[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81542.1

[Show Plain Result]


## Summary of Sequence Search
    1::349
   40::348     2e-34  34%  368 aa  Y0569_BRAHW RecName: Full=Uncharacterized protein
   72::330     7e-24  36%  343 aa  SP2D_BACSU RecName: Full=Stage II sporulation protein D;AltName:
  389::703     4e-22  45%  705 aa  CWBA_BACSU RecName: Full=Amidase enhancer;AltName: Full=Modifier
   73::331     1e-19  31%  344 aa  SP2D_BACAM RecName: Full=Stage II sporulation protein D;
  127::190     2e-04  37%  286 aa  Y311_CHLMU RecName: Full=Uncharacterized protein TC_0311;
  111::174     2e-04  37%  270 aa  Y041_CHLTR RecName: Full=Uncharacterized protein CT_041;
    1::349

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxEALLVRVLLKEVALGEEVRLALPTGEVALRGQAEGVVVEGRPLPS
Y0569_BRAHW     -------------------------ESEIISALTNETVMVVENRLGLKVNEVGV--YKEGIVFETQ----
SP2D_BACSU      ----------------------------------------------------------------------
CWBA_BACSU      ----------------------------------------------------------------------
SP2D_BACAM      ----------------------------------------------------------------------
Y311_CHLMU      ----------------------------------------------------------------------
Y041_CHLTR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WAVEGPYFALEGRPYRGGLVARVEGGRLLLVNVLPLEDYLLGVLPAEMPASFPEEALKAQAVLARTFAVR
Y0569_BRAHW     ---DG--FTLNGIEYYGSLMFIPYNDTMIVVNELNIEDYVKGVLPHEMSPDWPMEALKAQAVAARTYALK
SP2D_BACSU      ------------------------------VENIPLEEYVIGVVASEMPATFKPEALKAQALAARTFIVR
CWBA_BACSU      --------SLDGKQYLGTVNFSIESTKYIRVNEIPFEDYLKGVIPNEMPASWSLEALKAQTVAARTYSIT
SP2D_BACAM      ------------------------------VENIPLEEYVIGVVASEMPVEFKPEALKAQALAARTFIVR
Y311_CHLMU      ---------VNGIQYKGSVIHKTERNCLFVVNELAIEDYLKSVLSVKYLKELDKEALSACVILERTALYE
Y041_CHLTR      ---------VNGIQYRGAIIHRTDRSCLFIVNELAVEDYLKSTLSVKYLKELDKEALSACVILERTALYE


                         +         .         .         .         .         *         .:210
query           RLNPLAPYDLCATEACQVYLGLSAETPRHERAVRATEGRVLSYAGQVASALYHADSGGMTAGSEEVFQKA
Y0569_BRAHW     NANKL-PFDVDNTTKYQVYNGKEKMNWSVEQAVDRTRYEIAVYKGKVIATYFSALCGGHTDSAENVFGVA
SP2D_BACSU      LMVSNSAVEVDDTQMFQVYWGTSYETKKITDAVASTQGKILTYNNQPIEASFFSTSNGYTENAEAYWTSA
CWBA_BACSU      KTGTTVP----DTTAFQVYGGYSWNS-NTNKAVEQTKGKVLKYNGSLITAAYSSSNGGYTEASNEVWSSS
SP2D_BACAM      LMRPRKGSLVDDTQMFQVYKSKSQNLKKITNAVAGTQGKILTYENKPIEASFFSTSNGYTENAEAYWTSA
Y311_CHLMU      RL--------------------------------------------------------------------
Y041_CHLTR      RL--------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LPYLRPRPDPYAKGPKSVWQQAVXXXXXXXXXXXXXXXXXXDDPPQVLEKSPSGRAWRVRLLGVEVRGPE
Y0569_BRAHW     VPYLGGVACPYCNAQIKPWTNALSYNELNNDLANYSVHATEKSSIGISTDPKSGKATNIKIDNNDITSRD
SP2D_BACSU      IPYLKSVKSPWKKSPK--YKATKTFTAAEFQQKLGVKLDGSSAVGKITGETPGHQVATAVINGKTLKGRD
CWBA_BACSU      VPYLIAKKD--TKDPQIGW---------------------------------------------------
SP2D_BACAM      IPYLKSVKSPWKKSPKYLATRT--FSVPEFQQKLGVQLAGQDTVGQITARTPGHQVATAVINGKKLKGRD
Y311_CHLMU      ----------------------------------------------------------------------
Y041_CHLTR      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AQRLLRLMGLPSAMAEFQGWLALGRGAGHGVGLSQWGAKGMAERGYGYREILGYYFPGTLLSxxxxxxx
Y0569_BRAHW     FRTTLSPRLVPSLNFTIKGIIITGKGSGHGVGMCQWGAYGMAQVKKDYKEILKFYYNG-----------
SP2D_BACSU      IREKL---GLNSADFE---WKRNGRGFGHGVGMSQYGANFMAKEGKTVDDIVKYYYQGTQIS-------
CWBA_BACSU      -----------------------GKGYGHGIGMSQYGAKARAEAGDSYSSILKFYYPGTTLT-------
SP2D_BACAM      IREKL---GLRSADFEWKXXXXXXXXXXXXVGMSQYGANYMAEQGKSVTDIVKHYYQGVDIS-------
Y311_CHLMU      ---------------------------------------------------------------------
Y041_CHLTR      ---------------------------------------------------------------------