[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81541.1

[Show Plain Result]


## Summary of Sequence Search
    1::147
   52::149     3e-17  46%  156 aa  OGT_METS5 RecName: Full=Methylated-DNA--protein-cysteine
   52::153     3e-14  43%  165 aa  OGT_MYCPA RecName: Full=Methylated-DNA--protein-cysteine
    9::153     3e-14  40%  165 aa  OGT_MYCLE RecName: Full=Methylated-DNA--protein-cysteine
    7::153     1e-13  38%  165 aa  OGT_MYCTU RecName: Full=Methylated-DNA--protein-cysteine
    7::153     1e-13  38%  165 aa  OGT_MYCBO RecName: Full=Methylated-DNA--protein-cysteine
   12::127     1e-13  39%  131 aa  OGT_METKA RecName: Full=Methylated-DNA--protein-cysteine
    9::146     5e-13  33%  151 aa  OGT_SULSO RecName: Full=Methylated-DNA--protein-cysteine
    9::146     5e-13  33%  151 aa  OGT_SULIY RecName: Full=Methylated-DNA--protein-cysteine
    9::146     5e-13  33%  151 aa  OGT_SULIM RecName: Full=Methylated-DNA--protein-cysteine
    9::146     5e-13  33%  151 aa  OGT_SULIL RecName: Full=Methylated-DNA--protein-cysteine
    9::146     5e-13  33%  151 aa  OGT_SULIK RecName: Full=Methylated-DNA--protein-cysteine
    9::146     5e-13  33%  151 aa  OGT_SULIA RecName: Full=Methylated-DNA--protein-cysteine
   54::155     6e-13  38%  156 aa  OGT_METAC RecName: Full=Methylated-DNA--protein-cysteine
    9::146     8e-13  33%  151 aa  OGT_SULIN RecName: Full=Methylated-DNA--protein-cysteine
    9::169     5e-12  37%  171 aa  OGT_SHIFL RecName: Full=Methylated-DNA--protein-cysteine
    9::169     5e-12  37%  171 aa  OGT_ECOLI RecName: Full=Methylated-DNA--protein-cysteine
   65::168     2e-11  37%  174 aa  OGT_THEGJ RecName: Full=Methylated-DNA--protein-cysteine
   52::147     4e-11  35%  156 aa  OGT_SULTO RecName: Full=Methylated-DNA--protein-cysteine
  103::178     4e-11  42%  211 aa  MGMT_MOUSE RecName: Full=Methylated-DNA--protein-cysteine
   48::144     4e-11  36%  149 aa  MGMT_MIMIV RecName: Full=Probable methylated-DNA--protein-cysteine
   85::169     5e-11  37%  175 aa  OGT_THESM RecName: Full=Methylated-DNA--protein-cysteine
   52::157     5e-11  35%  179 aa  OGT_HAEIN RecName: Full=Methylated-DNA--protein-cysteine
   53::158     5e-11  38%  165 aa  OGT_BACSU RecName: Full=Methylated-DNA--protein-cysteine
   91::179     6e-11  41%  216 aa  MGMT_CANFA RecName: Full=Methylated-DNA--protein-cysteine
   84::168     8e-11  38%  174 aa  OGT_PYRKO RecName: Full=Methylated-DNA--protein-cysteine
   65::170     1e-10  31%  176 aa  OGT_METTH RecName: Full=Methylated-DNA--protein-cysteine
  103::178     1e-10  42%  209 aa  MGMT_RAT RecName: Full=Methylated-DNA--protein-cysteine
   42::145     3e-10  38%  147 aa  OGT_ARCFU RecName: Full=Methylated-DNA--protein-cysteine
   99::173     3e-10  38%  207 aa  MGMT_HUMAN RecName: Full=Methylated-DNA--protein-cysteine
   66::154     1e-09  40%  167 aa  OGT_METJA RecName: Full=Methylated-DNA--protein-cysteine
  229::348     1e-09  36%  353 aa  ADA_SALTY RecName: Full=Regulatory protein ada;AltName:
   53::120     3e-09  40%  148 aa  OGT_PYRAE RecName: Full=Methylated-DNA--protein-cysteine
