLSEIRG
GUAA_RHIL3      -VLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFHRLQPKAVILSGSPASTVDEGSPRAPDIIFDS
GUAA_PSEMY      -ILILDFGSQYTQLIARRVREIGVYCELHPWDMSDEDIRAFAPRGIILAGGPESVHEANSPRAPQAVFDL
GUAA_PHEZH      -VLIVDFGSQVTQLIARRLRESGVYCEIHPYDKVDAVLDSFRPKAVILSGGPASVHEAESPAASKRLFEL
GUAA_NOCFA      -VLVVDFGAQYAQLIARRVREASVYSEVVPHTATVEEIAAKKPLAVILSGGPASVYAEGAPQLDPRLFDL
GUAA_RHIEC      -VLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSPASTVDEGSPRAPQIIFDS
GUAA_HAEIN      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFAPTGIILSGSPESTTEENSPRAPEYVFNA
GUAA_ALTMD      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGPESVTEEGSPRAPDYVFEA
GUAA_SINMW      -VLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEDGFHRLKPKAVILSGSPASTLDVGSPRAPSVIFES
GUAA_SHELP      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKAFAPNGIILAGGPESVTADNSPRAPEYVFNA
GUAA_RHIME      -VLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEEGFHRLKPKAVILSGSPASTLDTGSPRAPSVIFDS
GUAA_ERWCT      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGSPRAPEYVFNA
GUAA_CLOD6      LVLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSPTISKEIFEL
GUAA_OCEIH      LVLVLDFGSQYNQLITRRIREFGVYSELHSHKLTAEEIKEMNPKGIILSGGPHSVYDENSFRCDEGIFEL
GUAA_MYCTU      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKLDPALLDL
GUAA_MYCTA      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKLDPALLDL
GUAA_MYCBT      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKLDPALLDL
GUAA_MYCBP      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKLDPALLDL
GUAA_MYCBO      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKLDPALLDL
GUAA_FRAP2      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDIADDFIKDYHAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_CHLT3      -VIVLDFGSQYTQLIARRIRELGIYSEILPYHTSAEALRERNPKALILSGGPTSVYDAFAPMPDEKIYEL
GUAA_BURPP      -ILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRVPQAVFEL
GUAA_BURP8      -ILILDFGSQVTQLIARRIREAHVLSEIHPHDVSDEFIRDFKPTGIILSGGPNSVTETDTPRAPQAVFEA
GUAA_ACTSZ      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFNPTGIILSGGPESTTENDSPRAPEYVFDA
GUAA_SYNP6      MLIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAPVCDPEIWNL
GUAA_PROM9      -ILILDFGSQYSELIARRIRETNVFSLVVSNCISIEEINDINPKGIILSGGPNSVYEKNAPKCDEKIFNL
GUAA_MYCMM      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSIEEIKARDPLALVLSGGPASVYAPGAPQLDPALFDL
GUAA_HAEI8      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFAPTGIILSGSPESTTEENSPRAPEYVFNA
GUAA1_BACTN     -IIILDFGSQTTQLIGRRVRELDTYCEIVP----YNKFPKEDPKGVILSGSPFSVYDKDAFKVDLSEIRG
GUAA_XYLFT      -ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAAPQHVFDS
GUAA_XYLF2      -ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAAPQHVFDS
GUAA_SODGM      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEQDSPRAPDYVFQA
GUAA_PHOPR      -ILILDFGSQYTQLIARRIREIGVYCELWSWDVDEADIRDFNPNGIILSGGPESVTGDESPRAPQYVFEA
GUAA_MYCLE      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSIEEITARDPLAIVLSGGPASVYTEGAPQLDPALFDL
GUAA_MYCLB      -VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSIEEITARDPLAIVLSGGPASVYTEGAPQLDPALFDL
GUAA_DESDG      -VIIVDYGSQVTQLIARRIREAGVYSEIHPCIVTAAEVAAMSPSAVVLSGGPASVLGEDSPALDKGLLEL
GUAA_SYNP2      IIVILDFGSQYSELIARRIRETEVYSEVISYRTSAEQLRQLNXXXXXXXXXXXXVYDDYAPACDPEIWNL
GUAA_SHEWM      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKEFAPNGIILAGGPESVTAKDSPRAPEYVFTA
GUAA_RHIE6      -VLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSPASTVDEGSPRAPQIIFDS
GUAA_FRATW      -ILILDFGSQYTQLIARRVRELGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_FRATT      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_FRATN      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFKL
GUAA_FRATM      -ILILDFGSQYTQLIARRVREVDVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_FRAT1      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_CHLCV      -ILILDFGSQYTNVLAKKIRLLSVFCEVLTWNTPLEKILQISPSGLIFSGGPHSVYQENSPKVDKEIYNS
GUAA_BURXL      -ILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRVPQAVFEL
GUAA_AGRVS      -VLIIDFGSQVTQLIARRVRETGVYCEIVPFQSSEEGFARLKPKAVILSGSPASALDEGSPRVPQVIFDS
GUAA_PECCP      -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGSPRAPEYVFNA
GUAA_MANSM      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFNPTGIILSGGPESTTEDNSPRAPEYVFNA
GUAA_AGRRK      -VLIVDFGSQVTQLIARRVREAGVYCEIVPFQSADAGFKRLQPKAVILSGSPASTVDEGSPRAPQIIFDS
GUAA_RHILW      -VLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFNRLQPKAVILSGSPASTVDEGSPRAPQIVFDS
GUAA_NEIMF      -ILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDY-QADTGIFDL
GUAA_HAES1      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEANSPRAPEYVFNA
GUAA_RHISN      -VLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLKPKAVILSGSPASTLDIGSPRAPSVIFES
GUAA_METFK      -ILILDFGSQYTQLIARRIREANVYCELHSWDVSDAFIREFNPAGVILSGGPNSVYEDETPRAPQSVFEL
GUAA_BACSK      -IVVLDFGGQYNQLITRRIRDLGVYSELHSHKLTADELKEMNPIGIIFSGGPNSAYVEGSPKCDPAIYDL
GUAA_ALCBS      -ILILDFGSQYTQLIARRVREIGVYCEIRAFDMTAEELAEFAPKGIILSGGPESVTAAQTPRAPQAVFEA
GUAA_RHILO      -VLIVDFGSQFTQLIARRIREAGVFSEIVPFQSAEAAFKRINPKAVILSGGPASTSDIGSPRAPQIVFDA
GUAA_PASMU      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVSEADIREFNPTGIILSGGPESTTEENSPRAPEYVFNA
GUAA_BACA2      MILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMNPKGIILSGGPNSVYDEGSFRCDEKIFEL
GUAA_STRMK      -ILILDFGAQYTQLIARRIRELGVYCEIWAWDHNPAEIAGFGAKGIILSGGPESTTLPGAPAAPQEVFDS
GUAA_STRM5      -ILILDFGAQYTQLIARRIRELGVYCEIWAWDHNPAEIAGFGAKGIILSGGPESTTLPGAPAAPQEVFDS
GUAA_RHOPA      -ILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDDNAPSAPMTILEA
GUAA_NEIMA      -ILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDY-QADTGIFDL
GUAA_CHLMU      -ILILDFGSQYTNVLAKKIRLLSVFCEVLPWNTPLEKILQKSPSGLIFSGGPHSVYQNNSPEVDKEIYNS
GUAA_BARBK      -VLIIDFGSQVTQLIARRVRAMGVYSEIVPFQSALGGINRIKPKAVILSGSPYSTLDNGSPRAPIEVFEA
GUAA_PSEF5      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDL
GUAA_NEIMB      -ILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDY-QADTGIFDL
GUAA_NEIG2      -ILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDY-QADTGIFDL
GUAA_NEIG1      -ILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDY-QADTGIFDL
GUAA_GRAFK      -VLILDFGSQYTQLIARRVRELNIYCEIYPYHKIPEDLSGFK--AVILSGSPFSVRAEDAPHPDLSQIRG
GUAA_CYAP8      MLVILDFGSQYSELIARRIRETQVYSEVLSYRTTIEQIRQLNPRGIILSGGPNSVYDNRAPQCDPEIFHL
GUAA_COREF      -VLVVDYGAQYAQLIARRVREAGIYSEVIPHTATPQEIQEKNPVALVLSGGPSSVYAEDAPGIDPDILKL
GUAA_CORDI      -VLVVDFGAQYAQLIARRVREANIYSEVVPHTATVEEIKAKNPAALILSGGPSSVYADGAPSLDPQVLEL
GUAA_YARLI      -ILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKIAE-LPWKPKGVILSGGPYSVYAEGSPHVDHAVFDL
GUAA_CORJK      -----DFGAQYAQLIARRVREVNLYSEVIPHTMPADEVAAKNPAALILSGGPSSVYADDAPSLHPELLEL
GUAA_BDEBA      --VILDFGSQFTQLIARRLREMGFYSEIHSFEYPTEEIRKKNPYGIILSGGPNSVYEAGSPQRNVAELRN
GUAA_PSEFS      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDL
GUAA_FRATO      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_FRATF      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_YERPY      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPS      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPP      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPN      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPG      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPE      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPB      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERPA      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_YERP3      -ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRAPDYVFTA
GUAA_NITHX      -ILIVDFGSQVTQLIARRIREEGVYSEIVPFQKAEAAFLEMKPKAVILSGGPASVLDKDAPAAPMSILKA
GUAA_LEIXX      ------------------------YSEIVPHTVTAADIAAKRPAGIILSGGPSSVYEEGAPRLDEGIFEL
GUAA_BIFLO      -VLVVDFGAQYAQLIARRVREAGVYSELVPHSMPVDEILAKDPKAIILSGGPASVFEPGAPTIDTKVFES
GUAA_RHOS5      -LLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKFAPKAVIFSGGPSSVFAEGAPMPPACVFEM
GUAA_PSEU2      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVVLAGGPESVHEADSPRCPQAVFDL
GUAA_HAES2      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEANSPRATEYVFNA
