[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81546.1

[Show Plain Result]


## Summary of Sequence Search
    1::916
   34::76      8e-05  47%  163 aa  HACB_THET2 RecName: Full=Homoaconitase small subunit;       
   34::131     2e-04  36%  243 aa  Y3374_MYCBO RecName: Full=Uncharacterized methyltransferase Mb3374;
   34::131     2e-04  36%  243 aa  Y3342_MYCTU RecName: Full=Uncharacterized methyltransferase
 1154::1290    4e-04  32% 1330 aa  NPHP3_HUMAN RecName: Full=Nephrocystin-3;
  215::275     5e-04  33%  389 aa  YCIM_ECOLI RecName: Full=Uncharacterized protein yciM;Flags:
  215::275     5e-04  33%  389 aa  YCIM_ECOL6 RecName: Full=Uncharacterized protein yciM;Flags:
  215::275     5e-04  33%  389 aa  YCIM_ECO57 RecName: Full=Uncharacterized protein yciM;Flags:
 1127::1263    5e-04  32% 1300 aa  NPHP3_XENLA RecName: Full=Nephrocystin-3;
  904::1040    9e-04  29% 1394 aa  LPPRC_HUMAN RecName: Full=Leucine-rich PPR motif-containing protein,
  105::200     9e-04  27%  657 aa  GRAD_TREPA RecName: Full=Putative greA-associated domains protein;
    1::916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxLPPRVEGRVLEVGAFTGALVGFLQRKRPDLEWHALDGVEEAVALGKKRVPEV
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ------------------LLPAAARRVLDLGAGTGKLTTRLVERGLDVV--AVDPIPEMLDVLRAALPQT
Y3342_MYCTU     ------------------LLPAAARRVLDLGAGTGKLTTRLVERGLDVV--AVDPIPEMLDVLRAALPQT
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPEAFWKRFAFFERLPLFARLLRPGGLLVYGHG
HACB_THET2      ---------------------------------------------YAFAHLRPEFAKEVRPGDILVFGRN
Y3374_MYCBO     VALLGTAEEIPLD----------------DNSVDAVLVAQA-WHWVDPARAIPEVARVLRPGGRL-----
Y3342_MYCTU     VALLGTAEEIPLD----------------DNSVDAVLVAQA-WHWVDPARAIPEVARVLRPGGRL-----
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PFLGKSPEGVEEGLRRLGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      AGLGSSREYAPEALKRLG----------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxRYRLALGRVYLAQGRYADALRQFVESGLPEADLYTRETLERITERMRRFAREGEWAEVSRR
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ---------RVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVS-ETLEMLQTCYQQLGKTAEWAEFLQR
YCIM_ECOL6      ---------RVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVS-ETLEMLQTCYQQLGKTAEWAEFLQR
YCIM_ECO57      ---------RVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVS-ETLEMLQTCYQQLGKTAEWAEFLQR
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           Axxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      A---------------------------------------------------------------------
YCIM_ECOL6      A---------------------------------------------------------------------
YCIM_ECO57      A---------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxARELLSRARDAGLEAVAEEDLTGLIHLLERLEG
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     -------------------------------------AEELYERALDIRRRALAP-DHPSLAYTVKHL--
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     -------------------------------------AEELYERALDIRRRALSP-DHPSLAYTVKHL--
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PWAAFSVLYQALSRTPQPPLELLALAYRLSRAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAH
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     -----AILYKKMGKLDKAPLYELAVEIRQKSFGPKHPSVATALVN-LAVLYSQMKKERALKIYEDSLRMH
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     -----AVLYKRKGKLDKAPLYELAVDIRQKSFGPKHPSVATALVN-LAVLYCQMKKERAMKIYEDSLRMH
LPPRC_HUMAN     --------------------------YKEAKKIIETPRARSARLQWFCRCVANNQVETLEKLVELTQKLF
GRAD_TREPA      ----------------------------------------------LGECYKTSGNEQLYDVWERLVRID


                         .         .         .         .         +         .         .:770
query           PQALEVLFDLAEHHEAQGDWRRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKA
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     PRVGETLKNLAVLSYEGGDFEKAAELYKRAMEI-------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     PRVGETLKNLAVLRYEEGDYEKAAELYKRAMEI-------------------------------------
LPPRC_HUMAN     EDRDQMYYNLLKLYKINGDWQRADAVWNKIQEEVIPREKTLRLLAEILREGNQEVPFDVPELWYEDEKHS
GRAD_TREPA      YEEAEITRVLADKYEQEGNKEKATEFYKKALYRFIARRQNAAI-KEVWTKLVALIPDD--VEFFYREQKK


                         .         .         *         .         .         .         .:840
query           VGEGLKALGEEAPHLPEAPRDLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     LNSSSASTTE-----PDFQKDIL-----------------------------------------------
GRAD_TREPA      ISEKL-----------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HACB_THET2      ----------------------------------------------------------------------
Y3374_MYCBO     ----------------------------------------------------------------------
Y3342_MYCTU     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
YCIM_ECOLI      ----------------------------------------------------------------------
YCIM_ECOL6      ----------------------------------------------------------------------
YCIM_ECO57      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
LPPRC_HUMAN     ----------------------------------------------------------------------
GRAD_TREPA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxx
HACB_THET2      ------
Y3374_MYCBO     ------
Y3342_MYCTU     ------
NPHP3_HUMAN     ------
YCIM_ECOLI      ------
YCIM_ECOL6      ------
YCIM_ECO57      ------
NPHP3_XENLA     ------
LPPRC_HUMAN     ------
GRAD_TREPA      ------