    9::169     3e-09  35%  171 aa  OGT_SALTY RecName: Full=Methylated-DNA--protein-cysteine
    9::169     3e-09  35%  171 aa  OGT_SALTI RecName: Full=Methylated-DNA--protein-cysteine
   94::172     6e-08  30%  175 aa  MGMT_CANAL RecName: Full=Methylated-DNA--protein-cysteine
  229::348     8e-08  31%  354 aa  ADA_ECOLI RecName: Full=Regulatory protein ada;AltName:
   49::139     2e-07  34%  158 aa  OGT_METMA RecName: Full=Methylated-DNA--protein-cysteine
  112::189     2e-07  37%  189 aa  MGMT_KLULA RecName: Full=Methylated-DNA--protein-cysteine
   77::146     3e-07  36%  172 aa  OGT_PYRHO RecName: Full=Methylated-DNA--protein-cysteine
   69::168     3e-07  30%  179 aa  ADAB_BACSU RecName: Full=Methylated-DNA--protein-cysteine
   82::131     5e-07  44%  155 aa  OGT_SULAC RecName: Full=Methylated-DNA--protein-cysteine
  102::190     5e-07  31%  201 aa  MGMT_LODEL RecName: Full=Methylated-DNA--protein-cysteine
  104::148     1e-06  47%  174 aa  OGT_PYRFU RecName: Full=Methylated-DNA--protein-cysteine
  103::178     6e-06  37%  209 aa  MGMT_CRIGR RecName: Full=Methylated-DNA--protein-cysteine
   95::146     8e-06  37%  172 aa  OGT_PYRAB RecName: Full=Methylated-DNA--protein-cysteine
    6::139     2e-05  31%  158 aa  OGT_METBF RecName: Full=Methylated-DNA--protein-cysteine
   91::165     3e-05  26%  188 aa  MGMT_YEAST RecName: Full=Methylated-DNA--protein-cysteine
  114::183     4e-05  31%  194 aa  MGMT_PICST RecName: Full=Methylated-DNA--protein-cysteine
   91::165     8e-05  25%  188 aa  MGMT_YEAS7 RecName: Full=Methylated-DNA--protein-cysteine
    9::66      8e-05  36%  108 aa  ATL1_SCHPO RecName: Full=Alkyltransferase-like protein 1;
   91::165     1e-04  27%  191 aa  MGMT_DEBHA RecName: Full=Methylated-DNA--protein-cysteine
   15::74      0.001  34%  321 aa  NFI_THEVO RecName: Full=Bifunctional
   21::79      0.001  35%  323 aa  NFI_THEAC RecName: Full=Bifunctional
    1::147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLPLDYTGLSPAR
OGT_METS5       -----------------------------------------------YFQGKRTDFDDIPIRLNTNS-FR
OGT_MYCPA       ------------------------------------------EQLGAYFAGELTEF-DIELDLRG-SEFQ
OGT_MYCLE       ----SPIGPLILAGHGSVLTNLEPSRVGWLPE-NGAFAEAVSQ-LDAYFAGELTEFA-IELDLCG-TEFQ
OGT_MYCTU       --IDSPIGPLTLAGHGTNLRMLEQTYEPSRTHDPGAFSGAV-DQLNAYFAGELTEF-DVELDLRG-TDFQ
OGT_MYCBO       --IDSPIGPLTLAGHGTNLRMLEQTYEPSRTHDPGAFSGAV-DQLNAYFAGELTEF-DVELDLRG-TDFQ
OGT_METKA       ------------------------------PPAEGFRTLSLKRDLERYFRGYPVDFDDVPVRINVSGKPR
OGT_SULSO       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_SULIY       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_SULIM       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_SULIL       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_SULIK       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_SULIA       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_METAC       --------------------------------------------LEAYFAGELKSF-DVKLAPEG-TEFQ
OGT_SULIN       ----SPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEG-KPINLREPINLKTY-PFR