GUAA_PSYA2      -ILILDFGSQYSQLIARRVRDSGVFCEMFPYDIDTQRITDFGAKGIILSGGPESVHAENSPRINDAVFEL
GUAA_NITWN      -ILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFLAMKPKAVILSGGPASVLDRXXXXXXXXIFTA
GUAA_CYTH3      -ILILDFGSQYTQLIARRVRELNVYCEIHPYNKAPQ--IDGTVKGVILSGSPCSVREENAPDIDLSLYRE
GUAA_BARQU      -VLIIDFGSQVTQLIARRVRAMGVYCEIVPFQLALEGVKRLRPQAVILSGSPYSVIDDGSPRAPMEIFEI
GUAA_ACTPJ      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRAPEYVFNA
GUAA_ACTP2      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRAPEYVFNA
GUAA_PSESM      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDL
GUAA_CORGL      -VLVVDFGAQYAQLIARRVREAGIYSEVIPHTATADDVRAKNAAALVLSGGPSSVYAEGAPSLDAEILDL
GUAA_BACP2      MILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMAPKGIILSGGPNSVYDEGSFRCDEKIFDL
GUAA_PSE14      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDL
GUAA_FRATH      -ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSDVKAPEI-VFEL
GUAA_COXBU      -ILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRAPAFIFEI
GUAA_COXB1      -ILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRAPAFIFEI
GUAA_ASHGO      -ILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKISE-LGWKPKGVILSGGPYSVYAADAPHVDRAVFEL
GUAA_XANOR      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_XANOM      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_STAHJ      LILVLDFGSQYNQLITRRIREMGVYSELHDHEISVDEIKRMNPKGIILSGGPNSVYEEGSFTIDPEIYNL
GUAA_PSEPF      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDEDAIREFAPKGVILAGGPESVHEANSPRCPQAVFDL
GUAA_JANMA      -ILILDFGSQVTQLIARRVRDSGVFSEVFPYDVSDEFVRNYGAAGVILSGGPNSVIEGDSPRVPQAVFEL
GUAA_COXB2      -ILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRAPAFIFEI
GUAA_HAEPS      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRAPEYVFNA
GUAA_CORGB      -VLVVDFGAQYAQLIARRVREAGIYSEVIPHTATADDVRAKNAAALVLSGGPSSVYAEGAPSLDAEILDL
GUAA_XANOP      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_BRUSI      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_BRUMB      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_BRUAB      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_BRUA2      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_BRUA1      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_XANCP      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_XANCB      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_XANC8      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_NEIM0      -ILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDY-QADIGIFDL
GUAA_PSEHT      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGPESTTLENSPRAPEYVFNA
GUAA_ACTP7      -ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRAQEYVFNA
GUAA_XANC5      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTSPGAPVAPQEVFDS
GUAA_THESQ      MVLVVDYGSQYSRLITRRIRENEVYSEVV---FPDDKVDLSKVDAVILSGGPRSVYEEDAPKLPEWFQEY
GUAA_THEMA      MVLVVDYGSQYSRLITRRIRENEVYSEVV---FPDDKVDLSKVDAVILSGGPRSVYEEDAPKLPEWFQEY
GUAA_OLICO      -ILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEQAFTAMQPKAVILSGGPASVLEAGAPSAPMSIFTA
GUAA_BARHE      -VLIIDFGSQVTQLIARRVRAMGVYCEVVPFQLALEGMQRIKPKAVILSGSPYSVIDEGSPRAPMEIFEM
GUAA_HELPY      MILVLDFGSQYTQLIARRLRERGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPSGKIFDL
GUAA_HELPS      MILVLDFGSQYTQLIARRLRESGIYAEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPSKKIFDL
GUAA_COXBN      -ILILDFSSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRAPAFIFEI
GUAA_CANAL      -ILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKIAE-LSWKPKGIILSGGPYSVYAEDAPHVDHDIFKL
GUAA_HELPJ      MILVLDFGSQYTQLIARRLRESGIYAEIVPFFESVENIQKKAPKGLILSGGPASVYAKDAYKPSEKIFDL
GUAA_CANGA      -ILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKIAD-LHFKPKGVIMSGGPYSVYAEDAPHVDHAIFDL
GUAA_BRUO2      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_THEP1      MVLVVDYGSQYSRLITRRIRENEVYSEVV---FPDDKVDLSKVDTVILSGGPRSVYEEDAPKLPEWFQEY
GUAA_RHOSK      -LLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKFAPKAVIFSGGPSSVFAEGAPMPPAGVFDL
