[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81585.1

[Show Plain Result]


## Summary of Sequence Search
    1::198
    1::198     e-110 100%  198 aa  KTHY_THET8 RecName: Full=Thymidylate kinase;       
    1::198     e-110 100%  198 aa  KTHY_THET2 RecName: Full=Thymidylate kinase;       
    1::198     4e-47  53%  206 aa  KTHY_SYNJB RecName: Full=Thymidylate kinase;       
    1::206     2e-46  51%  233 aa  KTHY_BIFLI RecName: Full=Thymidylate kinase;       
    1::197     6e-46  55%  204 aa  KTHY_SYNJA RecName: Full=Thymidylate kinase;       
    1::205     4e-45  51%  206 aa  KTHY_BIFLD RecName: Full=Thymidylate kinase;       
    1::205     7e-45  52%  214 aa  KTHY_DESOH RecName: Full=Thymidylate kinase;       
    1::205     9e-45  51%  206 aa  KTHY_BIFLO RecName: Full=Thymidylate kinase;       
    1::201     3e-44  53%  203 aa  KTHY_CARHZ RecName: Full=Thymidylate kinase;       
    1::209     2e-43  50%  217 aa  KTHY_CHLP8 RecName: Full=Thymidylate kinase;       
    1::220     3e-43  49%  222 aa  KTHY_CHLCH RecName: Full=Thymidylate kinase;       
    1::204     6e-43  50%  217 aa  KTHY_BIFAA RecName: Full=Thymidylate kinase;       
    1::198     1e-42  52%  214 aa  KTHY_PELLD RecName: Full=Thymidylate kinase;       
    3::204     4e-42  48%  214 aa  KTHY_SYMTH RecName: Full=Thymidylate kinase;       
    4::202     5e-42  50%  216 aa  KTHY_PELCD RecName: Full=Thymidylate kinase;       
    1::189     9e-42  47%  208 aa  KTHY_KOSOT RecName: Full=Thymidylate kinase;       
    1::207     1e-41  49%  215 aa  KTHY_PROVI RecName: Full=Thymidylate kinase;       
    4::203     1e-41  50%  207 aa  KTHY_DINSH RecName: Full=Thymidylate kinase;       
    5::212     2e-41  52%  217 aa  KTHY_RHOSK RecName: Full=Thymidylate kinase;       
    1::201     3e-41  50%  224 aa  KTHY_DESVH RecName: Full=Thymidylate kinase;       
    1::197     3e-41  51%  207 aa  KTHY_HALOH RecName: Full=Thymidylate kinase;       
    1::201     3e-41  50%  224 aa  KTHY_DESVV RecName: Full=Thymidylate kinase;       
    1::209     4e-41  49%  215 aa  KTHY_DESVM RecName: Full=Thymidylate kinase;       
    2::192     6e-41  49%  213 aa  KTHY_GEOUR RecName: Full=Thymidylate kinase;       
    4::205     1e-40  46%  207 aa  KTHY_DESRM RecName: Full=Thymidylate kinase;       
    1::203     1e-40  48%  217 aa  KTHY_DESAD RecName: Full=Thymidylate kinase;       
    5::200     1e-40  53%  217 aa  KTHY_RHOS4 RecName: Full=Thymidylate kinase;       
    5::200     1e-40  53%  217 aa  KTHY_RHOS1 RecName: Full=Thymidylate kinase;       
    2::199     3e-40  45%  204 aa  KTHY_SULSY RecName: Full=Thymidylate kinase;       
    4::197     5e-40  53%  210 aa  KTHY_THERP RecName: Full=Thymidylate kinase;       
    4::199     6e-40  49%  206 aa  KTHY_DEIRA RecName: Full=Thymidylate kinase;       
    1::202     2e-39  48%  223 aa  KTHY_PROA2 RecName: Full=Thymidylate kinase;       
    1::211     2e-39  47%  217 aa  KTHY_PELPB RecName: Full=Thymidylate kinase;       
    3::204     2e-39  49%  208 aa  KTHY_METCA RecName: Full=Thymidylate kinase;       
    1::204     9e-39  44%  208 aa  KTHY_THETN RecName: Full=Thymidylate kinase;       
    3::229     1e-38  51%  236 aa  KTHY_HERA2 RecName: Full=Thymidylate kinase;       
    2::203     1e-38  47%  214 aa  KTHY_GEOSF RecName: Full=Thymidylate kinase;       
    1::202     2e-38  47%  214 aa  KTHY_CHLTE RecName: Full=Thymidylate kinase;       
   10::212     3e-38  45%  227 aa  KTHY_COXBU RecName: Full=Thymidylate kinase;       
    1::197     5e-38  48%  212 aa  KTHY_GLOVI RecName: Full=Thymidylate kinase;       
    1::185     8e-38  49%  197 aa  KTHY_THEMA RecName: Full=Thymidylate kinase;       
    1::194     8e-38  43%  203 aa  KTHY_METFK RecName: Full=Thymidylate kinase;       
    1::203     8e-38  47%  212 aa  KTHY_DESDG RecName: Full=Thymidylate kinase;       
    1::205     1e-37  47%  210 aa  KTHY_PSEFS RecName: Full=Thymidylate kinase;       
    1::209     1e-37  41%  216 aa  KTHY_LACAC RecName: Full=Thymidylate kinase;       
    3::216     2e-37  49%  226 aa  KTHY_ROSS1 RecName: Full=Thymidylate kinase;       
    3::203     2e-37  46%  207 aa  KTHY_DEHE1 RecName: Full=Thymidylate kinase;       
    3::217     2e-37  49%  229 aa  KTHY_ROSCS RecName: Full=Thymidylate kinase;       
    1::205     2e-37  45%  205 aa  KTHY_RALPJ RecName: Full=Thymidylate kinase;       
    3::201     3e-37  48%  204 aa  KTHY_THIDA RecName: Full=Thymidylate kinase;       
    1::185     3e-37  49%  197 aa  KTHY_THESQ RecName: Full=Thymidylate kinase;       
   10::222     3e-37  50%  241 aa  KTHY_THEEB RecName: Full=Thymidylate kinase;       
    1::193     3e-37  45%  212 aa  KTHY_EXIS2 RecName: Full=Thymidylate kinase;       
    3::203     3e-37  47%  208 aa  KTHY_DEHSB RecName: Full=Thymidylate kinase;       
    1::183     4e-37  45%  203 aa  KTHY_THEPX RecName: Full=Thymidylate kinase;       
    1::183     4e-37  45%  203 aa  KTHY_THEP3 RecName: Full=Thymidylate kinase;       
    4::204     4e-37  44%  212 aa  KTHY_STRPS RecName: Full=Thymidylate kinase;       
    1::184     4e-37  49%  205 aa  KTHY_RALSO RecName: Full=Thymidylate kinase;       
    1::202     4e-37  48%  210 aa  KTHY_PSE14 RecName: Full=Thymidylate kinase;       
    1::195     4e-37  44%  210 aa  KTHY_GEOSW RecName: Full=Thymidylate kinase;       
    1::197     5e-37  48%  205 aa  KTHY_NITMU RecName: Full=Thymidylate kinase;       
    1::185     7e-37  49%  197 aa  KTHY_THEP1 RecName: Full=Thymidylate kinase;       
    4::204     7e-37  43%  212 aa  KTHY_STRPI RecName: Full=Thymidylate kinase;       
    4::198     7e-37  46%  212 aa  KTHY_STRGC RecName: Full=Thymidylate kinase;       
    3::203     7e-37  47%  208 aa  KTHY_DEHSC RecName: Full=Thymidylate kinase;       
    4::206     7e-37  46%  206 aa  KTHY_BURCM RecName: Full=Thymidylate kinase;       
    4::206     7e-37  46%  206 aa  KTHY_BURA4 RecName: Full=Thymidylate kinase;       
    1::205     9e-37  48%  212 aa  KTHY_SYNR3 RecName: Full=Thymidylate kinase;       
    4::206     9e-37  45%  206 aa  KTHY_BURTA RecName: Full=Thymidylate kinase;       
    4::206     1e-36  46%  206 aa  KTHY_BURCH RecName: Full=Thymidylate kinase;       
    4::206     1e-36  46%  206 aa  KTHY_BURCC RecName: Full=Thymidylate kinase;       
    4::206     1e-36  46%  206 aa  KTHY_BURCA RecName: Full=Thymidylate kinase;       
    4::204     1e-36  43%  212 aa  KTHY_STRZP RecName: Full=Thymidylate kinase;       
    4::204     1e-36  43%  212 aa  KTHY_STRZJ RecName: Full=Thymidylate kinase;       
    4::204     1e-36  43%  212 aa  KTHY_STRPN RecName: Full=Thymidylate kinase;       
    4::204     1e-36  43%  212 aa  KTHY_STRP7 RecName: Full=Thymidylate kinase;       
    4::204     1e-36  43%  212 aa  KTHY_STRP4 RecName: Full=Thymidylate kinase;       
    1::211     1e-36  45%  219 aa  KTHY_CHLL2 RecName: Full=Thymidylate kinase;       
    4::204     2e-36  43%  212 aa  KTHY_STRR6 RecName: Full=Thymidylate kinase;       
    4::204     2e-36  43%  212 aa  KTHY_STRP2 RecName: Full=Thymidylate kinase;       
    1::198     2e-36  46%  208 aa  KTHY_JANSC RecName: Full=Thymidylate kinase;       
    1::207     2e-36  44%  211 aa  KTHY_ANAVT RecName: Full=Thymidylate kinase;       
    4::204     3e-36  43%  212 aa  KTHY_STRZT RecName: Full=Thymidylate kinase;       
    5::196     3e-36  48%  211 aa  KTHY_SILPO RecName: Full=Thymidylate kinase;       
    1::186     3e-36  49%  193 aa  KTHY_COPPD RecName: Full=Thymidylate kinase;       
    1::189     3e-36  48%  211 aa  KTHY_CLAMS RecName: Full=Thymidylate kinase;       
    4::206     3e-36  45%  206 aa  KTHY_BURS3 RecName: Full=Thymidylate kinase;       
    4::206     3e-36  45%  206 aa  KTHY_BURCJ RecName: Full=Thymidylate kinase;       
    4::204     4e-36  43%  212 aa  KTHY_STRPJ RecName: Full=Thymidylate kinase;       
    1::186     4e-36  50%  210 aa  KTHY_PSEU2 RecName: Full=Thymidylate kinase;       
    1::205     4e-36  46%  221 aa  KTHY_DESAP RecName: Full=Thymidylate kinase;       
    1::211     4e-36  45%  219 aa  KTHY_CHLPD RecName: Full=Thymidylate kinase;       
    1::195     6e-36  45%  211 aa  KTHY_LACLM RecName: Full=Thymidylate kinase;       
    1::200     6e-36  45%  212 aa  KTHY_GEOLS RecName: Full=Thymidylate kinase;       
    1::209     7e-36  41%  212 aa  KTHY_LACH4 RecName: Full=Thymidylate kinase;       
    1::186     7e-36  44%  212 aa  KTHY_EXISA RecName: Full=Thymidylate kinase;       
    8::209     7e-36  46%  212 aa  KTHY_CHRVO RecName: Full=Thymidylate kinase;       
    4::206     7e-36  46%  206 aa  KTHY_BURVG RecName: Full=Thymidylate kinase;       
    1::205     9e-36  44%  210 aa  KTHY_PSEPF RecName: Full=Thymidylate kinase;       
    2::206     9e-36  46%  219 aa  KTHY_PELPD RecName: Full=Thymidylate kinase;       
    4::209     1e-35  46%  211 aa  KTHY_STRP3 RecName: Full=Thymidylate kinase;       
    4::198     1e-35  45%  208 aa  KTHY_CAUCR RecName: Full=Thymidylate kinase;       
    1::199     1e-35  42%  208 aa  KTHY_BACCN RecName: Full=Thymidylate kinase;       
    1::204     2e-35  42%  211 aa  KTHY_NOSP7 RecName: Full=Thymidylate kinase;       
    2::203     2e-35  47%  212 aa  KTHY_SYNS3 RecName: Full=Thymidylate kinase;       
    4::207     2e-35  44%  219 aa  KTHY_SYNAS RecName: Full=Thymidylate kinase;       
    1::172     2e-35  56%  205 aa  KTHY_PYRAB RecName: Full=Probable thymidylate kinase;       
    1::186     2e-35  49%  210 aa  KTHY_PSESM RecName: Full=Thymidylate kinase;       
    4::196     3e-35  43%  212 aa  KTHY_STRSV RecName: Full=Thymidylate kinase;       
    1::181     3e-35  54%  205 aa  KTHY_PYRHO RecName: Full=Probable thymidylate kinase;       
    1::195     3e-35  44%  211 aa  KTHY_LACLA RecName: Full=Thymidylate kinase;       
    5::197     4e-35  44%  206 aa  KTHY_NEIMF RecName: Full=Thymidylate kinase;       
    5::197     4e-35  44%  206 aa  KTHY_NEIMA RecName: Full=Thymidylate kinase;       
    4::200     4e-35  44%  206 aa  KTHY_BURPP RecName: Full=Thymidylate kinase;       
    1::189     5e-35  41%  199 aa  KTHY_TROWT RecName: Full=Thymidylate kinase;       
    1::189     5e-35  41%  199 aa  KTHY_TROW8 RecName: Full=Thymidylate kinase;       
    1::204     5e-35  46%  209 aa  KTHY_SYNPX RecName: Full=Thymidylate kinase;       
    1::185     5e-35  47%  211 aa  KTHY_CLAM3 RecName: Full=Thymidylate kinase;       
    6::212     5e-35  42%  224 aa  KTHY_AGRT5 RecName: Full=Thymidylate kinase;       
    5::202     6e-35  44%  225 aa  KTHY_MESSB RecName: Full=Thymidylate kinase;       
    1::195     6e-35  45%  211 aa  KTHY_LACLS RecName: Full=Thymidylate kinase;       
    4::200     6e-35  44%  206 aa  KTHY_BURP8 RecName: Full=Thymidylate kinase;       
    4::202     8e-35  50%  210 aa  KTHY_PYRFU RecName: Full=Probable thymidylate kinase;       
    5::197     8e-35  44%  206 aa  KTHY_NEIMB RecName: Full=Thymidylate kinase;       
    4::206     8e-35  44%  206 aa  KTHY_BURPS RecName: Full=Thymidylate kinase;       
    4::206     8e-35  44%  206 aa  KTHY_BURP1 RecName: Full=Thymidylate kinase;       
    4::206     8e-35  44%  206 aa  KTHY_BURP0 RecName: Full=Thymidylate kinase;       
    1::208     8e-35  42%  212 aa  KTHY_BACP2 RecName: Full=Thymidylate kinase;       
    1::199     1e-34  41%  208 aa  KTHY_BACCR RecName: Full=Thymidylate kinase;       
    1::199     1e-34  41%  208 aa  KTHY_BACC2 RecName: Full=Thymidylate kinase;       
    4::197     1e-34  46%  217 aa  KTHY_ACISJ RecName: Full=Thymidylate kinase;       
    1::196     1e-34  45%  199 aa  KTHY_ACIBY RecName: Full=Thymidylate kinase;       
    1::196     1e-34  45%  199 aa  KTHY_ACIB5 RecName: Full=Thymidylate kinase;       
    1::196     1e-34  45%  199 aa  KTHY_ACIB3 RecName: Full=Thymidylate kinase;       
    5::197     1e-34  43%  206 aa  KTHY_NEIG2 RecName: Full=Thymidylate kinase;       
    5::197     1e-34  43%  206 aa  KTHY_NEIG1 RecName: Full=Thymidylate kinase;       
    1::209     2e-34  42%  213 aa  KTHY_LACJO RecName: Full=Thymidylate kinase;       
    1::197     2e-34  44%  227 aa  KTHY_DESAH RecName: Full=Thymidylate kinase;       
    4::206     2e-34  44%  206 aa  KTHY_BURP6 RecName: Full=Thymidylate kinase;       
    4::206     2e-34  44%  206 aa  KTHY_BURMS RecName: Full=Thymidylate kinase;       