OGT_SHIFL       --IATPLGPLWVEYSERMVQLLDIHYRKEGYERPGGLSDKLRE----YFAGNLSIIDTLPTA-TGGTPFQ
OGT_ECOLI       --IATPLGPLWVEYSERMVQLLDIHYRKEGYERPGGLSDKLRE----YFAGNLSIIDTLPTA-TGGTPFQ
OGT_THEGJ       ------------------------------------------ELVYRVLIGELENEKALPLSFEGVTPFE
OGT_SULTO       -----------------------------------------------YFEGKKVDLTE-PVDFKPFNEFR
MGMT_MOUSE      ----------------------------------------------------------------------
MGMT_MIMIV      -----------------------------------------------YFKGQNDYFTNLDLELKG-TPFQ
OGT_THESM       ------------------------------------------------------------LSFEGTTPFE
OGT_HAEIN       ---------------------------------------KVRLAFERYFNGEVECFSNIPLKPEGTA-FQ
OGT_BACSU       ---------------------------------------EAKQQLQEYFAGERKTF-SLPLSQKG-TPFQ
MGMT_CANFA      -----------------------------------------------------------PIFQRGSFTAR
OGT_PYRKO       ------------------------------------------------------------LSFEGVTPFE
OGT_METTH       ---------------------------------------KLLDSIRMFLDGCEVDFDLSVLDFGGCTEYQ
MGMT_RAT        ----------------------------------------------------------------------
OGT_ARCFU       --------------------------------------------LERYFSGERVE-VRIPYRLKASSFTR
MGMT_HUMAN      ----------------------------------------------------------------------
OGT_METJA       ---------------------------------------KVRELIS--YKLEVPEFTKKVLDI-------
ADA_SALTY       -------------------------LFPRHEPADALFQQRVRQVVAAI--NTRDVLLSLPLDIQGTA-FQ
OGT_PYRAE       ----------------------------------------------------------------------
OGT_SALTY       --IATPLGPLWVVCDEFRLRAIEWEQYR--DRMEQLLNIHYRERVSAYFAGNLA-VIDTLETATGGTPFQ
OGT_SALTI       --IATPLGPLWVVCDEFRLRAIEWEQYR--DRMEQLLNIHYRERVSAYFAGNLA-VIDTLETATGGTPFQ
MGMT_CANAL      ------------------------------------------------------------------TPLQ
ADA_ECOLI       -------------------------MFPAADNAPADLMFQVREVIASLNQRDTP--LTLPLDIRGTA-FQ
OGT_METMA       ---------------------------------------EVSNQLEAYFSGKLKTF-DVKLAPQG-TEFQ
MGMT_KLULA      ----------------------------------------------------------------------
OGT_PYRHO       --------------------------------------------------GNEKGFEELSLE--GLTRFE
ADAB_BACSU      --------------------------------------------ITQYLEGKRKNFT-VPVEYAG-TQFQ
OGT_SULAC       ----------------------------------------------------------------------
MGMT_LODEL      ----------------------------------------------------------IPIEFIFGTELQ
OGT_PYRFU       ----------------------------------------------------------------------
MGMT_CRIGR      ----------------------------------------------------------------------
OGT_PYRAB       ----------------------------------------------------------------------
OGT_METBF       --IESPIGPILLAGNEKGLKHLD---FLKGKKRIEIPADWIREALEAYFSGKLESF-DLKLAPEG-TDFQ
MGMT_YEAST      ----------------------------------------------------------IPFEFLFGTDFQ
MGMT_PICST      ----------------------------------------------------------------------
MGMT_YEAS7      ----------------------------------------------------------IPFEFLFGTDFQ
ATL1_SCHPO      ----------------------------------------------------------------------