GUAA_RHOS4      -LLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKFAPKAVIFSGGPSSVFAEGAPMPPAGVFDL
GUAA_RHOS1      -LLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKFAPKAVIFSGGPSSVFAEGAPMPPAGVFDL
GUAA_COLP3      -ILILDFGSQYTQLIARRVREIGVYCELWSWDVTEEQIKGFNPTGIILAGGPESVTEANSPRAPEYVYTA
GUAA_BRUSU      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_BRUC2      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_BRAJA      -ILIVDFGSQVTQLIARRVREDGVYCEIVPFNKAEEAFKEMKPKAVILSGGPESVHEAGSPRAPQLIFAS
GUAA_PSEPW      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDL
GUAA_HERAR      -ILILDFGSQVTQLIARRVRDSGVFSEVYPYDVSDEFVRNYGAAGVILSGGPNSVIEGDSPRVPQAVFEL
GUAA_MARMS      -ILILDFGSQYTQLIARRVREIGVYCEVRAFDMEDQDVIDFDPKGIILAXXXXXXXXXXXXRAPEAVFTL
GUAA_HELAH      MIVVLDFGSQYTQLIARRLRESGIYAEIVPFFESTENIQKKAPKGLILSGGPASVYAKDAYTPSEKIFDL
GUAA_HELPH      MILVLDFGSQYTQLIARRLRESGIYAEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPSEKIFDL
GUAA_YEAST      -ILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKISE-LGWTPKGVILSGGPYSVYAEDAPHVDHAIFDL
GUAA_SPIKU      -IIILDFGSQYTQLIARRIRDLEVYCEVWPYNTALEKIKTTSMKGIILSGGPASVYEEDAFLIDKQLFEL
GUAA_BACV8      -IIILDFGSQTTQLIARRVRELNTYCEIVPYNK-----FPHNDPSIILSGSPFSVYDESAFKVDLSDIRG
GUAA_RHORT      -ILIIDFGSQVTQLIARRVRESGVYSEIQPNTVTAASIAAFAPKGVILSGGPASVTAADTPRAPIELFTM
GUAA_RHOP2      -ILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDADAPAAPMAILEA
GUAA_LISIN      -IIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDM
GUAA_KLULA      -ILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKIAD-LHWKPKGVILSGGPYSVYEKDAPHVDKAIFDL
GUAA_HELP2      MILVLDFGSQYTQLIARRLRESGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPNGKIFDL
GUAA_ARCB4      -IVVLDFGSQYTQIIARKLREAGVYSEIVPYNEPIGDIVARTPKGIILSGGPASVYAVDAYHPDTTIFEL
GUAA_XANAC      -ILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVAPQEVFDS
GUAA_DEBHA      -ILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKISE-LTWKPKGIILSGGPYSVYEDGSPHVDHDIFKL
GUAA_SULDN      -IIVLDFGSQYTQLIARRLREDKIYCEILPYHTKVADIKAKNPQGIILSGGPSSVYNKDAYEVDQGVYKM
GUAA_RHOBA      -ILVLDFGSQYAQLIARRVREQNVYCQIVRHDISAERIAELAPKGIILSGGPNSVYEEGAPKCDEGLFDL
GUAA_NITEC      -ILILDFGSQYARLIARRIRETSVYCELHPFDVSPQFIREFSPVGIILSGGPASIFTNDAPRVPQIVFEL
GUAA_RHOPB      -ILIVDFGSQVTQLIARRVREEGVYSEIVPFNXXXXXXXXXXXXXVILSGGPASVLDDDAPQAPLSILTA
GUAA_PSYIN      -ILILDFGSQYTQLIARRIREIGVYCELWSWDVDEQDIKDFAPNGIILAGGPESVTAEGSPRAPEYVFTA
GUAA_HELPG      MILVLDFGSQYTQLIARRLRESGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKPSGKIFDL
GUAA_PSEPK      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDL
GUAA_PSEPG      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDL
GUAA_BORPD      -ILILDYGSQVTQLIARRVREAGVYSEIHPGDVDDAFVRDQAGQGLILSGSHASAYAEDSLRVPAAVFEL
GUAA_PSEP1      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDL
GUAA_EMENI      -ILVLDFGSQYTHLITRRLREINVYSEMLPCTQKLAD-LGWKPKGIILSGGPYSVYEEGAPHADPAFFEL
GUAA_PSEE4      -ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRAPQAVFDL
GUAA_POLSQ      -ILILDFGSQVTQLIARRVRDARVYSEIHPYDCDPEFIRKFIQEGIILSGGPNSVTEDGSPRAPQIVFEL
GUAA_LISMO      -IIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDM
GUAA_HAHCH      -ILILDFGSQYTQLIARRVREIGVYCEIYPFDMSEADIREFNPKGVILAGGPESVTELGSPRAPECLFNM
GUAA_CLOBA      LVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQMNPKGIIFTGGPNSVYGENSPLCDKAIFEL
GUAA_CAUCR      -VLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAIVDEYAPSAIILSGGPASVLEADSPRIGRKLFDL
GUAA_CAUCN      -VLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAIVDEYAPSAIILSGGPASVLEADSPRIGRKLFDL
GUAA_LISMF      -IIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDM
GUAA_LISW6      -IIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDKDAFRADERIFDM
GUAA_DESPS      -IIILDFGSQTTQLIARRVREMKVYSEIHPFSLPLEKLKELNPTGIILSGGPCSVYDDDAPHSDAGLFEL
GUAA_DESMR      -VLILDFGSQYTQLIARRVREAGVYSEIHPCTVTAKEVAAMAPKAVILSGGXXXXXXXXXXXXXXXXXXL
GUAA_CELJU      -ILILDFGSQYTQLIARRVREIGVFSEIRAWDMSDDEIRAYKPSGIILAGGXXXXXXXXXXXXXXXVFAL
GUAA_DEHSC      -IVIFDFGSQYSLLIARRIREMHVYCELVSHDTPWEKIAHLNPRGFILSGGPSSVYEPEAPLAPAYIFES