    4::206     2e-34  44%  206 aa  KTHY_BURMA RecName: Full=Thymidylate kinase;       
    4::206     2e-34  44%  206 aa  KTHY_BURM9 RecName: Full=Thymidylate kinase;       
    4::206     2e-34  44%  206 aa  KTHY_BURM7 RecName: Full=Thymidylate kinase;       
    1::199     2e-34  42%  208 aa  KTHY_BACCQ RecName: Full=Thymidylate kinase;       
    1::199     2e-34  41%  208 aa  KTHY_BACC4 RecName: Full=Thymidylate kinase;       
    1::196     2e-34  45%  199 aa  KTHY_ACIBS RecName: Full=Thymidylate kinase;       
    1::196     2e-34  45%  199 aa  KTHY_ACIBC RecName: Full=Thymidylate kinase;       
    4::196     3e-34  47%  211 aa  KTHY_STRP6 RecName: Full=Thymidylate kinase;       
    4::196     3e-34  47%  211 aa  KTHY_STRP1 RecName: Full=Thymidylate kinase;       
    1::199     3e-34  41%  208 aa  KTHY_BACWK RecName: Full=Thymidylate kinase;       
    1::199     3e-34  41%  208 aa  KTHY_BACHK RecName: Full=Thymidylate kinase;       
    1::199     3e-34  41%  208 aa  KTHY_BACCZ RecName: Full=Thymidylate kinase;       
    1::199     3e-34  41%  208 aa  KTHY_BACAN RecName: Full=Thymidylate kinase;       
    1::199     3e-34  41%  208 aa  KTHY_BACAC RecName: Full=Thymidylate kinase;       
    1::199     3e-34  41%  208 aa  KTHY_BACAA RecName: Full=Thymidylate kinase;       
    4::196     4e-34  47%  211 aa  KTHY_STRPZ RecName: Full=Thymidylate kinase;       
    1::189     4e-34  43%  197 aa  KTHY_FERNB RecName: Full=Thymidylate kinase;       
    1::199     4e-34  41%  208 aa  KTHY_BACC7 RecName: Full=Thymidylate kinase;       
    1::199     4e-34  41%  208 aa  KTHY_BACC3 RecName: Full=Thymidylate kinase;       
    1::199     4e-34  41%  208 aa  KTHY_BACAH RecName: Full=Thymidylate kinase;       
    4::197     5e-34  45%  211 aa  KTHY_STRU0 RecName: Full=Thymidylate kinase;       
    1::202     5e-34  51%  205 aa  KTHY_PYRKO RecName: Full=Probable thymidylate kinase;       
    1::215     5e-34  44%  225 aa  KTHY_POLSJ RecName: Full=Thymidylate kinase;       
    1::195     5e-34  42%  225 aa  KTHY_GEOTN RecName: Full=Thymidylate kinase;       
    1::199     5e-34  41%  208 aa  KTHY_BACC1 RecName: Full=Thymidylate kinase;       
    1::196     5e-34  45%  199 aa  KTHY_ACIBT RecName: Full=Thymidylate kinase;       
    1::213     7e-34  45%  225 aa  KTHY_TRIEI RecName: Full=Thymidylate kinase;       
    1::203     7e-34  41%  208 aa  KTHY_LISW6 RecName: Full=Thymidylate kinase;       
    1::203     7e-34  43%  203 aa  KTHY_CHLMU RecName: Full=Thymidylate kinase;       
    1::226     7e-34  43%  231 aa  KTHY_ACAM1 RecName: Full=Thymidylate kinase;       
    4::196     9e-34  47%  211 aa  KTHY_STRPG RecName: Full=Thymidylate kinase;       
    4::196     9e-34  47%  211 aa  KTHY_STRP8 RecName: Full=Thymidylate kinase;       
    1::202     9e-34  44%  207 aa  KTHY_PSEPW RecName: Full=Thymidylate kinase;       
    1::201     9e-34  43%  212 aa  KTHY_PROM2 RecName: Full=Thymidylate kinase;       
    1::208     2e-33  45%  209 aa  KTHY_SYNS9 RecName: Full=Thymidylate kinase;       
    1::186     2e-33  46%  203 aa  KTHY_RALEH RecName: Full=Thymidylate kinase;       
    1::203     2e-33  44%  203 aa  KTHY_CHLTR RecName: Full=Thymidylate kinase;       
    1::202     2e-33  44%  202 aa  KTHY_ACIAD RecName: Full=Thymidylate kinase;       
    2::212     2e-33  44%  225 aa  KTHY_GEOSM RecName: Full=Thymidylate kinase;       
    1::203     2e-33  43%  203 aa  KTHY_DICNV RecName: Full=Thymidylate kinase;       
    1::200     2e-33  41%  211 aa  KTHY_ANASP RecName: Full=Thymidylate kinase;       
    4::205     3e-33  38%  205 aa  KTHY_CLONN RecName: Full=Thymidylate kinase;       
    1::199     3e-33  42%  212 aa  KTHY_LACDB RecName: Full=Thymidylate kinase;       
    1::199     3e-33  42%  212 aa  KTHY_LACDA RecName: Full=Thymidylate kinase;       
    2::192     3e-33  44%  225 aa  KTHY_GEOBB RecName: Full=Thymidylate kinase;       
   13::218     3e-33  45%  226 aa  KTHY_BRASO RecName: Full=Thymidylate kinase;       
   13::220     3e-33  48%  228 aa  KTHY_BRAJA RecName: Full=Thymidylate kinase;       
    1::192     4e-33  45%  203 aa  KTHY_RALEJ RecName: Full=Thymidylate kinase;       
    1::191     4e-33  45%  211 aa  KTHY_MESFL RecName: Full=Thymidylate kinase;       
    1::203     4e-33  43%  203 aa  KTHY_CHLTA RecName: Full=Thymidylate kinase;       
    4::196     4e-33  45%  213 aa  KTHY_BACSK RecName: Full=Thymidylate kinase;       
    4::197     6e-33  45%  215 aa  KTHY_NITEC RecName: Full=Thymidylate kinase;       
    1::203     6e-33  41%  208 aa  KTHY_LISIN RecName: Full=Thymidylate kinase;       
    1::210     6e-33  42%  217 aa  KTHY_DESDA RecName: Full=Thymidylate kinase;       
    1::189     8e-33  45%  210 aa  KTHY_PSEF5 RecName: Full=Thymidylate kinase;       
    1::208     8e-33  39%  208 aa  KTHY_LAWIP RecName: Full=Thymidylate kinase;       
    4::183     8e-33  47%  206 aa  KTHY_BURXL RecName: Full=Thymidylate kinase;       
    1::176     1e-32  42%  205 aa  KTHY_WOLTR RecName: Full=Thymidylate kinase;       
    1::202     1e-32  43%  210 aa  KTHY_PSEU5 RecName: Full=Thymidylate kinase;       
    1::201     1e-32  44%  210 aa  KTHY_PSEPG RecName: Full=Thymidylate kinase;       
    1::205     1e-32  43%  210 aa  KTHY_PSEE4 RecName: Full=Thymidylate kinase;       
    1::205     1e-32  42%  220 aa  KTHY_PROMA RecName: Full=Thymidylate kinase;       
    1::186     1e-32  47%  203 aa  KTHY_CUPTR RecName: Full=Thymidylate kinase;       
    5::208     1e-32  43%  221 aa  KTHY_ACIAC RecName: Full=Thymidylate kinase;       
    1::176     1e-32  41%  205 aa  KTHY_WOLPP RecName: Full=Thymidylate kinase;       
    1::205     1e-32  43%  210 aa  KTHY_PSEP1 RecName: Full=Thymidylate kinase;       
    1::196     2e-32  42%  214 aa  KTHY_LACSS RecName: Full=Thymidylate kinase;       
    1::198     2e-32  44%  214 aa  KTHY_LACF3 RecName: Full=Thymidylate kinase;       
    4::194     2e-32  41%  208 aa  KTHY_HAHCH RecName: Full=Thymidylate kinase;       
    4::191     2e-32  45%  217 aa  KTHY_ALHEH RecName: Full=Thymidylate kinase;       
    1::204     2e-32  48%  213 aa  KTHY_SYNPW RecName: Full=Thymidylate kinase;       
    8::206     2e-32  46%  210 aa  KTHY_LEIXX RecName: Full=Thymidylate kinase;       
    1::203     2e-32  43%  203 aa  KTHY_CHLTB RecName: Full=Thymidylate kinase;       
    1::203     2e-32  43%  203 aa  KTHY_CHLT2 RecName: Full=Thymidylate kinase;       
    1::191     2e-32  42%  207 aa  KTHY_CHLCV RecName: Full=Thymidylate kinase;       
   13::218     2e-32  42%  226 aa  KTHY_BRASB RecName: Full=Thymidylate kinase;       
    1::202     2e-32  44%  214 aa  KTHY_BARQU RecName: Full=Thymidylate kinase;       
    1::193     2e-32  41%  195 aa  KTHY_AQUAE RecName: Full=Thymidylate kinase;       
    4::197     3e-32  42%  211 aa  KTHY_STRA5 RecName: Full=Thymidylate kinase;       
    4::197     3e-32  42%  211 aa  KTHY_STRA3 RecName: Full=Thymidylate kinase;       
    4::197     3e-32  42%  211 aa  KTHY_STRA1 RecName: Full=Thymidylate kinase;       
    1::200     4e-32  43%  207 aa  KTHY_ONYPE RecName: Full=Thymidylate kinase;       
    1::194     4e-32  43%  206 aa  KTHY_METAC RecName: Full=Probable thymidylate kinase;       
    1::203     4e-32  41%  208 aa  KTHY_LISMF RecName: Full=Thymidylate kinase;       
    1::203     4e-32  41%  208 aa  KTHY_LISMC RecName: Full=Thymidylate kinase;       
    1::200     4e-32  43%  214 aa  KTHY_LACCB RecName: Full=Thymidylate kinase;       
    1::200     4e-32  43%  214 aa  KTHY_LACC3 RecName: Full=Thymidylate kinase;       
    2::202     4e-32  42%  213 aa  KTHY_GEOSL RecName: Full=Thymidylate kinase;       
    1::199     4e-32  41%  212 aa  KTHY_ENTFA RecName: Full=Thymidylate kinase;       
    1::193     4e-32  39%  212 aa  KTHY_BACA2 RecName: Full=Thymidylate kinase;       
    1::197     4e-32  41%  208 aa  KTHY_ALCBS RecName: Full=Thymidylate kinase;       
    8::206     5e-32  41%  225 aa  KTHY_PARUW RecName: Full=Thymidylate kinase;       
    1::187     5e-32  45%  206 aa  KTHY_METMA RecName: Full=Probable thymidylate kinase;       
    1::196     6e-32  50%  205 aa  KTHY_THEON RecName: Full=Probable thymidylate kinase;       
    1::203     6e-32  41%  208 aa  KTHY_LISMO RecName: Full=Thymidylate kinase;       
    1::199     6e-32  40%  212 aa  KTHY_BACLD RecName: Full=Thymidylate kinase;       
    1::203     8e-32  40%  208 aa  KTHY_LISMH RecName: Full=Thymidylate kinase;       
    1::203     8e-32  44%  215 aa  KTHY_BARHE RecName: Full=Thymidylate kinase;       
    4::203     1e-31  42%  211 aa  KTHY_STRS7 RecName: Full=Thymidylate kinase;       
    1::204     1e-31  42%  210 aa  KTHY_PROM5 RecName: Full=Thymidylate kinase;       
    1::185     1e-31  43%  206 aa  KTHY_CHLPN RecName: Full=Thymidylate kinase;       
    1::191     2e-31  41%  211 aa  KTHY_CHLAB RecName: Full=Thymidylate kinase;       
    4::197     2e-31  43%  212 aa  KTHY_STRMU RecName: Full=Thymidylate kinase;       
    4::193     2e-31  42%  205 aa  KTHY_STAS1 RecName: Full=Thymidylate kinase;       
    1::176     3e-31  42%  196 aa  KTHY_WOLPM RecName: Full=Thymidylate kinase;       
    4::203     3e-31  42%  211 aa  KTHY_STRE4 RecName: Full=Thymidylate kinase;       
    1::204     4e-31  40%  212 aa  KTHY_MARMS RecName: Full=Thymidylate kinase;       
    5::201     4e-31  43%  214 aa  KTHY_GLUOX RecName: Full=Thymidylate kinase;       
    1::188     4e-31  40%  212 aa  KTHY_BACSU RecName: Full=Thymidylate kinase;       
    2::198     5e-31  49%  210 aa  KTHY_THESM RecName: Full=Probable thymidylate kinase;       
    3::204     5e-31  44%  212 aa  KTHY_CHRSD RecName: Full=Thymidylate kinase;       
    4::205     7e-31  38%  205 aa  KTHY_VESOH RecName: Full=Thymidylate kinase;       
    4::205     7e-31  39%  205 aa  KTHY_RUTMC RecName: Full=Thymidylate kinase;       
    5::210     7e-31  43%  215 aa  KTHY_RHOFD RecName: Full=Thymidylate kinase;       
    4::197     7e-31  44%  215 aa  KTHY_NITEU RecName: Full=Thymidylate kinase;       
    5::209     7e-31  42%  214 aa  KTHY_LEUCK RecName: Full=Thymidylate kinase;       
    1::180     9e-31  43%  214 aa  KTHY_PROMP RecName: Full=Thymidylate kinase;       
    1::204     9e-31  41%  212 aa  KTHY_PROM9 RecName: Full=Thymidylate kinase;       
    1::179     1e-30  46%  209 aa  KTHY_SYNSC RecName: Full=Thymidylate kinase;       
    1::194     1e-30  42%  200 aa  KTHY_RALME RecName: Full=Thymidylate kinase;       
    1::180     1e-30  44%  212 aa  KTHY_PROM0 RecName: Full=Thymidylate kinase;       
    1::224     1e-30  42%  234 aa  KTHY_CYAP4 RecName: Full=Thymidylate kinase;       
    4::196     1e-30  40%  210 aa  KTHY_BACHD RecName: Full=Thymidylate kinase;         EC=2.7.4.9;
    1::205     2e-30  42%  210 aa  KTHY_PSEMY RecName: Full=Thymidylate kinase;       
    1::203     2e-30  45%  214 aa  KTHY_MYCS5 RecName: Full=Thymidylate kinase;       
    1::203     2e-30  40%  213 aa  KTHY_LACRJ RecName: Full=Thymidylate kinase;       
    1::203     2e-30  40%  213 aa  KTHY_LACRD RecName: Full=Thymidylate kinase;       
    1::200     2e-30  42%  207 aa  KTHY_AYWBP RecName: Full=Thymidylate kinase;       
    1::197     3e-30  41%  214 aa  KTHY_LACBA RecName: Full=Thymidylate kinase;       
    1::190     3e-30  39%  207 aa  KTHY_CHLFF RecName: Full=Thymidylate kinase;       
    1::207     3e-30  38%  209 aa  KTHY_ANOFW RecName: Full=Thymidylate kinase;       
    1::193     3e-30  43%  210 aa  KTHY_PSEA7 RecName: Full=Thymidylate kinase;       
    1::194     3e-30  42%  205 aa  KTHY_METBF RecName: Full=Probable thymidylate kinase;       
    1::197     3e-30  41%  201 aa  KTHY_ACHLI RecName: Full=Thymidylate kinase;       
    1::193     5e-30  43%  210 aa  KTHY_PSEAB RecName: Full=Thymidylate kinase;       
    4::199     5e-30  43%  204 aa  KTHY_JANMA RecName: Full=Thymidylate kinase;       
    4::184     6e-30  43%  203 aa  KTHY_STAHJ RecName: Full=Thymidylate kinase;       
    1::193     6e-30  43%  210 aa  KTHY_PSEAE RecName: Full=Thymidylate kinase;       
    1::193     6e-30  43%  210 aa  KTHY_PSEA8 RecName: Full=Thymidylate kinase;       
    1::182     8e-30  45%  193 aa  KTHY_PYRCJ RecName: Full=Probable thymidylate kinase;       
    1::204     8e-30  40%  212 aa  KTHY_PROMS RecName: Full=Thymidylate kinase;       
   13::215     8e-30  45%  230 aa  KTHY_NITHX RecName: Full=Thymidylate kinase;       