MGMT_DEBHA      ----------------------------------------------------------IPYEFIFGTELQ
NFI_THEVO       ----------------------------------------------------------------------
NFI_THEAC       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWL
OGT_METS5       MRVYKEVRKVKWGEVVTYKDIAEAVGTSPRAVGVALSKNPILLLIPCHRVV-AENGLGGYSRGVELKRKL
OGT_MYCPA       RRVWRALQTIPYGETRSYGEIAEQIGAAARAVGLANGHNPIAIVVPCHRVIGASGKLTGYGGGLDRKQTL
OGT_MYCLE       QRVWQALLTIPYGETRSYGEIAEQVGAAARAVGLANSRNPIAIIVPCHRVIGASGQLIGYGGGLNRKLTL
OGT_MYCTU       QRVWKALLTIPYGETRSYGEIADQIGAAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRAL
OGT_MYCBO       QRVWKALLTIPYGETRSYGEIADQIGAAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRAL
OGT_METKA       -EVLELVREIPYGTVVTYGDIAQKANTHPRVVGVSLARNRVPIIVACHRVVAADG-LGGFRWGLEWKRRL
OGT_SULSO       LSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_SULIY       LSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_SULIM       LSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_SULIL       LSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_SULIK       LSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_SULIA       LSVFKEVMRIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_METAC       KSVWNALKEIPYGETRTYGEIAKNIGKASRAVGLANNRNPIAIIVPCHRVIGANGKLTGYASGLDIKEFL
OGT_SULIN       LSVFKEVMKIPWGKVMPYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVI-AENGIGGYSRGVKLKRAL
OGT_SHIFL       REVWKTLRTIPCGQVMHYGQLAEQLXXXXXXXXXXXXXXPISIVVPCHRVIGRNGTMTGYAGGVQRKEWL
OGT_ECOLI       REVWKTLRTIPCGQVMHYGQLAEQLXXXXXXXXXXXXXXPISIVVPCHRVIGRNGTMTGYAGGVQRKEWL
OGT_THEGJ       RRVYEWLKNVKRGTVITYGSLAKALETSPRAVGGAMKRNPYPIIVPCHRVVSREG-IGHYNLGIEEKKFL
OGT_SULTO       IRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVI-GEKSLGGYSRGVELKRKL
MGMT_MOUSE      --LWKLLKVVKFGETVSYQQLAALAGKAARAVGGAMRSNPVPILIPCHRVVRSDGAIGHYSGGQAVKEWL
MGMT_MIMIV      RKVWKQILEIPFGETRTYSDIAMAIG-NPKAVRAVANACPIAIIVPCHRVVGKNND-GGYEYGLEKKLWL
OGT_THESM       KKVYETLKKVKRGEVITYGELAKMLRSSPRAIGGAMKRNPYPIIVPCHRVI-ASNNIGNYTPKREYKRFL
OGT_HAEIN       QAIWQALREIDYGELSTYGELALRINKAVRAVGGAVGSNPISIIIPCHRILGKDRTLTGFGGGLEAKRFL
OGT_BACSU       QKVWQALERIPYGESRSYADIAAAVG-SPRAVGQANKRNDLPIFVPCHRVIGKNSALTGYAGSKEIKAFL
MGMT_CANFA      V-LRKLLELVKFGDTVSYQQLAALAGKAARAVGGAMRSNPVPILIPCHRVVCSSGAMGNYTGGLATKEWL
OGT_PYRKO       KKVYEWLKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDG-IGYYSSGIEEKKFL
OGT_METTH       RRVLDVVSSIPRGSTLTYSEVXXXXXXXXXXXXXXXXXNPFPLVIPCHRVIRSDGNAGGYQGGVKLKKRL
MGMT_RAT        --LWKLLKVVKFGEMVSYQQLAALAGKAARAVGGAMRSNPVPILIPCHRVIRSDGAIGNYSGGQTVKEWL
OGT_ARCFU       -RVLEEVSRIPYGMVRMYSDIAKALNTSPRAVGQAVKRNPLPVIIPCHRVV-GKKEIGGYTDGKSLKKRL
MGMT_HUMAN      --LWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
OGT_METJA       ------VKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVV-AKNSLGGYSYGLDKKKFI
ADA_SALTY       QQVWQALCAIPCGETVSYQQLAATIG-KPTAVRAVASACKLAMVIPCHRVVRRDGALSGYRWGVRRKAQL
OGT_PYRAE       ---------IPRGYVTTYKLYAEVLGTSPRHVGWLMARNPLPVILPCHRVVKSDFSLGGYTGGVEVKKKL
OGT_SALTY       REVWQALRAIPCGQVMHYGQLAAQLXXXXXXXXXXXXXXXXXIVVPCHRVIGRNGTLTGYAGGVQRKEWL