GUAA_BAUCH      -ILILNFGSQYAQLLVRRVRELGVYCELRAWDITEAQIREFAPNGIILSGGPESTLTIDSPRASPYIFMA
GUAA_SHESH      -ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIKGFAPNGIILAGGPESVTADESPRAPEYVFNA
GUAA_BORBR      -ILILDYGSQVTQLIARRVREAGVYSEIHAGDAFVRDQVAQGLKGIILSGSHASAYEEGSMRVPAAVFEV
GUAA_ROSDO      -LLIIDFGSQVTQLIARRLRELNVYCEIHPFNLVDDAFLDFGAKAVIFSGGPSSVFADGAPMPPASVFER
GUAA_GLUOX      -ILILDFGSQVTQLIARRVRESGVYCEIWPFTATEEKIRAFNPRGIILSGSPASVHDENAPPIPNVVFAL
GUAA_CLOBB      LVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQMNPKGIIFTGGPNSVYGENSPLCDKAIFEL
GUAA_PYRAE      -VLVVNFGGQYAHLIARRIREVGVYAEIASPEEAVIKASKEEVKAVILSGGPSSVYEPGAPDIDEGIFAL
GUAA_TREDE      -ILIVDFGGQYNQLIARRVRDLNVYSDIVPASKALDYIRENKPIGIIFTGGPNSVYEEKAPLPPKEIFNL
GUAA_MYCPE      -ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKPNKGIWDL
GUAA_BURA4      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_POLNS      -ILILDFGSQVTQLIARRVRDGRVYSEIHPYDCDPELIRKFIQEGIILSGGPSSVTEEGSPRAPQIVFEL
GUAA_BURCM      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BORPE      -ILILDYGSQVTQLIARRVREAGVYSEIHAGDAFVRDQVAQGLKGIILSGSHASAYEEGSMRVPAAVFDV
GUAA_BORPA      -ILILDYGSQVTQLIARRVREAGVYSEIHAGDAFVRDQVAQGLKGIILSGSHASAYEEGSMRVPAAVFEV
GUAA_CUPTR      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAIILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURCH      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURCC      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURCA      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURVG      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURM1      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_VESOH      -ILILDFGSQYTQLIARRVREIGVYCELSHYDINSDFIKKFNPKGVILSGGPDTVTFDNSARAPSIIFDL
GUAA_DECAR      -ILILDFGSQVTQLIARRVREAKVFCEIHPYDVSEEFIRNYGAKGIILSGGPSSVTEGDTPRAPEVVFQL
GUAA_BURS3      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BRASO      -ILIVDFGSQVTQLIARRVREDGVYCEIVPFQKAEAAFRQMNPKAVILSGGPESVHEEGSPRAPQLIFES
GUAA_DEHE1      -IVIFDFGSQYSLLIARRIREMHVYCELVSHDTPWEKIAHLNPRGFILSGGPSSVYEAGAPLAPAYIFES
GUAA_CAMFF      -ILVLDFGSQYTQLIARRLREQGVYAELMPFNVSIEAIKAKNPKGIILSGGPASVYAKDAYFCDEGVFTL
GUAA_BLOPB      -ILVIDFGSQYTQLLLRRIRELGVYSESCSWNISKSQVYAFNPNGIILSGGPYSVIDNDSPYIPEFVFQL
GUAA_PSEAE      -ILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDL
GUAA_PSEA8      -ILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDL
GUAA_FLAJ1      -VLILDFGSQYTQLIARRVRELNIFCEIFPYNHIPSDLSSYK--AVILGGSPFSVRGEDAPHPDLSQIRG
GUAA_BORA1      -ILILDYGSQVTQLIARRVREAGVYSEIHPGDVDDAFIREQAAQGLILSGSHASAYEEGSMRVPAAVFEL
GUAA_RALME      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVTDEFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_PSEAB      -ILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRAPQAVFDL
GUAA_AGRT5      -ILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAEAFEKLQPKGVIFSGGPASVTAEGSPRAPQAVFDS
GUAA_ELUMP      -ILILDFGSQYTQLIARRLREEQIYCEILPFNTKYEDIIALDPAGVILSGGPSSVYGAGAPKPDPKIFSI
GUAA_CORAM      -VLVVDFGAQYAQLIARRVREASIYSEVVPHSATVKEIKAKNPAALILSGGPSSVYADGAPQLKPELLEL
GUAA_RALEH      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAIILSGSHASTYEDHQLRAPQAVWDL
GUAA_RALEJ      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREYAPKGIILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURCJ      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRAPQAVWDL
GUAA_SCHPO      -ILILDFGSQYSHLIARRLREIHVYAELLPCTQKIE-ALPFKPIGVILSGGPYSVYDDIAPHVDPAVFEL
GUAA_ZYMMO      -ILIVDFGSQVTQLIARRVREAGVYSEIVPFNRAEEAFQRLQPKGIILSGSPASVVAEGSPRAPESFFQA
GUAA_SULNB      -ILVLDFGSQYTQLIARKLRESGVYTEVVPYRESIEDIKARKPQGIILSGGPASVYAEDAYKPDEGIWDL
GUAA_RALPJ      -VLILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAIILSGSHASTYEDHQLRAPQAVWDL
GUAA_MESFL      -ILILDFGSQYTQLLARRVREANIYTEVLPFDTSIEKI-KEYPKGIILSGGPSSVYLQNAYKIDSEILNL
GUAA_RHOFD      -ILILDFGSQVTQLIARRIREAHVFCEVHPCDVTDDWVRAYKLKGVILSGSHASVYEETTDKAPPAVFEL
GUAA_LACPL      -ILVLDFGSQYNQLITRRIRDFGVYSELLPNTITAEEIKARHPKGIIFSGGPNSVYDDGAFRVDPEIFKL