   13::199     1e-29  45%  230 aa  KTHY_RHOPB RecName: Full=Thymidylate kinase;       
    5::197     1e-29  42%  213 aa  KTHY_LEUMM RecName: Full=Thymidylate kinase;       
    4::197     2e-29  43%  209 aa  KTHY_STRTD RecName: Full=Thymidylate kinase;       
    4::197     2e-29  43%  209 aa  KTHY_STRT2 RecName: Full=Thymidylate kinase;       
    4::197     2e-29  43%  209 aa  KTHY_STRT1 RecName: Full=Thymidylate kinase;       
   16::202     2e-29  41%  204 aa  KTHY_PROAC RecName: Full=Thymidylate kinase;       
    5::199     2e-29  39%  214 aa  KTHY_GEOKA RecName: Full=Thymidylate kinase;       
    1::200     2e-29  39%  201 aa  KTHY_THEAB RecName: Full=Thymidylate kinase;       
    5::208     2e-29  43%  208 aa  KTHY_SHEAM RecName: Full=Thymidylate kinase;       
    1::205     4e-29  43%  216 aa  KTHY_PROMM RecName: Full=Thymidylate kinase;       
    1::197     4e-29  38%  209 aa  KTHY_FRATW RecName: Full=Thymidylate kinase;       
    1::197     4e-29  38%  209 aa  KTHY_FRATT RecName: Full=Thymidylate kinase;       
    1::197     4e-29  38%  209 aa  KTHY_FRATO RecName: Full=Thymidylate kinase;       
    1::197     4e-29  38%  209 aa  KTHY_FRAT1 RecName: Full=Thymidylate kinase;       
    1::203     4e-29  40%  212 aa  KTHY_BLOPB RecName: Full=Thymidylate kinase;       
    1::200     5e-29  39%  209 aa  KTHY_PEDPA RecName: Full=Thymidylate kinase;       
    1::197     5e-29  38%  209 aa  KTHY_FRATN RecName: Full=Thymidylate kinase;       
    4::198     7e-29  42%  213 aa  KTHY_OENOB RecName: Full=Thymidylate kinase;       
    1::190     7e-29  39%  208 aa  KTHY_LACS1 RecName: Full=Thymidylate kinase;       
    6::199     7e-29  41%  204 aa  KTHY_HERAR RecName: Full=Thymidylate kinase;       
    1::197     7e-29  38%  209 aa  KTHY_FRATH RecName: Full=Thymidylate kinase;       
    1::197     7e-29  38%  209 aa  KTHY_FRATF RecName: Full=Thymidylate kinase;       
    1::197     9e-29  38%  209 aa  KTHY_FRATM RecName: Full=Thymidylate kinase;       
    4::190     1e-28  41%  205 aa  KTHY_STAAW RecName: Full=Thymidylate kinase;       
    4::190     1e-28  41%  205 aa  KTHY_STAAS RecName: Full=Thymidylate kinase;       
    8::207     1e-28  43%  209 aa  KTHY_SHESR RecName: Full=Thymidylate kinase;       
    8::207     1e-28  43%  209 aa  KTHY_SHESM RecName: Full=Thymidylate kinase;       
    4::204     1e-28  39%  224 aa  KTHY_RHILO RecName: Full=Thymidylate kinase;       
    1::209     1e-28  41%  215 aa  KTHY_PROM4 RecName: Full=Thymidylate kinase;       
    5::202     1e-28  41%  213 aa  KTHY_KLEP7 RecName: Full=Thymidylate kinase;       
    1::189     1e-28  43%  202 aa  KTHY_EHRRW RecName: Full=Thymidylate kinase;       
    1::189     1e-28  43%  202 aa  KTHY_EHRRG RecName: Full=Thymidylate kinase;       
    5::202     1e-28  41%  213 aa  KTHY_KLEP3 RecName: Full=Thymidylate kinase;       
    6::210     1e-28  41%  214 aa  KTHY_HAEDU RecName: Full=Thymidylate kinase;       
    1::179     1e-28  47%  211 aa  KTHY_ANAMM RecName: Full=Thymidylate kinase;       
    1::179     1e-28  47%  211 aa  KTHY_ANAMF RecName: Full=Thymidylate kinase;       
    4::183     2e-28  40%  203 aa  KTHY_STAES RecName: Full=Thymidylate kinase;       
    4::183     2e-28  40%  203 aa  KTHY_STAEQ RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAAR RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAAN RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAAM RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAAC RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAAB RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAA9 RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAA8 RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAA3 RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAA2 RecName: Full=Thymidylate kinase;       
    4::190     2e-28  41%  205 aa  KTHY_STAA1 RecName: Full=Thymidylate kinase;       
   13::193     2e-28  47%  230 aa  KTHY_NITWN RecName: Full=Thymidylate kinase;       
    1::176     2e-28  43%  202 aa  KTHY_EHRCR RecName: Full=Thymidylate kinase;       
    1::123     2e-28  54%  209 aa  KTHY_DESMR RecName: Full=Thymidylate kinase;       
   27::207     3e-28  44%  234 aa  KTHY_RHIME RecName: Full=Thymidylate kinase;       
    4::206     3e-28  37%  213 aa  KTHY_CLOB8 RecName: Full=Thymidylate kinase;       
    1::202     3e-28  41%  210 aa  KTHY_ACTSZ RecName: Full=Thymidylate kinase;       
    1::206     3e-28  41%  212 aa  KTHY_YERE8 RecName: Full=Thymidylate kinase;       
    1::198     3e-28  39%  210 aa  KTHY_MAGSM RecName: Full=Thymidylate kinase;       
    1::206     3e-28  42%  213 aa  KTHY_EDWI9 RecName: Full=Thymidylate kinase;       
    2::196     4e-28  48%  208 aa  KTHY_THEGJ RecName: Full=Probable thymidylate kinase;       
    1::208     4e-28  37%  214 aa  KTHY_BRUSU RecName: Full=Thymidylate kinase;       
    8::207     7e-28  42%  209 aa  KTHY_SHEON RecName: Full=Thymidylate kinase;       
    1::208     7e-28  37%  214 aa  KTHY_BRUO2 RecName: Full=Thymidylate kinase;       
    1::208     7e-28  37%  214 aa  KTHY_BRUME RecName: Full=Thymidylate kinase;       
    1::208     7e-28  37%  214 aa  KTHY_BRUMB RecName: Full=Thymidylate kinase;       
    1::208     7e-28  37%  214 aa  KTHY_BRUA1 RecName: Full=Thymidylate kinase;       
    1::188     1e-27  39%  225 aa  KTHY_OCEIH RecName: Full=Thymidylate kinase;       
    1::208     1e-27  37%  214 aa  KTHY_BRUSI RecName: Full=Thymidylate kinase;       
    5::210     1e-27  43%  215 aa  KTHY_HALHL RecName: Full=Thymidylate kinase;       
    1::202     1e-27  41%  212 aa  KTHY_ENTS8 RecName: Full=Thymidylate kinase;       
    1::208     1e-27  37%  214 aa  KTHY_BRUC2 RecName: Full=Thymidylate kinase;       
    5::202     2e-27  42%  213 aa  KTHY_SALAR RecName: Full=Thymidylate kinase;       
    1::205     2e-27  42%  216 aa  KTHY_PROM3 RecName: Full=Thymidylate kinase;       
    1::192     2e-27  41%  216 aa  KTHY_PELTS RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPY RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPS RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPP RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPN RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPG RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPE RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPB RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERPA RecName: Full=Thymidylate kinase;       
    1::202     3e-27  41%  212 aa  KTHY_YERP3 RecName: Full=Thymidylate kinase;       
    5::202     3e-27  42%  213 aa  KTHY_SALTY RecName: Full=Thymidylate kinase;       
    5::202     3e-27  42%  213 aa  KTHY_SALTI RecName: Full=Thymidylate kinase;       
    5::202     3e-27  42%  213 aa  KTHY_SALSV RecName: Full=Thymidylate kinase;       
    5::202     3e-27  42%  213 aa  KTHY_SALDC RecName: Full=Thymidylate kinase;       
    7::203     3e-27  34%  203 aa  KTHY_RICM5 RecName: Full=Thymidylate kinase;       
    7::203     3e-27  35%  206 aa  KTHY_RICBR RecName: Full=Thymidylate kinase;       
    4::173     3e-27  44%  208 aa  KTHY_PSYWF RecName: Full=Thymidylate kinase;       
    1::190     3e-27  38%  199 aa  KTHY_NEOSM RecName: Full=Thymidylate kinase;       
    1::201     3e-27  42%  213 aa  KTHY_ECOL6 RecName: Full=Thymidylate kinase;       
    1::197     3e-27  42%  208 aa  KTHY_ACTPJ RecName: Full=Thymidylate kinase;       
    1::197     3e-27  42%  208 aa  KTHY_ACTP7 RecName: Full=Thymidylate kinase;       
    1::197     3e-27  42%  208 aa  KTHY_ACTP2 RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALPK RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALPC RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALPB RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALPA RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALNS RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALHS RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALG2 RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALEP RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALCH RecName: Full=Thymidylate kinase;       
    5::202     4e-27  42%  213 aa  KTHY_SALA4 RecName: Full=Thymidylate kinase;       
    7::203     4e-27  35%  203 aa  KTHY_RICCK RecName: Full=Thymidylate kinase;       
    7::203     4e-27  35%  206 aa  KTHY_RICB8 RecName: Full=Thymidylate kinase;       
    1::201     4e-27  42%  213 aa  KTHY_ECOUT RecName: Full=Thymidylate kinase;       
    1::201     4e-27  42%  213 aa  KTHY_ECOK1 RecName: Full=Thymidylate kinase;       
    1::201     4e-27  42%  213 aa  KTHY_ECO45 RecName: Full=Thymidylate kinase;       
    7::203     5e-27  34%  203 aa  KTHY_RICAE RecName: Full=Thymidylate kinase;       
    1::192     5e-27  42%  205 aa  KTHY_METMJ RecName: Full=Probable thymidylate kinase;       
    6::212     6e-27  41%  215 aa  KTHY_SHEFN RecName: Full=Thymidylate kinase;       
    7::203     6e-27  35%  203 aa  KTHY_RICAH RecName: Full=Thymidylate kinase;       
    1::192     6e-27  37%  213 aa  KTHY_MYCCT RecName: Full=Thymidylate kinase;       
    7::203     8e-27  34%  203 aa  KTHY_RICPR RecName: Full=Thymidylate kinase;       
   47::229     8e-27  38%  245 aa  KTHY_RHOBA RecName: Full=Thymidylate kinase;       
   13::193     8e-27  42%  228 aa  KTHY_OLICO RecName: Full=Thymidylate kinase;       
    1::192     8e-27  37%  213 aa  KTHY_MYCMS RecName: Full=Thymidylate kinase;       
    1::185     8e-27  40%  211 aa  KTHY_MYCHJ RecName: Full=Thymidylate kinase;       
    1::185     8e-27  40%  211 aa  KTHY_MYCH2 RecName: Full=Thymidylate kinase;       
    4::200     8e-27  38%  204 aa  KTHY_FRAP2 RecName: Full=Thymidylate kinase;       
    1::188     8e-27  45%  219 aa  KTHY_ERWCT RecName: Full=Thymidylate kinase;       
    7::203     1e-26  34%  203 aa  KTHY_RICPU RecName: Full=Thymidylate kinase;       
    8::205     1e-26  42%  210 aa  KTHY_SHELP RecName: Full=Thymidylate kinase;       
    7::203     1e-26  33%  203 aa  KTHY_RICRS RecName: Full=Thymidylate kinase;       
    7::203     1e-26  33%  203 aa  KTHY_RICRO RecName: Full=Thymidylate kinase;       
    7::203     1e-26  33%  203 aa  KTHY_RICCN RecName: Full=Thymidylate kinase;       
    1::141     1e-26  49%  211 aa  KTHY_PROM1 RecName: Full=Thymidylate kinase;       
    4::202     1e-26  36%  212 aa  KTHY_LEGPC RecName: Full=Thymidylate kinase;       
    1::174     1e-26  40%  206 aa  KTHY_CALS8 RecName: Full=Thymidylate kinase;       
    1::176     2e-26  38%  199 aa  KTHY_THEM4 RecName: Full=Thymidylate kinase;       
    7::203     2e-26  34%  203 aa  KTHY_RICTY RecName: Full=Thymidylate kinase;       
    7::203     2e-26  34%  206 aa  KTHY_RICFE RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOSM RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECO7I RecName: Full=Thymidylate kinase;       
    4::171     2e-26  46%  226 aa  KTHY_VEREI RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_SHISS RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_SHIFL RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_SHIF8 RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_SHIDS RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_SHIBS RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_SHIB3 RecName: Full=Thymidylate kinase;       
    1::141     2e-26  48%  211 aa  KTHY_PROMT RecName: Full=Thymidylate kinase;       
    1::185     2e-26  39%  211 aa  KTHY_MYCH7 RecName: Full=Thymidylate kinase;       
    4::202     2e-26  36%  212 aa  KTHY_LEGPH RecName: Full=Thymidylate kinase;       
    1::190     2e-26  42%  210 aa  KTHY_ERWT9 RecName: Full=Thymidylate kinase;       
    1::172     2e-26  41%  202 aa  KTHY_EHRCJ RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOSE RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOLU RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOLI RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOLC RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOL5 RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOHS RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECODH RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECOBW RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECO8A RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECO81 RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECO55 RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECO27 RecName: Full=Thymidylate kinase;       
