[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81530.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
   13::188     1e-26  40%  202 aa  Y925_SYNY3 RecName: Full=Uncharacterized protein sll0925;
    5::155     7e-20  36%  177 aa  Y1609_SYNY3 RecName: Full=Uncharacterized protein sll1609;
   12::188     4e-18  37%  190 aa  Y1290_SYNY3 RecName: Full=Uncharacterized protein slr1290;
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxARLRRLTAEEYLREEATSPVKRELVEGVPYAMAGAGRAHNLIVTNLVLLLGPLARRKGGRLYVADM
Y925_SYNY3      ------------DDYLELESRSDVKHEYIDGQIYAMAGTGGIHNIISGNFYMALRSRLQNSGCRVYFADL
Y1609_SYNY3     ----ATTKILTAAEYLQREEQATEKSEFIQGEIIPIAGASANHNRLTFNLSRLLPLEIGDRQYEIFVSDM
Y1290_SYNY3     --------KLSPEEYLQWEERQREKHEYFDGQIYAMGGGSKNHSVISVRLSTLF--CNHLDGGDCEIGNS


                         .         .         *         .         .         .         .:140
query           KLKVGEATFYYPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREKLWRYLSLPSLEGYLLVSARE
Y925_SYNY3      KVKLKEGRFYYPDLLVTCERDAPSQAFVNFPRVIIEVLSESTEGFDRGKKFQDYRTLPSLWAYILVNAQQ
Y1609_SYNY3     RLWIAESSYFYPDVMVIAEEPKNSQMAVTNPSLIAEVLSTSAAGFDKNQKFGFYRTIPKLQEYLLIDQFC
Y1290_SYNY3     DLKVNTQNYTCPDVSVTCDPRDKSTQFITYPCLVVEVLSPSTEAYDRGGKFRLYAHNPMLQDYLLVSSTS


                         +         .         .         .         .         *         .:210
query           RRVELYRKEGDILHQVAEEGEVPLPCLEGSLPVAEVYAGVELxxxxx
Y925_SYNY3      YLVECFRTPQDFWLLKSYEGLEAIADIEAAIPLAEIYATLNL-----
Y1609_SYNY3     YRVEHYQKVGD------------------------------------
Y1290_SYNY3     VEIDLYHKNDDILNYQASD-RLELKSIGLSFAVDVIYRGL-------