GUAA_BURP6      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURP0      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURMS      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURMA      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURM9      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURM7      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_ANAMM      -VAIVDFGSQVTQLIARRVRELGVYSEVFPPSTDFQAMASRKIDAFILSGGPNSVQQPNAVSDVLNLLQK
GUAA_ANAMF      -VAIVDFGSQVTQLIARRVRELGVYSEVFPPSTDFQAMASRKIDAFILSGGPNSVQQPNAVSDVLNLLQK
GUAA_SILPO      -LLIIDFGSQVTQLIARRLRELNVYCEIHPQNVTMDFVREMAPRAVIFSGGPDSVTREGSPRAPQEIFDY
GUAA_BURPS      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_BURP1      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRAPQAVWDL
GUAA_SILST      -LLIIDFGSQVTQLIARRLRELNVYCEIHPQNVTMDFVREFAPKAVIFSGGPDSVTREGSPRAPQEIFDY
GUAA_RALSO      -VLILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAIILSGSHASTYEDQDLRAPQAVWDL
GUAA_BORGA      -ILVLDFGSQYSQLIARRIREIGVYTKVIPYYTPLKEIKNMNIAGIILSGGPASVYAKDAPTLNMEIFNL
GUAA_ENTFA      -IIVLDFGSQFNQLITRRIREFGVFSELLSHRTTAEEIRKIAPKGIIFSGGPNSVYDKDAFSIDPEIYEL
GUAA_DINSH      -LLIIDFGSQVTQLIARRLRELNVFCEIHPFQNVTDAFLADAPKAVIFSGGPASVIDANSPRPPASVFEL
GUAA_CAMHC      -IIVLDFGSQYTQLIARRLREQGVYTEILPFNAKISQIKEKNPKGLILSGGPASVYAKDAYFPNDEIFNL
GUAA_LACRH      -IIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGVDEDIFKL
GUAA_AERPE      -VLVVDFGGQYAHLIARRIRELGVYSEIVPATSALGEALP-RAAGVVLSGGPGSVWGSRHDEAAAMVLQL
GUAA_LACSS      -IIVLDYGSQYNQLITRRIREFGIFSELLPNTTTAAEIKKIAPKGIIFSGGPMSVYDGGAFSVDPEIFEL
GUAA_LACCB      -IIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGVDEDLFKL
GUAA_LACC3      -IIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGVDEDLFKL
GUAA_FLAPJ      -VLILDFGSQYTQLIARRVRELNIFCEIFPFDKIPTDLSIYK--AVILGGSPFSVRSEDALHPDLSEIRG
GUAA_EUBR3      -VIVIDFGGQYNQLVARRVRECNVYCEIYSYKIDIEKIKEMNPKGIILTGGPNSCYEENSPSYRKELFEL
GUAA_METPP      -ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFIREFAPKGIILSGSHASTYEDHDLRAPQAVWEL
GUAA_LACLM      -IIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFEL
GUAA_LACLA      -IIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFEL
GUAA_TROW8      -VLVVDFGSQYSQLVVRAIRECGYYAEFASPSISAAECLALSPIAIFLSGGPASAYKDNAPKLDEEIFNC
GUAA_STRT2      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGIDEEIFEL
GUAA_WOLSU      -LLILDFGSQYTQLIARRLREYGIYCEIVPYHEKLEAIKAREPKGIILSGGPASVYEEDAFLIDKAVFEL
GUAA_STRZT      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRZP      -IIVLDYGSQYNQLISRRIRDIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRR6      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRPS      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRPN      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRPI      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRP7      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRP4      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRP2      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_LACLS      -IIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDIDPEIFEL
GUAA_STRT1      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGIDEEIFEL
GUAA_LACS1      -IIVLDFGSQYNQLITRRIREFGVYSELLSHKLTAAQIKEMNPKGIIFSGGPNSVYDDGAFQIDPEIFEL
GUAA_ASPOR      -ILTLDFGSQYTHLITRRLRELNVYSEMLPCTQKLAD-LKFKPAGVILSGGPYSVYEEGAPHVDPAYFDL
GUAA_PEDPA      -IIVLDFGSQYNQLITRRIREFGIYSELLSHKITAEEIKKINPKGIIFSGGPNSVYDKDAFRIDPEIYKL
GUAA_TROWT      -VLVVDFGSQYSQLVVRAIRECGYYAEFASPSISAAECLALSPIAIFLSGGPASAYKDNAPKLDEEILNC
GUAA_BLOFL      -ILIIDFGSQYTQLLLRRIRELGIYAKVCDWNISQDLLVSLNPNGIIFSGGPDSVTNKHSSSISKVVFKI
GUAA_STRPC      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRPB      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRU0      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQEIREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRPZ      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRPM      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRPF      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRP8      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRP6      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRP1      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRP3      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELHEINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRA5      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGIDEEIFEL
GUAA_STRA3      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGIDEEIFEL
GUAA_STRA1      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGIDEEIFEL
GUAA_STRZJ      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_STRPJ      -IIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFEL
GUAA_ASPFU      -ILTLDFGSQYTHLITRRLREIGVYSEMLPCTQKLAD-LPFKPKGIILSGGPYSVYEDGAPHADPAVFEL
GUAA_STRPD      -IIVLDYGSQYNQLIARRIREFGVLSELKSHKITAQELHEINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_STRPG      -IIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGIDPEIFEL
GUAA_PHANO      -ILVLDFGSQYTHLITRRLRELNVYSEMLPCNTKLAD-LPFTPKGIILSGGPYSVYEEGAPHVDHAVFDL
GUAA_RUTMC      -ILILDFGSQYTQLIARRVREIGVYCELFPYDVDSEFIKKLNPKGIILSGGPDTVTLDNAAKAPSIIFDL
GUAA_EUBE2      -VIVIDFGGQYNQLVARRVRECNVYCEIYSYKTDLAQIKAMNPKGIILTGGPNSCYEDGAPTCTKELFEL
GUAA_STRS7      -IIVLDYGSQYNQLIARRIREFGVFSELKSHNITAQELRDINPIGIVLSGGPNSVYADDAFGIDPEIFEL
GUAA_CAMLR      -ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLDEIKAKEPKGIILSGGPASVYANDAYFCDKGVFDL
GUAA_STRMU      -IIVLDYGSQYNQLIARRIREFGIFSELRSHKVTADEVRAINPIGIVLSGGPSSVYAEDAFDIDKEILDL
GUAA_STRE4      -IIVLDYGSQYNQLIARRIREFGVFSELKSHHITAQELRDINPIGIVLSGGPNSVYATDAFGIDPEIFEL
GUAA_EHRCR      -VAIIDFGSQFTQLLARRIRELNVYSEIFPHDIAFDYIKDSK--AFILSGGPKSVLDFTGMPPIVHDIKT
GUAA_CAMJ8      -ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDL
GUAA_BORBU      -ILVLDFGSQYSQLIARRIREIGVYTKVIPYYTPLKEIKNMNISGIILSGSPASVYSKEAPTLNMEIFNL
GUAA_EHRCJ      -VAIIDFGSQFTQLLARRIRELNVYCEIFTPDVEFDLVKDSK--AFILSGGPKSVASAEIPKIVHNIIES
GUAA_CAMJJ      -ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDL
GUAA_CAMJR      -ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLTDIKAKEPKGIILSGGPASVYATDAYFCDKGIFDL
GUAA_CAMJE      -ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDL
GUAA_CAMJD      -ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFCDKGIFDL
GUAA_GEMAT      -ILILDCGSQFTQLIARRVREARVYSEIHPPTKSLDWIRAWKPTGIILSGGPSSVTDEGAPTIPPALLDV
GUAA_WOLWR      -IAIIDFGSQFTQLIARQVRGMGVYCEIFPSNISFETISKFN--GFILSGGPQSVNDDETSRVVHEIIAT
GUAA_WOLPM      -IAIIDFGSQFTQLIARQVRGMGVYCEIFPSNISFETISKFN--GFILSGGPQSVNDDETSRVVHEIIAT
GUAA_WIGBR      -ILIIDFGSQYTKLVARRMKDIGAKFIISSWEXXXXXXXXXXXXXXXXSGSPMSVLDDKSPYVSKDILNM
GUAA_GIBZE      ------------------------YSEMLPCTQKIKD-LGWKPVGVILSGGPSSVYADDAPGVDPLVFEL
GUAA_BRUME      -ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDA
GUAA_EHRRG      -VAIIDFGSQFTQLLARRIRDLNIYSEIFLPNVAFD--LIKGVDAFILSGGPRSVPNSDGPKHDILQFNT
GUAA_EHRRW      -VAIIDFGSQFTQLLARRIRDLNIYSEIFLPNVAFD--LIKGVDAFILSGGPRSVPNSDGPKHDILQFNT
GUAA_WOLPP      -IAVIDFGSQFTQLIARQIREMGVYCEIFPSNIDFETVSKFN--GFIFSGGPQSVNDSEVAHKIIKLNET
GUAA_PELUB      -ILIIDFGSQFTQLIARRVRELGVFSEIVSHKKKIAQITKDNIAGIILSGGPLNVYENXXXXXXXXXXXX
GUAA_WOLTR      -IAIIDFGSQFTQLIARQIREMDVYCEIFPSNISFETISKFN--GFILSGGPQSVHDSEASGVAHEIIAT
GUAA_LEPIN      -IAVVDFGGQYAHLIASRIRRLGAYTEILSNEEPISNYQKY--SGIILSGGPESVYEPNSPTVTTRIFDL
GUAA_LEPIC      -IAVVDFGGQYAHLIASRIRRLGAYTEILSNEEPISNYQKY--SGIILSGGPESVYEPNSPTVTTRIFDL
GUAAB_PYRAB     ----------------------------------------------------------------------
GUAAB_PYRKO     ----------------------------------------------------------------------
GUAAB_PYRHO     ----------------------------------------------------------------------
GUAAB_PYRFU     ----------------------------------------------------------------------
GUAA_HELHP      -ILVLDFGSQYTQLIARRLREYGVYTEIVPYFEKLDSIKSKNPKGIILSGGPASVYEKDAYKPDSAIFTL
GUAA_MOUSE      -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTI
GUAA_RAT        -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTI
GUAAB_PICTO     ----------------------------------------------------------------------
GUAAB_METJA     ----------------------------------------------------------------------
GUAA_PONAB      -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTI
GUAA_HUMAN      -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTI
GUAAB_METTH     ----------------------------------------------------------------------
GUAAB_ARCFU     ----------------------------------------------------------------------
GUAAB_METVS     ----------------------------------------------------------------------
GUAAB_METMJ     ----------------------------------------------------------------------
GUAA2_BACTN     ----------------------------------------------------------------------
GUAAB_METMA     ----------------------------------------------------------------------
GUAAB_THEAC     ----------------------------------------------------------------------
GUAAB_METAC     ----------------------------------------------------------------------
GUAAB_UNCMA     ----------------------------------------------------------------------
GUAAB_METBF     ----------------------------------------------------------------------
GUAAB_THEVO     ----------------------------------------------------------------------
GUAAB_METM7     ----------------------------------------------------------------------
GUAAB_METPE     ----------------------------------------------------------------------
GUAAB_METBU     ----------------------------------------------------------------------
GUAAB_METMP     ----------------------------------------------------------------------
GUAAB_METB6     ----------------------------------------------------------------------
GUAA_CHLPN      -IFILDFGSQYTYVLAKQVRKLFVYCEVLPWNISVQCLKERAPLGIILSGGPHSVYENKAPHLDPEIYKL
GUAA_CAEEL      -IAILDFGAQYGKVIDRRVRELLVQSEMFPLNTTARTLIELGGKGIIISGGPNSVFEPEAPSIDPEIFTC
GUAAB_NATPD     ----------------------------------------------------------------------
GUAAB_HALSA     ----------------------------------------------------------------------
GUAAB_HALS3     ----------------------------------------------------------------------
GUAAB_HALMA     ----------------------------------------------------------------------
GUAA_DICDI      VIVILDAGSQYSKVIDRRVRELNVASEIHPLNIDLLELXXXXXXXXXXXXXPESVYGENAPKFDKSLFSE
GUAAB_HALLT     ----------------------------------------------------------------------
GUAAB_METKA     ----------------------------------------------------------------------
GUAAB_SULSO     ----------------------------------------------------------------------
GUAAB_SULIY     ----------------------------------------------------------------------
GUAAB_SULIN     ----------------------------------------------------------------------
GUAAB_SULIM     ----------------------------------------------------------------------
GUAAB_SULIL     ----------------------------------------------------------------------
GUAAB_SULIK     ----------------------------------------------------------------------
GUAAB_SULIA     ----------------------------------------------------------------------
GUAAB_SULTO     ----------------------------------------------------------------------
GUAAA_PYRKO     MIVIMDNGGQYVHRIWRTLRYLGVEAKIIPNTTPLEEIKAMKPKGIIFSGGPDINKTGNCSAILEHYDEF
GUAAA_PYRHO     MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEF
GUAAA_PYRFU     MIIIMDNGGQYVHRIWRTLRYLGVEAKIIPNTTPLDEIKAMKPKGIIFSGGPSLENTGNCEKILEHYEEF
GUAAA_PYRAB     MIVIMDNGGQYVHRIWRTLRYIGVESKIIPNTTPLEDIKAMNPSGIIFSGGPSLENTGNCEKILENYDEF
GUAAA_SULAC     -VAVIYFGGQYNHLIVKDLKYLGLEAVAITPDKSVEELKEF--DSVVFGGGPYSVIDKMGFAPD-YVKSL
GUAAA_SULTO     -IAVIYFGGQYNHLIVKDLKYLGLNAVLITPEKPVE-ILKDY-DCIIFGGGPYSVITEKMGNAVDYVLRT
GUAAA_SULSO     ------YGGQYNHLILKNVKYLGADIEVIPPHKPVEELKKF--DCVIFSGGPYSVSEEIQKMGNSPLYIK
GUAAA_METJA     MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEKGIILSGGPDI---EKAKNCIDIALNA
GUAAA_METMP     MIVILNNGGQYVHRIQRSLKYLDVPAKIVPNSTTLEEIAANPEKGVILSGGPDIT---KATNCENIALNS
GUAAA_METM5     MIVILNNGGQYVHRIQRSLKYLDVPAKIIPNSTTLEEIIADSEKGIILSGGPDIT---KATNCENIALNS
GUAAA_METTH     MILIINNHGQYNHRIHRTLRYLQIPSELVPNTTPLDEIISRDPEGLILGGGPSLERSGNCVEYIQKL---
GUAAA_METM7     MIVILNNGGQYVHRIQRSLKYLGVPAKIVPNSTTLEEIVNPEIKGIILSGGPDIT---KATNCENIALNS
GUAAA_METM6     MIVILNNGGQYVHRIQRSLKYLEVPAKIVPNSTTLEEIIADSEKGIILSGGPDIT---KATNCENIA