    1::201     2e-26  41%  213 aa  KTHY_ECO24 RecName: Full=Thymidylate kinase;       
    1::201     3e-26  41%  213 aa  KTHY_ECO5E RecName: Full=Thymidylate kinase;       
    1::201     3e-26  41%  213 aa  KTHY_ECO57 RecName: Full=Thymidylate kinase;       
    4::202     4e-26  36%  212 aa  KTHY_LEGPL RecName: Full=Thymidylate kinase;       
    5::201     4e-26  41%  213 aa  KTHY_CITK8 RecName: Full=Thymidylate kinase;       
    4::200     4e-26  41%  213 aa  KTHY_AERHH RecName: Full=Thymidylate kinase;       
    2::207     7e-26  38%  210 aa  KTHY_VIBPA RecName: Full=Thymidylate kinase;       
    5::201     7e-26  41%  213 aa  KTHY_ENT38 RecName: Full=Thymidylate kinase;       
    1::198     9e-26  42%  219 aa  KTHY_PECCP RecName: Full=Thymidylate kinase;       
    4::202     9e-26  36%  212 aa  KTHY_LEGPA RecName: Full=Thymidylate kinase;       
    1::189     9e-26  39%  203 aa  KTHY_FINM2 RecName: Full=Thymidylate kinase;       
    1::178     9e-26  42%  219 aa  KTHY_ANAPZ RecName: Full=Thymidylate kinase;       
   14::213     1e-25  42%  234 aa  KTHY_MYCPU RecName: Full=Thymidylate kinase;       
    2::197     1e-25  36%  221 aa  KTHY_LACPL RecName: Full=Thymidylate kinase;       
    1::208     1e-25  40%  210 aa  KTHY_HAMD5 RecName: Full=Thymidylate kinase;       
    4::203     1e-25  41%  210 aa  KTHY_HAES1 RecName: Full=Thymidylate kinase;       
    1::193     2e-25  41%  206 aa  KTHY_METHJ RecName: Full=Probable thymidylate kinase;       
    1::191     2e-25  40%  201 aa  KTHY_METBU RecName: Full=Probable thymidylate kinase;       
    1::204     2e-25  38%  205 aa  KTHY_IDILO RecName: Full=Thymidylate kinase;       
    1::197     2e-25  40%  208 aa  KTHY_HAEPS RecName: Full=Thymidylate kinase;       
    1::194     2e-25  39%  212 aa  KTHY_PHOLL RecName: Full=Thymidylate kinase;       
    1::206     3e-25  38%  212 aa  KTHY_VIBCM RecName: Full=Thymidylate kinase;       
    1::206     3e-25  38%  212 aa  KTHY_VIBCH RecName: Full=Thymidylate kinase;       
    1::206     3e-25  38%  212 aa  KTHY_VIBC3 RecName: Full=Thymidylate kinase;       
    5::151     3e-25  43%  208 aa  KTHY_BORPE RecName: Full=Thymidylate kinase;       
    5::151     3e-25  43%  208 aa  KTHY_BORPA RecName: Full=Thymidylate kinase;       
    5::151     3e-25  43%  208 aa  KTHY_BORBR RecName: Full=Thymidylate kinase;       
    4::203     3e-25  40%  210 aa  KTHY_HAES2 RecName: Full=Thymidylate kinase;       
    1::202     4e-25  41%  213 aa  KTHY_SODGM RecName: Full=Thymidylate kinase;       
    4::206     4e-25  38%  209 aa  KTHY_PASMU RecName: Full=Thymidylate kinase;       
    7::193     4e-25  41%  214 aa  KTHY_BDEBA RecName: Full=Thymidylate kinase;       
    1::188     6e-25  39%  209 aa  KTHY_MYCMO RecName: Full=Thymidylate kinase;       
    5::190     6e-25  42%  213 aa  KTHY_ESCF3 RecName: Full=Thymidylate kinase;       
    1::196     6e-25  36%  204 aa  KTHY_DECAR RecName: Full=Thymidylate kinase;       
    5::201     8e-25  38%  208 aa  KTHY_PSEHT RecName: Full=Thymidylate kinase;       
    1::192     8e-25  39%  222 aa  KTHY_ALTMD RecName: Full=Thymidylate kinase;       
    1::193     1e-24  39%  215 aa  KTHY_MYCAP RecName: Full=Thymidylate kinase;       
    1::191     1e-24  41%  195 aa  KTHY_HALMA RecName: Full=Probable thymidylate kinase;       
    5::192     1e-24  38%  207 aa  KTHY_BORPD RecName: Full=Thymidylate kinase;       
    5::206     1e-24  39%  214 aa  KTHY_MANSM RecName: Full=Thymidylate kinase;       
    1::202     2e-24  39%  210 aa  KTHY_HAEIG RecName: Full=Thymidylate kinase;       
    2::182     2e-24  40%  212 aa  KTHY_BUCBP RecName: Full=Thymidylate kinase;       
    1::208     2e-24  39%  208 aa  KTHY_SPHWW RecName: Full=Thymidylate kinase;       
    2::207     3e-24  38%  210 aa  KTHY_VIBHB RecName: Full=Thymidylate kinase;       
    8::207     8e-24  39%  209 aa  KTHY_SHESA RecName: Full=Thymidylate kinase;       
    1::202     1e-23  37%  210 aa  KTHY_HAEIN RecName: Full=Thymidylate kinase;       
    4::197     1e-23  40%  210 aa  KTHY_VIBFM RecName: Full=Thymidylate kinase;       
    1::205     1e-23  35%  205 aa  KTHY_TERTT RecName: Full=Thymidylate kinase;       
   13::216     1e-23  38%  230 aa  KTHY_RHOPA RecName: Full=Thymidylate kinase;       
    6::203     2e-23  37%  212 aa  KTHY_VIBVY RecName: Full=Thymidylate kinase;       
    6::203     2e-23  37%  212 aa  KTHY_VIBVU RecName: Full=Thymidylate kinase;       
    4::197     2e-23  40%  210 aa  KTHY_VIBF1 RecName: Full=Thymidylate kinase;       
    4::187     2e-23  39%  212 aa  KTHY_COLP3 RecName: Full=Thymidylate kinase;       
    4::201     2e-23  39%  210 aa  KTHY_ALISL RecName: Full=Thymidylate kinase;       
    3::178     3e-23  43%  192 aa  KTHY_PYRAE RecName: Full=Probable thymidylate kinase;       
   13::216     4e-23  37%  230 aa  KTHY_RHOPT RecName: Full=Thymidylate kinase;       
    4::175     4e-23  39%  210 aa  KTHY_MYCGE RecName: Full=Thymidylate kinase;       
    1::203     4e-23  38%  212 aa  KTHY_BAUCH RecName: Full=Thymidylate kinase;       
    1::199     7e-23  39%  212 aa  KTHY_SERP5 RecName: Full=Thymidylate kinase;       
    1::195     7e-23  40%  198 aa  KTHY_METLZ RecName: Full=Probable thymidylate kinase;       
    1::202     7e-23  38%  211 aa  KTHY_BLOFL RecName: Full=Thymidylate kinase;       
    7::174     1e-22  37%  213 aa  KTHY_MYCGA RecName: Full=Thymidylate kinase;       
    1::202     2e-22  38%  210 aa  KTHY_HAEIE RecName: Full=Thymidylate kinase;       
    6::226     8e-22  38%  234 aa  KTHY_WIGBR RecName: Full=Thymidylate kinase;       
    1::174     1e-21  39%  196 aa  KTHY_NATPD RecName: Full=Probable thymidylate kinase;       
    1::202     2e-21  35%  209 aa  KTHY_PHOPR RecName: Full=Thymidylate kinase;       
    3::178     2e-21  40%  205 aa  KTHY_CALMQ RecName: Full=Probable thymidylate kinase;       
    7::203     5e-21  32%  217 aa  KTHY_ORITI RecName: Full=Thymidylate kinase;       
    7::203     5e-21  32%  217 aa  KTHY_ORITB RecName: Full=Thymidylate kinase;       
    1::175     5e-21  43%  199 aa  KTHY_HALSA RecName: Full=Probable thymidylate kinase;       
    1::175     5e-21  43%  199 aa  KTHY_HALS3 RecName: Full=Probable thymidylate kinase;       
    1::195     1e-20  38%  197 aa  KTHY_HALLT RecName: Full=Probable thymidylate kinase;       
    4::175     1e-20  39%  190 aa  KTHY1_SULTO RecName: Full=Probable thymidylate kinase;       
    1::185     2e-20  34%  191 aa  KTHY_SULDN RecName: Full=Thymidylate kinase;       
    4::173     2e-20  44%  196 aa  KTHY_METS5 RecName: Full=Probable thymidylate kinase;       
    4::148     3e-20  41%  210 aa  KTHY_MYCPN RecName: Full=Thymidylate kinase;       
    1::140     3e-20  38%  203 aa  KTHY_BRAHW RecName: Full=Thymidylate kinase;       
    5::184     1e-19  40%  188 aa  KTHY_METJA RecName: Full=Probable thymidylate kinase;       
    1::171     2e-19  36%  196 aa  KTHY_ARCFU RecName: Full=Probable thymidylate kinase;       
    5::143     3e-19  40%  202 aa  KTHY_DESPS RecName: Full=Thymidylate kinase;       
    6::173     3e-19  37%  212 aa  KTHY_BUCAP RecName: Full=Thymidylate kinase;       
    9::108     6e-19  48%  227 aa  KTHY_XANCP RecName: Full=Thymidylate kinase;       
    9::108     6e-19  48%  227 aa  KTHY_XANCB RecName: Full=Thymidylate kinase;       
    9::108     6e-19  48%  227 aa  KTHY_XANC8 RecName: Full=Thymidylate kinase;       
   16::220     8e-19  30%  230 aa  KTHY_UREPA RecName: Full=Thymidylate kinase;       
   16::220     8e-19  30%  230 aa  KTHY_UREP2 RecName: Full=Thymidylate kinase;       
    6::207     1e-18  34%  214 aa  KTHY_MYCPE RecName: Full=Thymidylate kinase;       
    1::195     3e-18  31%  195 aa  KTHY_HELHP RecName: Full=Thymidylate kinase;       
    9::127     2e-17  42%  217 aa  KTHY_XYLF2 RecName: Full=Thymidylate kinase;       
    1::178     2e-17  37%  190 aa  KTHY_WOLSU RecName: Full=Thymidylate kinase;       
    1::143     3e-17  38%  191 aa  KTHY_HELPG RecName: Full=Thymidylate kinase;       
    9::120     4e-17  43%  217 aa  KTHY_XYLFM RecName: Full=Thymidylate kinase;       
    1::118     8e-17  41%  208 aa  KTHY_XYLFT RecName: Full=Thymidylate kinase;       
    1::163     8e-17  37%  191 aa  KTHY_HELAH RecName: Full=Thymidylate kinase;       
    9::201     8e-17  33%  206 aa  KTHY_AKKM8 RecName: Full=Thymidylate kinase;       
    1::143     1e-16  38%  191 aa  KTHY_HELP2 RecName: Full=Thymidylate kinase;       
    1::188     2e-16  33%  191 aa  KTHY_HELPY RecName: Full=Thymidylate kinase;       
    6::199     2e-16  34%  212 aa  KTHY_BUCAI RecName: Full=Thymidylate kinase;       
    4::175     2e-16  37%  199 aa  KTHY_METMP RecName: Full=Probable thymidylate kinase;       
    5::176     2e-16  37%  189 aa  KTHY1_SULSO RecName: Full=Probable thymidylate kinase 1;       
    1::111     3e-16  42%  208 aa  KTHY_XYLFA RecName: Full=Thymidylate kinase;       
    1::187     5e-16  34%  191 aa  KTHY_HELPH RecName: Full=Thymidylate kinase;       
    4::169     5e-16  41%  208 aa  KTHY_AERPE RecName: Full=Putative thymidylate kinase;       
    1::186     8e-16  34%  189 aa  KTHY_ARCB4 RecName: Full=Thymidylate kinase;       
    6::190     1e-15  35%  199 aa  KTHY_STAMF RecName: Full=Probable thymidylate kinase;       
    1::187     2e-15  33%  191 aa  KTHY_HELPS RecName: Full=Thymidylate kinase;       
    4::162     5e-15  37%  194 aa  KTHY_SULAC RecName: Full=Probable thymidylate kinase;       
    1::97      5e-15  42%  191 aa  KTHY_HELPJ RecName: Full=Thymidylate kinase;       
    4::209     5e-15  32%  213 aa  KTHY2_SULTO RecName: Full=Probable thymidylate kinase;       
    7::202     7e-15  38%  208 aa  KTHY_TREPA RecName: Full=Putative thymidylate kinase;       
    1::179     2e-14  30%  194 aa  KTHY_NAUPA RecName: Full=Thymidylate kinase;       
    1::182     5e-14  33%  195 aa  KTHY_METST RecName: Full=Probable thymidylate kinase;       
    7::198     1e-13  32%  205 aa  KTHY_LEPBL RecName: Full=Thymidylate kinase;       
    7::198     1e-13  32%  205 aa  KTHY_LEPBJ RecName: Full=Thymidylate kinase;       
    1::197     1e-13  32%  213 aa  KTHY2_SULSO RecName: Full=Probable thymidylate kinase 2;       
    1::190     2e-13  34%  191 aa  KTHY_SULNB RecName: Full=Thymidylate kinase;       
    1::184     2e-13  38%  194 aa  KTHY_METTH RecName: Full=Probable thymidylate kinase;       
    9::120     4e-13  40%  226 aa  KTHY_XANC5 RecName: Full=Thymidylate kinase;       
    9::120     4e-13  40%  227 aa  KTHY_XANAC RecName: Full=Thymidylate kinase;       
    1::212     4e-13  37%  212 aa  KTHY_SYNY3 RecName: Full=Thymidylate kinase;       
    2::175     4e-13  38%  194 aa  KTHY_METKA RecName: Full=Probable thymidylate kinase;       
    7::151     7e-13  39%  204 aa  KTHY_LEPIN RecName: Full=Thymidylate kinase;       
    7::151     7e-13  39%  204 aa  KTHY_LEPIC RecName: Full=Thymidylate kinase;       
    1::182     7e-13  34%  194 aa  KTHY_CAMC5 RecName: Full=Thymidylate kinase;       
    1::94      7e-13  48%  195 aa  KTHY_CAMC1 RecName: Full=Thymidylate kinase;       
    9::121     9e-13  39%  227 aa  KTHY_XANOR RecName: Full=Thymidylate kinase;       
    9::121     9e-13  39%  227 aa  KTHY_XANOP RecName: Full=Thymidylate kinase;       
    9::121     9e-13  39%  227 aa  KTHY_XANOM RecName: Full=Thymidylate kinase;       
    1::137     2e-12  37%  190 aa  KTHY_THEVO RecName: Full=Probable thymidylate kinase;       
    4::128     3e-12  40%  198 aa  KTHY_METVS RecName: Full=Probable thymidylate kinase;       
    4::175     3e-12  35%  199 aa  KTHY_METM7 RecName: Full=Probable thymidylate kinase;       
    4::175     4e-12  34%  199 aa  KTHY_METM6 RecName: Full=Probable thymidylate kinase;       
    1::137     1e-11  34%  193 aa  KTHY_THEAC RecName: Full=Probable thymidylate kinase;       
    8::153     2e-11  39%  218 aa  KTHY_CAEEL RecName: Full=Probable thymidylate kinase;       
    1::94      8e-11  46%  192 aa  KTHY_CAMFF RecName: Full=Thymidylate kinase;       
    1::95      1e-10  43%  195 aa  KTHY_CAMHC RecName: Full=Thymidylate kinase;       
    4::154     1e-10  34%  196 aa  KTHY_META3 RecName: Full=Probable thymidylate kinase;       