OGT_SALTI       REVWQALRAIPCGQVMHYGQLAAQLXXXXXXXXXXXXXXXXXIVVPCHRVIGRNGTLTGYAGGVQRKEWL
MGMT_CANAL      RKVWKELVKIPAGQTRTYKELADLLGTHSRVIGNCCGANRIAVLIPCHRVVGANNKLTGYRWGKSYKEYL
ADA_ECOLI       QQVWQALRTIPCGETVSYQQLANAIG-KPKXXXXXXXXXXLAIIIPCHRVVRGDGTLSGYRWGVSRKAQL
OGT_METMA       KSVWKALCEIPCGETRTYGEIAKRIQKAYRAVGLANNRNPIAIIVPCHRVIGANGKLTGY----------
MGMT_KLULA      -KVWETTKTIKAGATISYQQLAVLLGKAVRAIGSALAKNNIAVVIPCHRIIGSKGKLTGFRWGIELKESL
OGT_PYRHO       IKVYSLVKNVKRGEVITYGKVAKALKTSPIAVGGAMKRNPYPIIVPCHRVV-------------------
ADAB_BACSU      LAVWNALCEIPYGQTKSYSDIANDINKPXXXXXXXXXXXPVLITVPCHRVIGKNGSLTGYRGGFEMKTLL
OGT_SULAC       ---------IGWGKVKTYKEIAETLKTSPRAVGMALSKNPVLLIIPCHRII-AESGLGGF----------
MGMT_LODEL      RKVWQQLLEIPVGEVRYYGNIVEALGLASRAVGNACGANKIALVVPCHRVIAQTGKLTGYRWGLATKKQI
OGT_PYRFU       ------VENVKRGEVITYGELAKILNTSSRAVGAAVKRNPYPIIVPCHRVI-------------------
MGMT_CRIGR      --LWKLLKVVKFGEMVSYQQLAALAGKAARAVGGAMRNNPVPILIPCHRVIXXXXXXXXXXXXQAVKEWL
OGT_PYRAB       IRVYSLVKNVKRGEVITYGKVAKELKTSALAIGGAMKRNPYPIVVPCHRVV-------------------
OGT_METBF       KSVWKALCEIPYGETRTYKEIAVSIGKAYRAVGLXXXXXXXXXXXXCHRVIGSDGKLTGY----------
MGMT_YEAST      RKVWNELLNVEHGHVVTYGDIAKRIGTAARSVGRACGSNNLALLVPCHRIVGSNRKLTGYK---------
MGMT_PICST      ------VNELPVGSISTYQKIAQHLGMSSRAIGNCVGANRIAVVIPCHRVIGSSGKITGYRYGTNIKKTI
MGMT_YEAS7      RKVWNELLNVEHGHVATYGDIAKRIGTAARSVGRACGSNNLALLVPCHRIVGSNRKLTGYK---------
ATL1_SCHPO      -KVYDAVCEIPYGKVSTYGEIARYVGMPARQVGQAMKHLHPETHVPWHRVINSRGTI-------------
MGMT_DEBHA      RKVWNQLMNTNASETVCYSQMASNLGMSSRVVGAACGANKIALFVPCHRALTKSGQISGYR---------
NFI_THEVO       --LYNLVRQIPDGMVSTYGDLAEALGVAARSVGFMLSINKEPDYIPCYKVVPHDGSVGNY----------
NFI_THEAC       ---YGLVKQIPEGYVTTYGDLAQALGIAARAVGYMLSINEDPDTIPCYRVVLHDGTVGNY----------


                         +         .         .         .         .         *         .:210
query           LRFEGAL
OGT_METS5       LELEGSL
OGT_MYCPA       LALE---
OGT_MYCLE       LELE---
OGT_MYCTU       LELE---
OGT_MYCBO       LELE---
OGT_METKA       LELEGAL
OGT_SULSO       LELEG--
OGT_SULIY       LELEG--
OGT_SULIM       LELEG--
OGT_SULIL       LELEG--
OGT_SULIK       LELEG--
OGT_SULIA       LELEG--
OGT_METAC       LKLEGS-
OGT_SULIN       LELEG--
OGT_SHIFL       LRHEGYL
OGT_ECOLI       LRHEGYL
OGT_THEGJ       LELEG--
OGT_SULTO       LELEG--
MGMT_MOUSE      LAHEG--
MGMT_MIMIV      LDFE---
OGT_THESM       LETEG--
OGT_HAEIN       LQLE---
OGT_BACSU       LNIE---
MGMT_CANFA      LAHEGRL
OGT_PYRKO       LEIEG--
OGT_METTH       LEMEG--
MGMT_RAT        LAHEG--
OGT_ARCFU       LRLEG--
MGMT_HUMAN      LAHEG--
OGT_METJA       LERE---
ADA_SALTY       LKRE---
OGT_PYRAE       LAYEGAL
OGT_SALTY       LRHEGYL
OGT_SALTI       LRHEGYL
MGMT_CANAL      LKQEG--
ADA_ECOLI       LRRE---
OGT_METMA       -------
MGMT_KLULA      LRQEQAI
OGT_PYRHO       -------
ADAB_BACSU      LDLE---
OGT_SULAC       -------
MGMT_LODEL      LKME---
OGT_PYRFU       -------
MGMT_CRIGR      LAHEG--
OGT_PYRAB       -------
OGT_METBF       -------
MGMT_YEAST      -------
MGMT_PICST      LQNE---
MGMT_YEAS7      -------
ATL1_SCHPO      -------
MGMT_DEBHA      -------
NFI_THEVO       -------
NFI_THEAC       -------