    6::143     1e-10  36%  212 aa  KTHY_HUMAN RecName: Full=Thymidylate kinase;       
    6::119     5e-10  38%  212 aa  KTHY_MOUSE RecName: Full=Thymidylate kinase;       
    1::184     2e-09  31%  192 aa  KTHY_METS3 RecName: Full=Probable thymidylate kinase;       
    7::190     2e-09  34%  210 aa  KTHY_SCHPO RecName: Full=Thymidylate kinase;       
    1::94      3e-09  40%  192 aa  KTHY_CAMJD RecName: Full=Thymidylate kinase;       
    1::94      3e-09  40%  192 aa  KTHY_CAMJ8 RecName: Full=Thymidylate kinase;       
    7::136     3e-09  39%  202 aa  KTHY_PICTO RecName: Full=Probable thymidylate kinase;       
    1::154     4e-09  32%  194 aa  KTHY_CAMLR RecName: Full=Thymidylate kinase;       
    1::94      4e-09  39%  192 aa  KTHY_CAMJJ RecName: Full=Thymidylate kinase;       
    1::94      6e-09  39%  192 aa  KTHY_CAMJR RecName: Full=Thymidylate kinase;       
    1::94      6e-09  39%  192 aa  KTHY_CAMJE RecName: Full=Thymidylate kinase;       
    4::87      1e-08  46%  199 aa  KTHY_METM5 RecName: Full=Probable thymidylate kinase;       
   19::177     1e-08  35%  222 aa  KTHY_DICDI RecName: Full=Thymidylate kinase;       
    5::132     2e-08  40%  216 aa  KTHY_YEAST RecName: Full=Thymidylate kinase;       
    1::102     2e-07  38%  240 aa  KTHY_ASFB7 RecName: Full=Thymidylate kinase;       
    1::124     2e-07  38%  239 aa  KTHY_ASFWA RecName: Full=Thymidylate kinase;       
    1::170     5e-07  33%  214 aa  KTHY_MYCTU RecName: Full=Thymidylate kinase;       
    1::102     4e-06  36%  239 aa  KTHY_ASFP4 RecName: Full=Thymidylate kinase;       
    1::102     2e-05  35%  235 aa  KTHY_ASFK5 RecName: Full=Thymidylate kinase;       
   14::161     2e-05  31%  213 aa  KTHY_IIV6 RecName: Full=Putative thymidylate kinase 251L;       
   36::78      3e-04  47%  373 aa  POTA_MANSM RecName: Full=Spermidine/putrescine import ATP-binding
   23::158     3e-04  30%  816 aa  ADA15_RAT RecName: Full=Disintegrin and metalloproteinase
  224::254     4e-04  48%  421 aa  FTSY_NEIMC RecName: Full=Cell division protein ftsY homolog;
  224::254     4e-04  48%  421 aa  FTSY_NEIMB RecName: Full=Cell division protein ftsY homolog;
  224::254     4e-04  48%  421 aa  FTSY_NEIMA RecName: Full=Cell division protein ftsY homolog;
  220::250     4e-04  48%  416 aa  FTSY_NEIGO RecName: Full=Cell division protein ftsY homolog;
   64::120     6e-04  35%  291 aa  SSUB_RALME RecName: Full=Aliphatic sulfonates import ATP-binding
    4::122     6e-04  34%  204 aa  KTHY_VACCW RecName: Full=Thymidylate kinase;       
    4::122     6e-04  34%  204 aa  KTHY_VACCT RecName: Full=Thymidylate kinase;       
    4::122     6e-04  34%  204 aa  KTHY_VACCC RecName: Full=Thymidylate kinase;       
    4::122     6e-04  34%  204 aa  KTHY_VACCA RecName: Full=Thymidylate kinase;       
   99::133     7e-04  54%  525 aa  SRP54_MYCTU RecName: Full=Signal recognition particle
   99::133     7e-04  54%  525 aa  SRP54_MYCBO RecName: Full=Signal recognition particle
   11::147     7e-04  39%  226 aa  KGUA_ANADE RecName: Full=Guanylate kinase;       
    1::198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
KTHY_THET8      MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
KTHY_THET2      MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
KTHY_SYNJB      ---MFITLEGGEGVGKTTQQALLVERLRQEGYACLCTREPGGTAKTLRELLLHGDFSPLAELLLYAADRA
KTHY_BIFLI      MSGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTVKAIRQLLLAVDIAPRAEALLFAADRA
KTHY_SYNJA      ---MFITLEGGEGVGKTTQQALLAERLQREGYACVSTREPGGALGELRELLLHGDLTPLAELLLYAADRA
KTHY_BIFLD      MSGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTAKAIRQLLLAVDIAPRAEALLFAADRA
KTHY_DESOH      ---MFITLEGIEGAGKTTQLPRLVDFLEQHGHTCVVTREPGGGMGQIRSLLLNSDMSPETELFLYAADRA
KTHY_BIFLO      MNGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTAKAIRQLLLAVDIAPRAEALLFAADRA
KTHY_CARHZ      MRGKFITIEGVEGSGKTTQIQYIARYLTEKNIPHIITREPGGTAKKIRELLLNPSVVPEAEILLYLADRA
KTHY_CHLP8      ---MLITFEGIDGAGKSTQVVKLKRHLQERGREVLTLREPGGTAEQIRELLLESDITSIAELLLFSASRA
KTHY_CHLCH      ---MLITFEGIDGAGKSTQVAKLVAYLKQQSTPLLSLREPGGTAESIRSLLLDKSITPIAELLLFSASRA
KTHY_BIFAA      MQGTFISFEGVDGVGKTTQVERLRAYVESQGRECVVTREPGGTAVAIRKMLLCADIAPRTEALLFAADRA
KTHY_PELLD      ---MLITFEGIDGAGKSTQIQKLAAYLKQEGREVLTLREPGGTAEKIRHILLESDITPVGELLLFSASRA
KTHY_SYMTH      ---VFISFEGVDGSGKSTQIRLLLQYLDEQSVPYVFTREPGGTAEQIRRVLLNRGMSVITEALLFAAARA
KTHY_PELCD      ----FISLEGIEGSGKTTQIKRLADRLESLGHAVLITREPGGCADQIRQILLHPDLDPKAELLLYAAARA
KTHY_KOSOT      ---MFISFEGIDGSGKSTQVALFREYLERNSMEYVFIREPGGTQADIREILLHNELFPETELLLFMASRA
KTHY_PROVI      ---MLITFEGIDGAGKSTQIRKLAAHLRSQGQEVLTLREPGGTAENIRLILLESDITPVGELLLFSASRA
KTHY_DINSH      -PGRLISFEGIDGSGKSTQARRLAEHLRDTGRDPLLTREPGGGAEDIRRLLVPDRWSPETELLLFTAARR
KTHY_RHOSK      --GFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGG-TPEIRGLVLAEAWDPMAELLLMTAARV
KTHY_DESVH      ---MFITFEGIEGSGKSTALQGLAAWLQQRGHGVAVTREPGGSRRTLRSILLNTDITPEAELFLYLADRA
KTHY_HALOH      MRGLFITLEGIEGSGKSTQIEMLYKRLKKDGFDVIITREPGGTPKEIRKLLLDPDMGAKAEFLLYAADRA
KTHY_DESVV      ---MFITFEGIEGSGKSTALQGLAAWLQQHGHGVAVTREPGGSRRTLRSILLNTDITPEAELFLYLADRA
KTHY_DESVM      ---MFITFEGMEGSGKSTALNRVQQVLLDAGHGVLLTREPGGSRRTLRSILLNDDIVPEAELFLYLADRA
KTHY_GEOUR      --GCFITFEGVEGCGKTTQIKLLAQHLTEQGHTVIVTREPGGCADQARAILLDADMTPTTELLLYAAARA
KTHY_DESRM      ---IFIVFEGVDGSGKSTQLNLLNKYLSQKEIKTICTREPGGTPEKIRELLLDPEIQDRTEALLYSAARA
KTHY_DESAD      ---MFITFEGIEGTGKTTQIKKLTAFLEESGHNVDVTLEPGGSRKELRKILLNMDITGECELFLYLADRA
KTHY_RHOS4      --GFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGG-TPEIRGLVLAEAWDPMAELLLMTAARV
KTHY_RHOS1      --GFFLAVEGIDGSGKSGIVRSLAAHLGAEGRDVLVTREPGG-TPEIRGLVLAEAWDPMAELLLMTAARV
KTHY_SULSY      --GFFITFEGIEASGKTTQINLLYDYLKSIGKNVIKTREPGGTKQKIREILLSKEKFPYAELLLYESDRN
KTHY_THERP      ----FITFEGPEGAGKTTQCALLAARLREAGYSLLVTREPGGTLGEIREWLLAGELRPETEALLFTAARA
KTHY_DEIRA      --GLFITLEGPEGAGKTTQXXXXXXXXXXXGHAVTVTREPGGTPTRVREVVLDPEIEPLGEFLLYSASRA
KTHY_PROA2      ---MFITFEGIDGAGKSTQVKMLRKLLISKGLEVLTLREPGGTSESIRDILLENDITPIGELLLFAASRA
KTHY_PELPB      ---MLITFEGIDGAGKSTQIKELVHALGLQGIEAVVLREPGGTTEKIRQILLESSITPVGELLLFSASRA
KTHY_METCA      -PGKFITLEGGEGVGKSTNVDFVVSRLRARGLKVVATREPGGTAEAVREIFLRQDVRPEAELLLLFAARV
KTHY_THETN      MRGKFISFEGIDGCGKTTQVKLLEEHLKKEGYDLLVLREPGGTREKVREILLDREIFPVTEMLLYASSRA
KTHY_HERA2      ---LFITFEGPEGSGKSTQARYLKDYLQQAGYPVILTREPGGTSDAVRRLVLDGQMEPTTETLLFAAARA
KTHY_GEOSF      --GCFITFEGIEGCGKTTQIKLLEQHLAEKGFKVLLTREPGGCADQIRAILLNSAMTPSAELLLYAAARA
KTHY_CHLTE      ---MLISFEGIDGAGKSTQVMKLKRYLQERGREVLALREPGGXXXXXXXXXXXNDITPVGELLLFAASRA
KTHY_COXBU      --GRFISFEGIEGVGKTTALNWVREQLDAARIPYVVTREPGGTAEAIRDVLLSHSMCPDTELLLMFAGRA
KTHY_GLOVI      ---MFITFEGGEGCGKTTQLTLLGDWLEKRCHRVVRTREPGGTARSLRGLLLDSEITPTAELLLYATDRA
KTHY_THEMA      ---MFITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETKIRKILLEEEVTPKAELFLFLASRN
KTHY_METFK      MRGRFITLEGMDGAGKSSHIESIVSVLEGRGLEVVSTREPGGTPEKLRELLLHERMHVETETLLMFAARR
KTHY_DESDG      ---MFITFEGIEGSGKSTALARLKDWLQEHGHGATLTREPGGSRLGLRSILLNDDLTGETELFLYLADRS
KTHY_PSEFS      MTGLFITLEGPEGAGKSTNRDYLAERLRSEGIEVVLTREPGGTAERIREVLLAEQMNPDTELLLVFAARA
KTHY_LACAC      MKGYFVSFEGPDGAGKSTVLKEVLAEIAPQLKTYLVTREPGGSAEKIRDIILNDKMDPKTEALLYAAARS
KTHY_ROSS1      ---LFVTFEGPEGSGKSTQARLLYESLHARRFPVILTREPGGTRDLIRRIVLDTEMAPTAEMLLFSAARA
KTHY_DEHE1      ---LFITFEGGEGCGKSTQSKALYRYLKKLGLGCVLTHEPGGGDKITRLLKWSEEISPLAELFLFNASRS
KTHY_ROSCS      ---LFVTFEGPEGSGKSTQARLLYESLYARRYPVILTREPGGTRDLIRRIVLDTEMAPTTETLLFSAARA
KTHY_RALPJ      MTGKFITFEGIDGAGKSTHAQQLQAKLAPLGKKVVVTREPGGTPERLREVLLHERMHLETEALLMFASRR
KTHY_THIDA      LPGKFITLEGVDGAGKSTHVGFVAEWLRGQGREVIVTREPGGALGELRELLLHREMAADTELLLMFAARQ
KTHY_THESQ      ---MFITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETKIRKILLEEEVTPKAELFLFLASRN
KTHY_THEEB      --GLFIVLEGGEGAGKTTQMGAIATWLENSGPPLLLTREPGGTPQGLRQLLLHSDLAPLAELLLYAADRA
KTHY_EXIS2      MTGTFITVEGPDGAGKTTQLQLLADRLTAEGYEIVMTREPGGTRNEIRSLILNQEMDEMTEILLYAASRA
KTHY_DEHSB      ---LFITFEGGEGCGKSTQSKALYRYLKKKGLGCVLTHEPGGGDKITRLLKWSKEISPLTELLLFNASRS
KTHY_THEPX      MKGKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKEKVRDILLDKNISPVTEMLLYASSRA
KTHY_THEP3      MKGKFISFEGIDGCGKTTQIKFLEEYLLKQGYNILVLREPGGTKEKVRDILLDKNISPVTEMLLYASSRA
KTHY_STRPS      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVKVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_RALSO      MTGKFITFEGIDGAGKSTHAQQLEARLAPQGRKVVVTREPGGTPERLREVLLHERMHLETEALLMFASRR
KTHY_PSE14      MTGLFITLEGPEGAGKSTNREYLAAQLRAQGVQVLLTREPGGTAERIRELLLAEAMSADTELLLVFAARA
KTHY_GEOSW      MKGRFFSFEGPDGAGKTTMITKLESFLREKGFDVLLTREPGGVAEEIRSIILNPEMDGRTEALLYAAARR
KTHY_NITMU      MRGKFITLEGIDGAGKTTHLRWLEYFLKERGKNVMVTREPGGTLGELRDILLDQTMHAETEALLMFAARR
KTHY_THEP1      ---MFITFEGIDGSGKSTQIKLLARYLEKRGKRVILKREPGGTETKIRKLLLKEEMTPKAELFLFLASRN
KTHY_STRPI      --GFLVSLEGPEGAGKTSVLEALLPILEVKGVKVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_STRGC      --GLLVSLEGPDGAGKSSVLEALVPILEAQGHQVVTTREPGG-VPAIREVILDQEMDGKTELLLYIASRR
KTHY_DEHSC      ---LFITFEGGEGCGKSTQSKALYRYLKKLGLGCVLTHEPGGGDKITRLLKWSKEISPLTELLLFNASRS
KTHY_BURCM      --GKFITFEGIDGAGKTTHLQRLQAKLAAGGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_BURA4      --GKFITFEGIDGAGKTTHLQRLQAKLAAGGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_SYNR3      MRGRFLVLEGIDGCGKTTQLKALADWLPASGAQLITTREPGGTAQALRQLLLPEEQAPRAELLLYAADRA
KTHY_BURTA      --GKFITFEGIDGAGKTTHLQRLQERLGPAGRHVVVTREPGGTRETLREILLNQPMDLETEALLMFAGRR
KTHY_BURCH      --GKFITFEGIDGAGKTTHLQRLQGRLAAAGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_BURCC      --GKFITFEGIDGAGKTTHLQRLQGRLAAAGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_BURCA      --GKFITFEGIDGAGKTTHLQRLQGRLAAAGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_STRZP      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVKVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_STRZJ      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_STRPN      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_STRP7      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_STRP4      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_CHLL2      ---MLITFEGIDGAGKSTQIRKLQKLLIGAHIDSITLREPGGTAEKIRQILLESEISPIGELLLFSASRA
KTHY_STRR6      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_STRP2      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_JANSC      MPPLFISLEGIDGSGKSTQTARLVDWLRVRGRDPLQTREPGGGAEEIRRLLVPDRWSAETEILLFTAARR
KTHY_ANAVT      MGGRFIVFEGVEGCGKTSQMQLCAEWLQNLGISVILTREPGGGVDLRRLLLQKAEDKPIAEVLLYAADRA
KTHY_STRZT      --GFLVSLEGPEGAGKTSVLEALLPILEEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_SILPO      --GLFLTFEGIDGSGKSTQARLLAETLRAAGHDVVLTREPGGGAEEIRRLVLPDRWSAETEILLFTAARR
KTHY_COPPD      ---MFIVVEGIDGCGKSTVASLLAAEI-GKKRPVFHTFEPGDGL--YRELIMENVDNPFVVAALFTIDRA
KTHY_CLAMS      MTGVFITLEGGDGVGKSTQSALLREWLEEQGHEVVVTREPGGSDQEIREIVLHRRIAPRAEALLYAADRA
KTHY_BURS3      --GKFITFEGIDGAGKTTHLQRLQGKLAAAGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_BURCJ      --GKFITFEGIDGAGKTTHCERLQGRLAAAGRQVVVTREPGGTQEKLREILLNQPMDLETEALLMFAARR
KTHY_STRPJ      --GFLVSLEGPEGAGKTSVLEALLPILKEKGVEVLTTREPGGVLEKIREVILDPQMDAKTELLLYIASRR
KTHY_PSEU2      MTGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTAERVRELLLAEAMSADTELLLVFAARA
KTHY_DESAP      MSGVFIVFEGIDGAGKTTQLAYLEALLSMRNHRVLVTREPGGTREAVRRVLLNSEMTGETEALLYAAARS
KTHY_CHLPD      ---MLITFEGIDGAGKSTQIKKLQTVLNKAGVESVTLREPGGTAEKIRSILLESEISAVGELLLFSATRA
KTHY_LACLM      MNGILISLEGPDGAGKTTVLQEILPEIQKMKREVVPTREPGGVAEEIRQIILNTEIDSKTELMLFAAARR
KTHY_GEOLS      ---MFITFEGIEGCGKSTXXXXXXXXXXXXXXRVLLTREPGGCADQIRSVLLNTALVPMAELMLYAASRA
KTHY_LACH4      MRGYFVSFEGPDGAGKSTVLKEVLDQIGPKLKPYLVTREPGGSAEKIRDIILNDKMDAKTEALLYAAARS
KTHY_EXISA      MSGMFITVEGPDGSGKSTQLQLLVENLKQKGYDIVVTREPGGTTVQIREVLLSHEMTPRVEMMLYAASRA
KTHY_CHRVO      --GRFITLEGIDGAGKSTHLSFIRDWLARHGVDAAFTREPGGTSEKIRDLLLDPGTSLDAEALLAFAARQ
KTHY_BURVG      --GKFITFEGIDGAGKTTHLQRLQAKLAAGDRQVVVTREPGGTLGELREMLLNQPMDLETEALLMFAARR
KTHY_PSEPF      MTGLFITLEGPEGAGKSTNREYLAERLRAAGIEVVLTREPGGTAERIREVLLAEVMNPDTELLLVFAARA
KTHY_PELPD      --GYFITFEGIEGSGKTTQIGLLGEQLESLGYSVVMTREPGGCADKIRSILLDADISPMTELLLYAAARA
KTHY_STRP3      --GKLITVEGPDGAGKTTVLEQLIPLLKQKAQEILTTREPGGAISEIRELILDTTMDPKTELLLYIAARR
KTHY_CAUCR      --GFFISFEGGEGAGKSTQIRRLADRLKAAGHDVIVTREPGGGAEAIRELLVNDRWSPVTESLLMYAARR
KTHY_BACCN      MKGLFVTIEGPEGSGKSTLITKLLPYFENKGQKVIATREPGGIAEEIRTILHKKEMEARTEALLYAAARR
KTHY_NOSP7      MGGKLIVFEGVEGCGKTSQMQLCSQWLESLGVSVVVTREPGGTEXXXXXXXXXXEKAEDTELLLYAADRS
KTHY_SYNS3      --GRLLVLEGIDGCGKTTQLQQLSSWLPKSGSRLVVTREPGGTATSLRQLLLDADPGPTAELLLYAADRA
KTHY_SYNAS      ----FISFEGIEGCGKTTQLKLAAQYLRTLKIPVXXXXXXXXXXKKIRNILLNREICAEAETLLFVAARA
KTHY_PYRAB      MRGYFVVLEGIDGSGKTTQAKLLAEWFEEQGWDVLLTKEPGRLIRELNSIIDGSRISYEAEALLFAADRA
KTHY_PSESM      MTGLFITLEGPEGAGKSTNRDYLAAQLRAQGVQVLLTREPGGTAERIRELLLAEGMSADTELLLVFAARA
KTHY_STRSV      --GILISLEGPEGAGKSSVLEALLPFLQNYGTGLITTREPGGVAEAIREVILEPSMDAKTELLLYIASRR
KTHY_PYRHO      MRGYFIVLEGIDGSGKTTQAKLLAEWFEDKGYEVLLTKEPTGKL--IRRIILEEKISYEAEALLFAADRA
KTHY_LACLA      MNGILISLEGPDGAGKTTVLKEILPEIQKMKREIVPTREPGGVAEEIRQIILNTDIDSKTELMLFAAARR
KTHY_NEIMF      ----FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPEALREILLNPETKARAETLMMFAARM
KTHY_NEIMA      ----FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPEALREILLNPETKARAETLMMFAARM
KTHY_BURPP      --GKFITFEGIDGAGKTTHLERLEQKVASTGRSVVMTREPGGTPEQIREIVLHQKMDLETEALLMFALRR
KTHY_TROWT      ---MFVTFEGIDGSGKTAQLTAAGEFLKASGKQVVLTREPGT-ISCIRDYVLASDMDIRTEALLYSADRA
KTHY_TROW8      ---MFVTFEGIDGSGKTAQLTAAGEFLKASGKQVVLTREPGT-ISCIRDYVLASDMDIRTEALLYSADRA
KTHY_SYNPX      MSGRFIVLDGIDGCGKSTQLDHLLGWLPGSGAELISTREPGGTPRSVRELLLEQAPAPTAELLLYAADRA
KTHY_CLAM3      MTGVFITLEGGDGVGKSTQSALLRGWLEDEGHEVVVTREPGGSEVEIREIVLHRRIAPRAEALLYAADRA
KTHY_AGRT5      --GLFISFEGGEGAGKSTQIRTLAEALRGRGFEVVVTREPGGGAEAVRHVILSESFGVRMEAILFAAARN
KTHY_MESSB      --GFFITFEGGEGAGKSTQIHLLADRLRREGRDVLTTREPGGGAEAIRHVLLSGAAEPTLEAILFAAARS
KTHY_LACLS      MNGILISLEGPDGAGKTTVLQEILPEIQKMKREVVPTREPGGVAEEIRQIILNTEIDSKTELMLFEAARR
KTHY_BURP8      --GKFITFEGIDGAGKTTHLGRLEQKVAPAGRSVVMTREPGGTKESLRDILLHEAMDLETEALLMFAARR
KTHY_PYRFU      --GLFIVLEGIDGSGKTTQARLLARWFEDNGFKVVLTKEPTGKI--IRKLVLEGSISLEAEALLFAADRA
KTHY_NEIMB      ----FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPEALREILLNPETKARAETLMMFAARM
KTHY_BURPS      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BURP1      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BURP0      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BACP2      MSGMFITFEGPEGAGKTTVIRKVHEEMERQGYAVMATREPGGIAEQIREVILNEKMDAKTEALLYAAARR
KTHY_BACCR      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACC2      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_ACISJ      --GAFITFEGIDGAGKSSHIDALAQALRAAGHTVALTREPGGTAEKLREMLLHDSMDALTEALLVFAARR
KTHY_ACIBY      ---MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTAEQIRSMLLAENMSHDTELLLIYAARA
KTHY_ACIB5      ---MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTAEQIRSMLLAENMSHDTELLLIYAARA
KTHY_ACIB3      ---MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTAEQIRSMLLAENMSHDTELLLIYAARA
KTHY_NEIG2      ----FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPEALREILLNPETKARAETLMMFAARM
KTHY_NEIG1      ----FITLDGIDGAGKSTNLAVIKAWFERRGLPVLFTREPGGTPEALREILLNPETKARAETLMMFAARM
KTHY_LACJO      MRGYLITFEGPDGAGKTTVINEIIKQLQSLQERTLVTREPGGSKENIRTIILNKEMDDRTEALLYAAQRS
KTHY_DESAH      ---MFITLEGIEGSGKTTQIKPLVDCLGQNGYEAVVTREPGATVKKIRAILLNSGMSDLCELFLYGADRA
KTHY_BURP6      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BURMS      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BURMA      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BURM9      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BURM7      --GKFITFEGIDGAGKTTHLQRLQERLGPTGRHVVVTREPGGTQETLREILLNQPMDLETEALLMFAGRR
KTHY_BACCQ      MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAEEIRTILHKQEMEARTEALLYAAARR
KTHY_BACC4      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_ACIBS      ---MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTAEQIRSMLLAENMSHDTELLLIYAARA
KTHY_ACIBC      ---MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTAEQIRSMLLAENMSHDTELLLIYAARA
KTHY_STRP6      --GKLITVEGPDGAGKTTVLEQLIPLLKQKAQEILTTREPGGAISEIRELILDTAMDPKTELLLYIAARR
KTHY_STRP1      --GKLITVEGPDGAGKTTVLEQLIPLLKQKAQDILTTREPGGVAEHIRELILDTAMDPKTELLLYIAARR
KTHY_BACWK      MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACHK      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACCZ      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACAN      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACAC      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACAA      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_STRPZ      --GKLITVEGPDGAGKTTVLEQLIPLLKQKAQDILTTREPGGVAEHIRELILDTAMDPKTELLLYIAARR
KTHY_FERNB      ---MFVSFEGIDGCGKSTQVNLLVNYLEEKGIPYIKVREPGGTHEKIRELLITQEMCARSELLLFLASRA
KTHY_BACC7      MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACC3      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_BACAH      MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_STRU0      --GKIITLEGPDGAGKTSVLEQLVLKLEKDNQSIVTTREPGGVAESIRNIILNTEMDFKTELLLYIAARR
KTHY_PYRKO      ---MFIVLEGIDGAGKSTQAKLLAEWFENRGYEVVLTKEPTGKL--IRRLVLTAKISHEAEALLFAADRA
KTHY_POLSJ      MHGLFISFEGIDGAGKSTHIAGLADAFRAQGRAVTLTREPGGTAEKLRDLVLNDAMDSLTEALLIFAARR
KTHY_GEOTN      MNGYFFSFEGPEGAGKTTMIGKLESFLRERGFDVMVTREPGGVAEAIRALILNREMDGRTEALLYAAARR
KTHY_BACC1      MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAEDIRTILHKQEMEARTEALLYAAARR
KTHY_ACIBT      ---MFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTREPGGTAEQIRSMLLAENMSHDTELLLIYAARA
KTHY_TRIEI      MIGKFIVFEGVEGGGKTTQIELLQDWLLETGESVVITREPGGTKKALRELLLSPDVLAESELLLYAADRA
KTHY_LISW6      MKAIFITLEGPDGSGKTTVGTLLNQKMEEAGIDFIKTREPGGSSEKVRNIVLNEEMDPKTEVLLIAGARR
KTHY_CHLMU      ---MFIVVEGGEGAGKTQFTQALSKRLMEEGKEVVLTREPGGSAEQLRDLVLTQEISSYAELLLFLAARA
KTHY_ACAM1      MLGKFIVFEGGEGAGKTTQTNRIKGYIQGDYPSVLTTREPGGTAKSIRKLLLNESIDERAELLLFAADRA
KTHY_STRPG      --GKLITVEGPDGAGKTTVLEQLIPPLKQKAQEILTTREPGGAISEIRELILDTTMDPKTELLLYIAARR
KTHY_STRP8      --GKLITVEGPDGAGKTTVLEQLIPPLKQKAQEILTTREPGGAISEIRELILDTTMDPKTELLLYIAARR
KTHY_PSEPW      ---MFITLEGPEGAGKSTNRDYLAARLREQGLDVVLTREPGGTAEKVRELLLAEVMAADTELLLVFAARA
KTHY_PROM2      MKGKFIVIEGIDGCGKTTQIDELSKWLPSKGSKLITTREPGGSHKRLRGLILNNKPSPLAELLLYSADRA
KTHY_SYNS9      MTGRFIVLDGIDGCGKSTQIRHLAQWLPASGAQLICTREPGGTPQSIRELLLHTEASVTAELLLYAADRA
KTHY_RALEH      MRGKFITFEGIDGAGKSTHIDWVADRLRARSAGVVTTREPGGTSEDLRQILLHRKMHLETEALLMFAARR
KTHY_CHLTR      ---MFIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSDSVRGLLLDQKISPYAELLLFLAARA
KTHY_ACIAD      ---MFISFEGTEGVGKTTLIRKLYEHFEASGKQVVLTREPGGTAEQIRSLLLAEPMSSDTELLLMYAARA
KTHY_GEOSM      --GFFITFEGIEGCGKTTQLRLLKERLVALGEKVTVTREPGGCADQMRAILLDAKITPXXXXXXXXXXXX
KTHY_DICNV      MRGKFICLDGTEGSGKSSQIQAICSFLQQHGKTVITTREPGGTQEAIRELVLSPHYQPQAELLLILAARH
KTHY_ANASP      MGGRFIVFEGVEGCGKTSQMQLCAEWLQSLGISVVLTREPGGTEXXXXXXXXXXQKAEDTELLLYAADRA
KTHY_CLONN      --GAFITLEGPEGSGKTTIVKMIEKYLSENNIEYISTREPGGISEQIRDVILNKDMDARTEALLYVASRR
KTHY_LACDB      MQGYFITFEGPDGAGKTTVINEVVKAIQGQKREILVTREPGGSAEKIRDIILNTEMNAKTEALLYAASRS
KTHY_LACDA      MQGYFITFEGPDGAGKTTVINEVVKAIQGQKREILVTREPGGSAEKIRDIILNTEMNAKTEALLYAASRS
KTHY_GEOBB      --GFFITFEGIEGCGKTTQLRLLKERLEAAGEKVTVTREPGGCADQMRAILLDAKITPXXXXXXXXXXXX
KTHY_BRASO      --GRFVTFEGGEGAGKSTQIKMLADRLEKDGVRVVLTREPGGGAEIMRHLVLSKLLGAEAETLLFAAARD
KTHY_BRAJA      --GRFITFEGGEGTGKSTQIKKLADRLKAARMRTLVTREPGGGAEIMRHLVLSKLLGPEAETLLFAAARD
KTHY_RALEJ      MRGKFITFEGIDGAGKSTHIGAVAARLERKDIPAVVTTREPGGTPDLRQILLHRKMHLETEALLMFAARR
KTHY_MESFL      ---MFITIEGMDGSGKTTALQRVKQYLEDLNYKVVMTREPGG-LPKIRELILNKDMEPWTEALLFIAARK
KTHY_CHLTA      ---MFIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSDSVRGLLLDQKISPYAELLLFLAARA
KTHY_BACSK      --GLFITVEGGEGAGKTTIINLVQEQLATQGYEVIRTREPGGVAEQIRDLLLTQEMDNRTEALLYAAARR
KTHY_NITEC      --GKFITFEGIDGAGKSTHLAWLASFLRDKGLEVIVTREPGSTAEQLRQLLLDQAMHAETETLLMFAARR
KTHY_LISIN      MKAIFITLEGPDGSGKTTVGTLLNQKMEEAGIDFIKTREPGGSSEKVRNIVLNEEMDPKTEVLLIAGARR
KTHY_DESDA      ---MFVTFEGIEGAGKSTAIDYLSDYLQARGHDPVLTREPXXXXXXXXXXVRTGGLASRAELFLFLADRA
KTHY_PSEF5      MTGLFITLEGPEGAGKSTNREYLAERLRAAGIEVLLTREPGGTAERIRDVLLTEVMNADTELLLVFAARA
KTHY_LAWIP      ---MFITIEGIEGSGKTTLINRLSEYFSSRGEDVIVTREPGGXXXXXXXXXXXXXXTAESELFLFLADRA
KTHY_BURXL      --GKFITFEGIDGAGKTTHLERLEQKVASTGRSVVMTREPGGTPEQIREIVLHQKMDLETEALLMFALRR
KTHY_WOLTR      ---MFITFEGIDGSGKTIQSELLANFKQIHGENMVLTREPGGTAEKVRGILLKDSIDPVSELLLLISMRY
KTHY_PSEU5      MKGLFVTLEGPEGAGKSTNREYLAERLRARGLDVVLTREPGGTAERIRELLLTEPMAVDTELLLVFAARA
KTHY_PSEPG      MSGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTAERVRELLLAESMAADTELLLVFAARA
KTHY_PSEE4      MSGLFITLEGPEGAGKSTNREYLAARLREQGVDVVMTREPGGTAERIRELLLAEAMAVDTELLLMFAARA
KTHY_PROMA      MKGIFLVLEGIDGCGKSTQIEHLAQWLPLSGAKLFITREPGGTRKSLRQLLLDESPKPLTELLLYAADRA
KTHY_CUPTR      MRGKFITFEGIDGAGKSTHADRLRARADIAG--VVTTREPGGTSEDLRQILLHRKMHLETEALLMFAARR
KTHY_ACIAC      --GWFITFEGIDGAGKSSHIEAVAEALXXXXXXXXXXXXPGGTAETLRSLLLNEAMDALTESLVVFAGRR
KTHY_WOLPP      ---MFITFEGIDGSGKTTQSELLANFKQIHGENVVLTREPGGTAEKIRGSLLKDNIDPISELLLFTSMRY
KTHY_PSEP1      MSGLFITLEGPEGAGKSTNRDYLAARLREHGLDVVLTREPGGTAEKVRELLLTEGMAADTELLLVFAARA
KTHY_LACSS      MVGKLITFEGPDGAGKTSALEAVVARLQKESQEIVVTREPGGNSEQIRQIILDVKMDDRTEALLYAAARR
KTHY_LACF3      MSGRFISFEGPDGAGKTSVLTAIRTGLVNQGDQVVYTREPGGNAEQVRAVLLDKQMDDWTEALLYAASRR
KTHY_HAHCH      --GLFITVEGIEGAGKTTNLNFIRSILEESGEEVVMTREPGGXXXXXXXXXXXXAVSSTAELLLMFAARA
KTHY_ALHEH      --GRFITLEGLEGAGKSTALTRVREYLQRQGIDAVMTREPGGTPERIRALLLGQSMAPATEALLMFAARS
KTHY_SYNPW      MKGRFLVLEGIDGCGKTTQLRQLAEWLPPEGATLHLTREPGGTPRALRELLLXXXXXXXXXLLMYAADRA
KTHY_LEIXX      -PGLFITLEGGDGVGKSTQAALLERWLLGLGRAVVRTREPGGTDAEIREIVLHRDIAPRAEALLYAADRA
KTHY_CHLTB      ---MFIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSDSVRGLLLDQKISPYAELLLFLAARA
KTHY_CHLT2      ---MFIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSDSVRGLLLDQKISPYAELLLFLAARA
KTHY_CHLCV      ---MFIVIEGCEGSGKSSLTELLKDRLIAEGKAVVATREPGGSPERVRDLILTPSISPYTELFLFLAARA
KTHY_BRASB      --GRFVTFEGGEGAGKSTQIKMLAARLESEGMRVVLTREPGGGAEIMRHLVLSKLLGAEAETLLFAAARD
KTHY_BARQU      MSGYFITFEGGEGVGKTTQISLLAQYLRNQGYDVLTTREPGGGAEAIRHILLSQNYGPLIEVILLTAARI
KTHY_AQUAE      ---MLIAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTVGEVXXXXXXXXXXXXXXXXXXXASRS
KTHY_STRA5      --GLMISFEGPDGAGKTTVLEAVLPLLEKLSQDILTTREPGGVTEEIRHIILDTQMDKKTELLLYMAARR
KTHY_STRA3      --GLMISFEGPDGAGKTTVLEAVLPLLEKLSQDILTTREPGGVTEEIRHIILDTQMDKKTELLLYMAARR
KTHY_STRA1      --GLMISFEGPDGAGKTTVLEAVLPLLEKLSQDILTTREPGGVTEEIRHIILDTQMDKKTELLLYMAARR
KTHY_ONYPE      ---MFISFEGCEGTGKTTHSRYLFEKLSKKYSCVL-TKEPGGGLEVIRNILLNKQIDFHTEALLFAADRA
KTHY_METAC      MRGKLITLEGIDGSGKSTVAKKLQENSELRVFEPVFTREPTRGTLTGNAVAIQSDTDQLAELFLFTADHA
KTHY_LISMF      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSSEKVRNIVLNEEMDPKTEVLLIAGARR
KTHY_LISMC      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSSEKVRNIVLNEEMDPKTEVLLIAGARR
KTHY_LACCB      MTGTFITFEGPDGAGKTSVLKTLIPQLEQHVRPLHLTREPGGAKETIREVILNTAMDARTEALLYAASRR
KTHY_LACC3      MTGTFITFEGPDGAGKTSVLKTLIPQLEQHVRPLHLTREPGGAKETIREVILNTAMDARTEALLYAASRR
KTHY_GEOSL      --GYFITFEGIEGCGKTTQIKRAAQSLREAGHRVVVTREPGGCADDIRAILLNSAMVPTTELLLYAAARA
KTHY_ENTFA      MQGIFITFEGPDGAGKTSVLKEVSERLAKESRKIVTTREPGG-IPKIRTVILNDRMDERTEALLYAAARR
KTHY_BACA2      MSGLFITFEGPEGAGKTTVLQEMKEILSAEGLPVTATREPGGIAEQIREVILNKNMDAKTEALLYAAARR
KTHY_ALCBS      MSGRFITLEGGEGAGKSSNLVWLAEALRAEGKTVMVSREPGGALAEIREVLLAEVMADDTELLLVFAARA
KTHY_PARUW      --GYFITIEGGEGSGKSTLLNQLGDYFRNKGFEVIQTREPGGTKESIRHLLLNHEIGHQAELLLFLAARA
KTHY_METMA      MRGKLITLEGIDGSGKSTVAKKIQENPEIQVFDPVFTREPTRGTLTGTAVAIQSETDQLAELFLFTADHA
KTHY_THEON      ---MFIVIEGIDGAGKSTQARLLAEWFKKKGYDVVLTKEPTGKL--IRRLVLTARISHEAEALLFAADRA
KTHY_LISMO      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSSEKVRNIVLNEEMDPKTEVLLIAGARR
KTHY_BACLD      MNGLFITFEGPEGAGKTTILQAAADQLTKNGHSVLATREPGGISERIREVILNPSMDPKTEALLYAAARR
KTHY_LISMH      MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSSEKVRNIVLNEEMDPKTEVLLIAGARR
KTHY_BARHE      MSGYFITFEGGEGVGKTTQIFLLAQHLYGKGYDVLTTREPGGGAEVIRHILLSQHYGPLIEAILFTAARI
KTHY_STRS7      --GKLITFEGPDGAGKTTVLERLVPLLQAAGQTIVTTREPGGVAEKIRQLILDVSMDDKTELLLYIAARR
KTHY_PROM5      MKGKFIVIEGIDGCGKTTQIDEISRWLPTSGSKLIKTREPGGSLKKLRNLILNNKPSSLAELLLYSADRA
KTHY_CHLPN      ---MFIVIEGGEGSGKSSLAKALGDQLVAQDRKVLLTREPGGCLERLRDLILEPELSRCCELFLFLGSRA
KTHY_CHLAB      ---MFIVIEGCEGSGKSSLTQLLKDKLMAEGKAVVATREPGGSSERVRDWILTTELSPYTELFLFLAARA
KTHY_STRMU      --GIFISFEGPDGAGKTTVLEAILPQLKKLAKEVITTREPGGVAESIRDLILDTNMDDKTELLLYIAARR
KTHY_STAS1      ----FITFEGPEGSGKTTVIQQVAQKLENQ-YSVVLTREPGGVKTQIREVLLEDDMDDRTEALLFAASRR
KTHY_WOLPM      ---MFITFEGIDGSGKTTQSKLLANFKQIRGENVVLTREPGGTAEKVRGVLLTNNXXXXXXXXXXXXMRR
KTHY_STRE4      --GKLITFEGPDGAGKTTVLERLVPLLQAAGQTIVTTREPGGVAEKIRQLILDVSMDDKTELLLYIAARR
KTHY_MARMS      MRGKFISLEGGEGSGKTTAIHFIRQWLDDHKIPYIMTREPGGTAEEIRQLVLTESVNDVTELLLVFAARA
KTHY_GLUOX      --GLFITLEGGEGAGKSTQXXXXXXXXXXXGHKVLLTREPGGGAEEIRNLLLKVDLSWRAEILMHMAARS
KTHY_BACSU      MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIAEQIREVILNENMDPKTEALLYAAARR
KTHY_THESM      --GIFIVLEGIDGAGKSTQAKMLAKWFENRGYEVVLTKEPTGKL--IRRLVLIARISKEAEALLFAADRA
KTHY_CHRSD      -PGRFITLEGGEGVGKSTNVAFVCDWLSARGIEVVRTREPGGTAEAIRELLLDEPLDETAELLLMFAARA
KTHY_VESOH      --GKFITIDGVEGAGKSTQIDFICSYLAKKNINVVLTREPGGTKEKIRALLLTQLMDNDTELLLIFAARN
KTHY_RUTMC      --GKFITIDGVEGSGKSTQIDFICDYLVTKKINVILTREPGGTEEKIRTLLLSQSIHGDTELLLLFAARN
KTHY_RHOFD      --GIFISFEGIDGAGKSTHIDALAQAFRAQGRAVTLTREPGGTAEKLRVLVLNDAMDAMTEALLVFAARR
KTHY_NITEU      --GKFITVEGIDGAGKSTHLAWLERFLQDKGLEVVVTREPGGALGELRQLLLDQAMHPETEALLMFAARR
KTHY_LEUCK      ---LFITFEGPEGAGKTSVLEALVSELKPLGDQLVTTREPGGNSEAIRQILQPEDMDDRTEALLYAAARR
KTHY_PROMP      MRGKFIVIEGIDGCGKTTQIDEISKWIPTSGQKLVKTREPGGSLKKIRNLILDNHKSSLAELLLYSADRA
KTHY_PROM9      MKGKFIVIEGIDGCGKTTQINELSKWLPKKGSKLITTREPXXXXXXXXXXXXTNKPSSLAELLLYSADRA
KTHY_SYNSC      MTGRFIVLEGIDGCGKTTQIQHLLEWLPPKGAAVVCTREPGGTPRSIRELLLQEAPAPTAELMLYAADRA
KTHY_RALME      MRGKFITFEGIDGAGKSTHIEWVAERLRARAN-VVTTREPGGTPEDLRQLLLHRKMHLETEALLMFAARR
KTHY_PROM0      MKGKFIVIEGIDGCGKTTQIDELSKWLPISGSKLITTREPXXXXXXXXXXXXNNKPSSLAELLLYSADRA
KTHY_CYAP4      MKGKLIVFEGGEGSGKTTQLQRSRQWLESSGKPLLVTREPGGGI-KLRQLLLNSDIQSRTELLLFAADRA
KTHY_BACHD      --GCFITVEGGEGAGKTSALDAIEEMLRENGLSVVRTREPGG-IPQIRSIILDVDMDPRTEALLYAAARR
KTHY_PSEMY      MTGLFITLEGPEGAGKSTNREYLAERLREQGVDVVLTREPGGTAERIRELLLDEPMAADTELLLVFAARA
KTHY_MYCS5      ---MFITFEGLDGSGKTTVINEXXXXXXXXXXXXVLTREPGGKSEKIREMILDSDLSPITEALLYTTSRR
KTHY_LACRJ      MDGKFISFEGPDGAGKTSVXXXXXXXXXXXXEKVMYTREPGGNKEQIRQVLFNTDMDGRTEALLFAAARR
KTHY_LACRD      MDGKFISFEGPDGAGKTSVXXXXXXXXXXXXEKVMYTREPGGNKEQIRQVLFNTDMDGRTEALLFAAARR
KTHY_AYWBP      ---MFISFEGCEGTGKTTHSSYLFEKLSKKYSCVL-TKEPGGGLEVIRNILLNKQIDFHTEALLFAADRA
KTHY_LACBA      MSGTFISFEGPDGAGKTSALQAITTQIKVLGDQLVITREPGGNSESIRAIILDRAMDYRTEALLYAAARR
KTHY_CHLFF      ---MFIVIEGCEGSGKSSLTELLKNRLITEGKSVIATREPGGSPEQVRNWILNPSLSPYTELFLFLASRA
KTHY_ANOFW      MSYLFFSFEGPEGAGKTTIVRMLKDYLSEQHVDVVATREPGGIAEQIRAVILNERMDARTEALLYAAARR
KTHY_PSEA7      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGVEVQLTREPGGTAERIRELLLAEPMAADTELLLMFAARA
KTHY_METBF      MRGKLITLEGIDGSGKSTVAEKLQKNPEIKAFKPVFTREPTRGTGDAVEKAIQSDTDQFAELFLFTADHA
KTHY_ACHLI      ---MFITFEGGEGSGKTTLIEKLKHTLLEKKYDVLTTREPGGSAEKIRSVLLNTEITAHTEALLFAASRA
KTHY_PSEAB      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTAERIRELLLAEPMAADTELLLMFAARA
KTHY_JANMA      --GKFITFEGIDGAGKSTHLSFVAELLCERKKTVVVTREPGGTSEELREILLHEKMHLETEALLMFAARR
KTHY_STAHJ      ----FITFEGPEGSGKTTVLQRVSEKL-AQDYQLIATREPGG-VPEIRKVVLEANMDIRTEAMLFAASRR
KTHY_PSEAE      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTAERIRELLLAEPMAADTELLLMFAARA
KTHY_PSEA8      MTGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTAERIRELLLAEPMAADTELLLMFAARA
KTHY_PYRCJ      ---MFIAVEGIDGSGKTTVIAEVAKALPR----VYVTREPSGG-PIGRLLLRGGTADPHVDALLFAADRV
KTHY_PROMS      MKGKFIVIEGIDGCGKTTQIDELSKWLPKKGSKLITTREPXXXXXXXXXXXXNNKPSSLAELLLYSADRA
KTHY_NITHX      --GRFITFEGGEGSGKSTQINILAERLNAAKLRAIVTREPGGGAEIIRHLVLSKLLGAYAETLLFAAARD
KTHY_RHOPB      --GRFITFEGGEGAGKSTQIKLLAERLNAGRIRCVLTREPGGGAEIIRHMXXXXXXXXEAETLLFAAARD
KTHY_LEUMM      ---IFISFEGPEGAGKTSVLEALISELKTKGDDLVTTREPGGNSEAIRSILQPEEMDKRTEALLYTAARR
KTHY_STRTD      --GLLISIEGPDGAGKTSVLKVLLPRLEVYPAQVITTREPGGVAEQIREVILDIDMDAKTELLLYIAARR
KTHY_STRT2      --GLLISIEGPDGAGKTSVLKVLLPRLEVYPAQVITTREPGGVAEQIREVILDIDMDAKTELLLYIAARR
KTHY_STRT1      --GLLISIEGPDGAGKTSVLKVLLPRLEVYPAQVITTREPGGVAEQIREVILDIDMDAKTELLLYIAARR
KTHY_PROAC      ---------------KTTQARLLDQWLTTEGIPHLMTREPGDSWQRIRELVLSPPISSRAEALLYNADKA
KTHY_GEOKA      MNGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPGGVAEAIRSIILNREMDGRTEALLYAAARR
KTHY_THEAB      ---MFIAFEGIDGSGKSTQLNLLSQYLKSKGKKVLNIREPGGTIEKIREILLDNNLNKRSELLLFLASRA
KTHY_SHEAM      -PGKFIVIEGLEGAGKSSAITLVHDFIEKHGMAPVCTREPGGTAEKIRDLVKNAELCDEAECLLFYAARA
KTHY_PROMM      MSGRFLVLEGIDGCGKTTQLRHLANWLPREGARLHLTREPGGTALGIRKLVLDXXXXXXXXXXXXXXDRA
KTHY_FRATW      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_FRATT      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_FRATO      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_FRAT1      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_BLOPB      MDNRFITIEGLDGAGKTTITHRVSKYLNQYGVTDILTTHEPGGTPVLRVLIMNEPINSISELLMIYAARL
KTHY_PEDPA      MNGHFISFEGPDGAGKTTVLQAMVEHYQQRLKDQLVTREPGGNSEAIRTIILDKEMDERTEALLYAAARR
KTHY_FRATN      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_OENOB      --GFFITIEGPDGAGKTSLLDNLMALRDIFGDNLIETREPGGVREAIRKIVLGPEMNRRTEALLFAAARA
KTHY_LACS1      MEGKFITFEGIDGSGKTSVLKGVIEHLDKRIDNYIWTREPGGNREAIRKIILNTEMDARTEALLYAAARR
KTHY_HERAR      ----FITFEGIDGAGKSTHLSFVADLLRASKKNVVVTREPGGSLGELRTILLHEKMHLETEALLMFAARR
KTHY_FRATH      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_FRATF      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_FRATM      MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTAEELRNLVLDEEIHSDSELLMIYAGRV
KTHY_STAAW      ----FITFEGPEGSGKTTVINKVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAAS      ----FITFEGPEGSGKTTVINKVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_SHESR      ----FIVVEGLEGAGKSSAIALIRDFIEKHGLAPVCTREPGGTAERIRDLVKIADLCDESECLLIYAARA
KTHY_SHESM      ----FIVVEGLEGAGKSSAIALIRDFIEKHGLAPVCTREPGGTAERIRDLVKIADLCDESECLLIYAARA
KTHY_RHILO      --GFFITFEGGEGAGKSTQIERLARKMHAKKYDVLLTREPGGGAEAVRHVLLSEPFGPKMEALLFAAARS
KTHY_PROM4      MKGHFIVLEGIDGCGKSTQISHISKWLPQSGANLYITREPGGTTKSLRDLLLTNVPAPLTELLLYAADRA
KTHY_KLEP7      ----YIVIEGLEGAGKTTARQLVVETLQSAGHDMVFTREPGGTIEKLRSLVLDEVINDKAEVLMFYAARV
KTHY_EHRRW      ---MFITFEGIDGSGKTTQSRLLTEYLSGVYGVVILTREPGGTFESVRNLLFTKNLDKLSELLFFIAMRR
KTHY_EHRRG      ---MFITFEGIDGSGKTTQSRLLTEYLSGVYGVVILTREPGGTFESVRNLLFTKNLDKLSELLFFIAMRR
KTHY_KLEP3      ----YIVIEGLEGAGKTTARQLVVETLQSAGHDMVFTREPGGTVEKLRSLVLDEVINDKAEVLMFYAARV
KTHY_HAEDU      MRGKFIVLEGLEGAGKTTAHQIILTQLKQAGQQIVQTREPGGTLAEKLRYLIKHEISPQAELLMLYAARA
KTHY_ANAMM      ---MFITFEGIDGCGKTTQAVLLAKYLDLYGEHVVLTREPGGSLNEIRGALLDYKLDGITELMLFIAMRR
KTHY_ANAMF      ---MFITFEGIDGCGKTTQAVLLAKYLDLYGEHVVLTREPGGSLNEIRGALLDYKLDGITELMLFIAMRR
KTHY_STAES      ----FITFEGPEGAGKTSVIKKVSERL-AKEYDIVTTREPGGVLTEIRRIVLDGDIDIRTEAMLFAASRR
KTHY_STAEQ      ----FITFEGPEGAGKTSVIKKVSERL-AKEYDIVTTREPGGVLTEIRRIVLDGDIDIRTEAMLFAASRR
KTHY_STAAR      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAAN      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAAM      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAAC      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAAB      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAA9      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAA8      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAA3      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAA2      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_STAA1      ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
KTHY_NITWN      --GRFITFEGGEGSGKSTQIRILAERLQAAKLRAIVTREPGGGAEIIRHLVLSKLLGADAETLLFAAARD
KTHY_EHRCR      ---MFITFEGIDGSGKTTQSHLLAEYLEIYGNNVVLTREPGGTLESVRNLLFAQGLDSLSELLFFIAMRR
KTHY_DESMR      ---MFVTFEGVEGSGKSTQMTRLCAALEAAGRTVCRTRQPGGCFQTLRAILLSQKLDDRAELFLYLADRA
KTHY_RHIME      ---------------KSTQMRLLAEALSARGYRVLTTREPGGGAEAVRHVLLSESFGVRMEAILFAAARS
KTHY_CLOB8      --GLFIVFEGGEGTGKTTAIDAIYDWITENNFECIKTREPGGIKEQIRQVILSKEMDAKTEALLYAAARR
KTHY_ACTSZ      MKGKFIVLEGLEGAGKTTALHTVVEQLRSLGTDLVFTREPGGTAEKLRQLIKHETEEPKAELLMLYAARI
KTHY_YERE8      MNSKFIVIEGLEGAGKTTARDTVVATLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_MAGSM      MQGRFITFEGGEGAGKSTQIAQLTQSLQAHGVKVLCTREPGGCSERIREILVTDDLDGTSELLLILAARH
KTHY_EDWI9      MESKFIVIEGLEGAGKTTARDVVVDELRRHGIPVVFTREPGGTAEHLRTLVKEETLTDRAEVLMLYAARV
KTHY_THEGJ      --GIFVVIEGIDGAGKSTQAKLLAKWFEKKGYEVILTKEPTGKL--IRKLVLTARISHEAEALLFAADRA
KTHY_BRUSU      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_SHEON      ----FIVVEGLEGAGKSSAIALIRDFIEKHGHAPVCTREPGGTAERIRDLVKIADLCDESECLLIYAARA
KTHY_BRUO2      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_BRUME      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_BRUMB      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_BRUA1      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_OCEIH      MAGLFITFEGGEGAGKTTVIQHIFQKLIAQGIDVIQTREPGGIKEKIRSIIHDPEMEERTEALLYAAARR
KTHY_BRUSI      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_HALHL      --GCFITVEGLEGAGKTTCLQAIEQMLLEAGRP-LFTREPGGTPEALRGALLDPQLTAEAEALTVFAARA
KTHY_ENTS8      MSSKYIVIEGLEGAGKTTARNLVVETLKSLGTDMTFTREPGGTVEKLRSLVLDEVITDNAEVLLFYAARV
KTHY_BRUC2      MSGLFITFEGGEGAGKSTQIALLASHLRNHGFDPVITREPGGGAEAIRHVILSETYGPXXXXXXXXXXXX
KTHY_SALAR      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_PROM3      MSGRLLVLEGIDGCGKTTQLRHLANWLPREGARLHLTREPGGTAMALRKLVLDXXXXXXXXXXXXXXDRA
KTHY_PELTS      MKGKFIVFEGVDGSGKTTQIKLLGEKLESMGCPVVYTREPGGTRERIREILLNPELVPWXXXXXXXXXXX
KTHY_YERPY      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPS      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPP      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPN      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPG      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPE      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPB      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERPA      MNSKFIVIEGLEGAGKTTTRDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_YERP3      MNSKFIVIEGLEGAGKTTARDTVVAVLRAQGNDIVFTREPGGTAEKLRDLIKQEVLTDKAEVLMLYAARV
KTHY_SALTY      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALTI      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALSV      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALDC      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_RICM5      --GKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIEKMREILVHEELLPMSELLQAIAARY
KTHY_RICBR      --GTFITFEGGEGIGKSTQCQMLYEYLKSQNIPVILTREVGGTAEKMREILVHTDLLPMSELLQAMAARY
KTHY_PSYWF      --GKFVSFEGTEGVGKTTAINGLCERLQAQGIEYVRTREPGGSAEQLRELLLDTQINDDTELLLMFAARS
KTHY_NEOSM      ---MFIVLEGIDGSGKSTQVKLLSKFLAKDGYPCVLTREPGGTAESLRSMILHDPIDPMARLLLIVSARV
KTHY_ECOL6      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ACTPJ      MRGKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTLAEKLRHLIKHEVSDKAELLMLYAARI
KTHY_ACTP7      MRGKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTLAEKLRHLIKHEVSDKAELLMLYAARI
KTHY_ACTP2      MRGKFIVLEGLEGAGKTTAHQVILAQLEKAGKNVVQTREPGGTLAEKLRHLIKHEVSDKAELLMLYAARI
KTHY_SALPK      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALPC      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALPB      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALPA      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALNS      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALHS      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALG2      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALEP      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALCH      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SALA4      ----YIVIEGLEGAGKTTARDVVVETLEQLGRNMIFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_RICCK      --GKFITFEGGEGSGKSTQSQMLYEYLKSQNTPVILTREVGGTIEKMREILVHEELLPMSELLQAMAARY
KTHY_RICB8      --GTFITFEGGEGIGKSTQCQMLYEYLKSQNIPVILTREVGGTAEKMREILVHTDLLPMSELLQAMAARY
KTHY_ECOUT      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOK1      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO45      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_RICAE      --GKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIEKMREILVHEELLPISELLQVMAARY
KTHY_METMJ      ---MLITIEGIDGSGKSTXXXXXXXXXXXXXXX--FTREPGATVGESVRRAIAERMDPITEALLFCADHA
KTHY_SHEFN      --GKFIVIEGLEGAGKSSAIALVNDIIKQHGQAPVCTREPGGTAEKMRDLVKTDPLCDEAECLLIYAART
KTHY_RICAH      --GKFITFEGGDGIGKSTQAQMLYEYLKSQNTHVILTREVGGTAEKMRAILVHESLLPMSELLQAMAARY
KTHY_MYCCT      ---MFITFEGMDGSGKTTALLKVKEELERLNYKVLITREPGGEVEQIRQIILNKDMDAWTEALLFIASRN
KTHY_RICPR      --GKFITFEGVDGIGKSTQSKMLYEYLKSQKIPVILTREVGGTTEKMREILVNEELLPMSELLQAMAARY
KTHY_RHOBA      -PGRLITLDGIDGVGKSSQIEILAERLRSEGRNVLCVRDPGSTDTKLRAMLLDSDLEMHTEAMLFMASRC
KTHY_OLICO      --GRFITFEGGEGSGKSTQIQLLAERLKGQGIETLVTREPGGGAEIVRHLLLSKLLGADAETLLFAAARD
KTHY_MYCMS      ---MFITFEGMDGSGKTTTLLKVKEELERLNYQVLITREPGGEAEQIRQIILNRDMDAWTEALLFIASRN
KTHY_MYCHJ      ---MFISFEGIDASGKSTVMDLFAKYLKIKEKEIVTTFEPGGNLKEIREFLLSKQISPYVEMLLFATARR
KTHY_MYCH2      ---MFISFEGIDASGKSTVMDLFAKYLKIKEKEIVTTFEPGGNLKEIREFLLSKQISPYVEMLLFATARR
KTHY_FRAP2      ----FIVIEGLDGAGKSTAIGFIKKYLDSKSLAAVYTREPGGTAEELRSIVLDEEIHPDSELLMIYAGRI
KTHY_ERWCT      MNSKFIVIEGLEGAGKTTARNIVVETLRSHGKEVLFTREPGGTLAEKLRELIKQGMADEAEVLMLYAARV
KTHY_RICPU      --GKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIEKMREILVHEELLPMSELLQAMAARY
KTHY_SHELP      ----FIVIEGLEGAGKSSAIALVRDFIEKHGVPPVCTREPGGTAERIRDLVKIADLCDESECLLIYAARA
KTHY_RICRS      --GKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIEKMREILVHEELLPMSELFQAMAARY
KTHY_RICRO      --GKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIEKMREILVHEELLPMSELFQAMAARY
KTHY_RICCN      --GKFITFEGGEGIGKSTQSQMLYEYLQSQNTPVILTREVGGTIEKMREILVHEELLPMSELLQAMAARY
KTHY_PROM1      MKGKFIVFEGIDGSGKTTQINQLSKWLISENNKLVITREPGGTQKSIRSLLLDTEKSPDSELLLYAADRS
KTHY_LEGPC      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTIGEIRSIIKNPELDDRSELLLLYAARI
KTHY_CALS8      MKGKFIVFEGNDGSGKSTQILKVEKYLKEKGYKVVTTREPGGTEVRIRKLLLAYKMDGLTEALLLAADRN
KTHY_THEM4      ---MFIAFEGIDGSGKSTQLVLLEKYLINRGKKVIKVREPGGTIEKIRDLLLNFNMNKRSELLLFLASRA
KTHY_RICTY      --GKFITFEGMDGIGKSTQSKMLYEYLKSQKIPVILTREVGGTFEKMREILVHEELLPMSELLQAMAARY
KTHY_RICFE      --GKFITFEGGEGIGKSTQSQMLYEYLKSQNTPVILTREVGGTAEKMREILVHEELLPMSELLQAMAARY
KTHY_ECOSM      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO7I      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_VEREI      -PGLFISFEGIDGAGKSSHVEGLAAAFRAQGRRVTVSREPGGTPXXXXXXXXXXXXXMDAESLLIFAARR
KTHY_SHISS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SHIFL      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SHIF8      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SHIDS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SHIBS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_SHIB3      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_PROMT      MKGKFIVFEGIDGSGKTTQINQLSKWLISENNKLVITREPGGTKKSIRSLLLDTEKSPDSELLLYAADRS
KTHY_MYCH7      ---MFISFEGIDASGKSTVMDLFAKYLKIKEKDIVTTFEPGGNLKEIREFLLSKQISPYVEMLLFATARR
KTHY_LEGPH      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTIGEIRSIIKNPELDDRSELLLLYAARI
KTHY_ERWT9      MNSKFIVIEGLEGAGKTTAREAVVSELQRHGNDIIFTREPGGTLAEKLRELIKQGVEGEAELLMLYAARV
KTHY_EHRCJ      ---MFITFEGIDGSGKTTQSHLLTEYLSKGVNNVVLTREPGGTLEAVRDLLFQAKLDSLSELLFFIAMRR
KTHY_ECOSE      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOLU      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOLI      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOLC      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOL5      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOHS      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECODH      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECOBW      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO8A      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO81      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO55      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO27      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO24      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEVITDKAEVLMFYAARV
KTHY_ECO5E      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEIITDKAEVLMFYAARV
KTHY_ECO57      MRSKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLVLDEIITDKAEVLMFYAARV
KTHY_LEGPL      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTIGEIRSIIKNPELDDRSELLLLYAARI
KTHY_CITK8      ----YIVIEGLEGAGKTTARNVVVETLEQLGHDMIFTREPGGTAEKLRSLVLDETITDKAEVLMFYAARV
KTHY_AERHH      ----FIVIEGLEGAGKSSAVRYVADYLHGHGARIECTREPGGTPLAERMRAIVKELTIEAELLLMYASRV
KTHY_VIBPA      MKANFIVVEGLEGAGKSTAIKTVLDTLKQAGENIVNTREPGGTAEKMRALVKEEELKDMTELLLLYAARV
KTHY_ENT38      ----YIVIEGLEGAGKTTARNVVVDTLKELGEQMVFTREPGGTAEKLRSLVLDEVIDVKAEVLMFYAARV
KTHY_PECCP      MNSKFIVIEGLEGAGKTTARHIVVETLRSHGKEVVFTREPGGTLAEKLRELIKQGMTDEAEVLMLYAARV
KTHY_LEGPA      LTGKLIVIEGLEGAGKSTAVNLVVELLSQKKISTITTREPGGTIGEIRSIIKNPELDDRSELLLLYAARI
KTHY_FINM2      ---MFITFEGPDGSGKSTIIQKVYDYLIENNYDVIKTREPGGSAEKIRNLILDTEMGYRTEALLYAASRA
KTHY_ANAPZ      ---MFITFEGIDGCGKTTQSILLAKYMDLYGEDVVLTREPGGTSFNLRSVFLSYKVDKLTELFLFLAMRR
KTHY_MYCPU      ---MFITFEGIDASGKTSLLAKLKAHVNLQGK-CTFTWEPGGRIQTIRHLILNKELSPIAEAFLYSSARR
KTHY_LACPL      LTGKLVTFEGPDGAGKTSALNAIVAKLQPQGDRLVVTREPGGNQEAIRKIILDRHMDDRTEALLYAAARR
KTHY_HAMD5      MKGKFIVIEGLEGAGKSTAVNTVQQFLRHKIQDVICTREPGGTAEEIRHLIKKKSLTDKAEXXXXXXXXX
KTHY_HAES1      --GKFIVIEGLEGAGKSSTHQVVVNTLKEFGHEVVFTREPGGTLAEKLRYLIKHEVTAKAELLMLYAARV
KTHY_METHJ      ---MLVTIEGIDGSGKSTLHKALGPYL-ADLNPVI-TCEPGSTIGEAVRRAIREHADPIAEALLFVADHA
KTHY_METBU      MKGKLITLEGIDGSGKSTITRFLPAFANA-----VFTKEPTTSIGDAVYKAIQSDTDELAELMLFTADHA
KTHY_IDILO      MSGKFIVIEGLEGAGKSSAIASVVTHLQAKGIQVETVREPGGSLRDLVKKKWEEKVSPTTELLLMYASRV
KTHY_HAEPS      MRGKFIVIEGLEGAGKSNAQRIVSETLAAHGIEFITTREPGGTAEALRNLWKEGETTDKAEVLMIYAARI
KTHY_PHOLL      MNSKFIVIEGLEGAGKTSAMKTIVEMLQQHGQNLIFTREPGGTAEKLRGLIKQEPLTDKAEVLMLYAARV
KTHY_VIBCM      MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDITRTREPGGTLEKLRALVKEEELQDITELLLVYAARV
KTHY_VIBCH      MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDITRTREPGGTLEKLRALVKEEELQDITELLLVYAARV
KTHY_VIBC3      MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDITRTREPGGTLEKLRALVKEEELQDITELLLVYAARV
KTHY_BORPE      --GRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPEKLRELLLSEPMALETETLLMFAARC
KTHY_BORPA      --GRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPEKLRELLLSEPMALETETLLMFAARC
KTHY_BORBR      --GRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGTPEKLRELLLSEPMALETETLLMFAARC
KTHY_HAES2      --GKFIVIEGLEGAGKSSTHQVVVNTLTEFGHEVVFTREPGGTLAEKLRYLIKHEVTAKAELLMLYAARV
KTHY_SODGM      MNSKFIVIEGLEGSGKTSAIAQVVDVLREQGRDVVFTREPGGTLAEALRTLIKDGVGEEAELLMLYAARV
KTHY_PASMU      --GKFIVLEGIEGAGKTTARDSIVRALHAHGHDIVFTREPGGTAEKLRQLIKHETEEPKAELLMLYAARI
KTHY_BDEBA      ----FIVFEGLDGSGKSSLMAALERELQNRAINFLRTREPGGTPDEIRNMILRKEPTPRTELLLYEASRS
KTHY_MYCMO      ---MFISFEGIDGAGKSTXXXXXXXXXXXXXXXFVFTREPGGKAEKIRKILLDKKIDPMTETLLYAASRR
KTHY_ESCF3      ----YIVIEGLEGAGKTTARNVVVETLEQLGREMIFTREPGGTAEKLRSLVLDEVITEKAEVLMFYAARV
KTHY_DECAR      MKGKFITFEGIDGAGKSSHVEWLAGLLRQRGIVVHVTREPGGTEEKLRELLLNEPMHLETETLLMFAARR
KTHY_PSEHT      ----FIVIEGLEGAGKSTAIALCQSFLNSKKIDFINVREPGGTAESLRTLVKAQEIAFETELLIMYAARS
KTHY_ALTMD      MRGKFIVVEGLEGAGKSSVIGLIVKALTDAGMRVEQTREPGGAIRECVKHDWDETVSEETELLLMYAARV
KTHY_MYCAP      ---MFITFEGLDGSGKTTQXXXXXXXXXXPALSFIVTREPGGKSEKIRELILDKELSPISEALLYTASRR
KTHY_HALMA      ---MLVTLEGLDGSGKTTVWERLRSD-DAVPSETVFTREPTDTWDAVQRSIDNDDADSLAELFLYTADHA
KTHY_BORPD      --GRFITLEGVDGAGKSTHAAWLADALRDMGRTVVATREPGGTLGELRGLVLSESMTLDTETLLMFAARC
KTHY_MANSM      MNGKFIVLEGLEGAGKTTARQAVVEQLNALGTDLLFTREPGGTAEKLRNLIKYETEEPKAELLMLYAARI
KTHY_HAEIG      MKGKFIVIEGLEGAGKSSAHQSVVRVLHELGKDVVFTREPGGTAEKLRHLIKHETEEPKAELLMLYAARI
KTHY_BUCBP      LKGKFIVIEGIEGSGKTTICKTLKNILYEHGKNVICVRDPGSTAEKIRSLLITKDKNEETELLLFYAARI
KTHY_SPHWW      MPGRFITLEGGEGVGKSTQXXXXXXXXXXXGLDVVETREPGGGAEAIRRLLLADRWNXXXXXXXXXXXXX
KTHY_VIBHB      MKANFIVVEGLEGAGKSTAIKTVLDTLKAAGENIVNTREPGGTAEKMRGLVKEEDLKDMTELLLLYAARV
KTHY_SHESA      ----FIVVEGLEGAGKSSAIALIRDFIEKHGLAPVCTREPGGTAERIRDLVKIADLCDESECLLIYAARA
KTHY_HAEIN      MKGKFIVIEGLEGAGKSSAHQSVVRVLHELGQDVVFTREPGGTAEKLRHLIKHETEEPKAELLMLYAARI
KTHY_VIBFM      ----FIVIEGLEGAGKSTAIKNVLATLAKHGSPVT-TREPGGTLAEKMRELVKQPLTDMAELLLLYAARA
KTHY_TERTT      MTGRFITVEGTEGVGKSTNLAFIEGFLRSRAIDVITTREPGGXXXXXXXXXXXXPVDACAELLMVFAARA
KTHY_RHOPA      --GRFITFEGGEGAGKSTQIXXXXXXXXXXXXXTLVTREPGGGAEAIRSXXXXXXXXXXXXXXXXXXXXX
KTHY_VIBVY      ----FIVIEGLEGAGKSTAIQTVLDTLRQAGNEIAQTREPGGTLAEKMRALVKEELHDMTELLLLYAARV
KTHY_VIBVU      ----FIVIEGLEGAGKSTAIQTVLDTLRQAGNEIAQTREPGGTLAEKMRALVKEELHDMTELLLLYAARV
KTHY_VIBF1      ----FIVIEGLEGAGKSTAIKNVLATLAKHGSPVT-TREPGGTLAEKMRELVKQPLTDMAELLLLYAARA
KTHY_COLP3      --GKFIVIEGMEGAGKSSAIAVIESTLNKHGIEYINTREPGGTLAEVKSVDHQEKLTVETELLLMYASRS
KTHY_ALISL      ----FIVIEGLEGAGKSTAIKNVLATLAKHGITAVTTREPGGTLAEKMRELVKQPLTDMAELLLLYAARA
KTHY_PYRAE      ----FVAIEGIDGSGKST----VISLLEKKLPRVYATREPSSG-PIGRLILKGGSVDPHVDALLFAADRI
KTHY_RHOPT      --GRFITFEGGEGAGKSTQIXXXXXXXXXXXXXTLVTREPGGGAEAIRSXXXXXXXXXXXXXXXXXXXXX
KTHY_MYCGE      --GVFVVIEGVDGAGKTALIEGFTKFLNYQ---LTYTREPGGTLEKIRQLLLNETMEPLTEAYLFAAART
KTHY_BAUCH      MKSKFIVIEGLEGAGKTSVIQQIITILHSNGHNIISTRDPGGTLAETIRDIIKKGMNGETELLLLYAART
KTHY_SERP5      MKSKFVVIEGLEGAGKTTARDTVVDVLREHGNDIAFTREPGGTLAEKLRDLFKRGVEGEAEVLMLYAARV
KTHY_METLZ      ---MLITLEGIDGAGKSTLYEGLKTRL--QDLEPVFTKEPGS--PLVNSAVRRENRDPFAEATLFVADHA
KTHY_BLOFL      MNNRFIVVEGLDGSGKTTIVHKIVKYFYNQKTNVITTHEPGGTLSEIKNKSKNEKLTDLSELLMLYAARS
KTHY_MYCGA      --GVFIVIEGVDGSGKSSFLKRMMEHTMINSQPIIYSREPGGTSEAVRELIMKLSNSPLTEALLFCASRN
KTHY_HAEIE      MKGKFIVIEGLEGAGKSSAHQSVVRVLELAIQDVVFTREPGGTAEKLRHLIKHETEEPKAELLMLYAARI
KTHY_WIGBR      ----FIVIEGLEGSGKTNAISKIVNLLNKQGKNVIFTREPGGTAESLRTLIKEEKITDNAELLMIYAARI
KTHY_NATPD      ---MLITLEGIDGSGKSTAHAALRERLTAE--ETTFTREPTDSWSAVERSIGDADADPLAELFLYTADHA
KTHY_PHOPR      MTAKFIVIEGLEGAGKSTAIQQVIDALAAHGENPESTREPGGTAEQMRALIKEEPLTDMAELLLLYAARI
KTHY_CALMQ      ---IFVDVEGIDGVGKSTVIRLTADELRRRGYLVYTTSEPSDGLFIRRSILESNEVEPMALALLFAADRV
KTHY_ORITI      --GKFITFEGNEGSGKTTQSKLLYEKLLDNGIKAVWTREIGGDIAEIRDIVLFKDMSITTELLLIMAARY
KTHY_ORITB      --GKFITFEGNEGSGKTTQSKLLYEKLLDNGIKAVWTREIGGDIAEIRDIVLFKDMSITTELLLIMAARY
KTHY_HALSA      ---MLVTLEGLDGSGKTTVWESLRA---SHDDGVTFTAEPTDSQQAVRRSESAADADPIAELFLFTADHA
KTHY_HALS3      ---MLVTLEGLDGSGKTTVWESLRA---SHDDGVTFTAEPTDSQQAVRRSESAADADPIAELFLFTADHA
KTHY_HALLT      ---MLITLEGLDGSGKTTVWEALHDVYP----DATFTREPTDSWEAVDRSIAADDADPLAELFLLTADHA
KTHY1_SULTO     ----FISFEGIDGAGKTTLAKKVYEVLKKKGYNVILTQEP--FTREITELIKKAGWNPVLLTLLFSADRA
KTHY_SULDN      ---MYIAIEGIDTAGKSTQIAKLQEHFS----DAIITKEPGGAGKEIREIVLNAKISKKAEFLLFLADRA
KTHY_METS5      -----VVIEGIDASGKTTLAKRLAESLSPRFK-VLLTQEP--FTDDIKQLLEKYQWKDQVLLLLFSADRR
KTHY_MYCPN      --GVFVAIEGVDGAGKTVKQRFPQSFL---GFKTLFSREPGGTAEKIRALLLHEAMEPLTEAYLFAASRT
KTHY_BRAHW      MKGKLIVLEGIDGSGKSSIGMMLTDILNNIGIKSIYTFEPTHAYSKLRESMLSKDLTPEEELSLFIADRK
KTHY_METJA      ---MFIVFEGIDGSGKTTQSKLLAKKMDA-----FWTYEPSNSLKIIREILSGKEVDNKTLALLFAADRI
KTHY_ARCFU      ---MLIAVEGIDGAGKTTIAAYIAELLKEKGYKVKVLKEPGDSKFGKKIKXXXXXXXXXXXXXXFLKDRE
KTHY_DESPS      -PGKLIIFEGTDGAGKSTQIKMLANYLRSKGLDVIASFEPTNGPQKIRQLYTDRKVTRNEELELFLADRR
KTHY_BUCAP      ----FIVIEGLEGAGKTHACICVQRILKENNKNVILVRQPGSTAEKIRKLIKNEDFEKETELLLMYAARI
KTHY_XANCP      --GLLIAIEGIDGAGKTTLARSLATLLEQAGARVVLSKEPTNGPTQLRQSAATGRLSAQDEVDLLLRDRR
KTHY_XANCB      --GLLIAIEGIDGAGKTTLARSLATLLEQAGARVVLSKEPTNGPTQLRQSAATGRLSAQDEVDLLLRDRR
KTHY_XANC8      --GLLIAIEGIDGAGKTTLARSLATLLEQAGARVVLSKEPTNGPTQLRQSAATGRLSAQDEVDLLLRDRR
KTHY_UREPA      --GLFIVFEGIDGAGKTSILKQLLEVLKEPKNKIFLTREPGGAAEMIREFFLKEVFDPLTLAYLYASSRA
KTHY_UREP2      --GLFIVFEGIDGAGKTSILKQLLEVLKEPKNKIFLTREPGGAAEMIREFFLKEVFDPLTLAYLYASSRA
KTHY_MYCPE      --GLFVAFEGPDACGKSTVSKKLINFFNNKDS-VILTREPGGTEEKIREILVNYDIDPRTEALLFAASRT
KTHY_HELHP      ---MYVAIEGVDTCGKSTQIQLLKAYYPQ----AVFTKEPGGSIEHIRDLVLFAPLDERAELMLFLADRA
KTHY_XYLF2      --GMLVAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPTLLRQSAVTGRFSPEEEVDVLLRDRR
KTHY_WOLSU      ---MYVAIEGVDTCGKSTQI----ALLKRRFPGAIFTKEPGGTAMKLRELLLGGEASAKAELLLFLADRA
KTHY_HELPG      ---MYVVLEGVDGAGKSTQVE----LLKTRFKNALFTKEPGGTRESLRHIALNENISELARAFLFLSDRA
KTHY_XYLFM      --GMLVAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPTLLRQSAATGRFSPEEEVDVLLRDRR
KTHY_XYLFT      ---MLVAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPTLLRQSAVTGRFSPEEEVDVLLRDRR
KTHY_HELAH      ---MYVVLEGIDGVGKSTQIELLSAFQNA-----LFTKEPGGTKETLRHIALHENLSELARAFLFLSDRA
KTHY_AKKM8      --GRLIVFEGIDGTGKSTHIGHLRKYLEEKELEVVQSFEPTRGRRMLRDSAVTGRLSVEEEVALFLKDRR
KTHY_HELP2      ---MYVVLEGVDGAGKSTQV----GLLKNKFKNALFTKEPGGTKESLRRIALNENISELARAFLFLSDRA
KTHY_HELPY      ---MYVVLEGVDGAGKSTQVE----LLKDRFKNALFTKEPGGTRESLRRIALNENISELARAFLFLSDRA
KTHY_BUCAI      ----FIVIEGLEGAGKTNACICXXXXXXXXXXXXXXXXRQPGSTPDIRRLIKKKNLIKETELLLMYAARI
KTHY_METMP      ----FIVFEGIDGCGKTTQAKLVAEKLNAN-----FTFEPTDGKKSIREILAGSKCNKETLALLFAADRV
KTHY1_SULSO     -----IAIEGIDGSGKTTLANLLKEHLESKMKNVIVTREPFSE-DIIKLIEKIGWNDPILLVLLFAADRE
KTHY_XYLFA      ---MLVAIEGIDGAGKTTLARSLALKLRGVGLETVVSKEPTNGPMLLRQSAATGRFSPEEEVDVLLRDRR
KTHY_HELPH      ---MYVVLEGVDGVGKSTQV----GLLKDRFKNALFTKEPGGTKESLRHIALNENISELARAFLFLSDRA
KTHY_AERPE      -----VALEGIDGSGVSTHSRLLHARLAGAGVKSCLWKEPTEG-PVGRFLRSTEGVDSDLMALLFAADRL
KTHY_ARCB4      ---MYVSIEGIDTAGKSTQLN----ILEKTFPNAIFTKEPGGGI-KLRAMALGGEASSIAEMFLFLADRA
KTHY_STAMF      --GFFLVLEGIDGAGKTSIAFKLRDFLVEKGFNVHYTYEPYNTLVEALKKKYNEXXXXXXXXXXXXXXXX
KTHY_HELPS      ---MYVVLEGVDGAGKSTQV----GLLKDRFKNALVTKEPGGTREHLRHIALNENISELARAFLFLSDRA
KTHY_SULAC      -----ISFEGIDGSGKTTISKIIYEKLLIENKKIILTSEPFSQ----EIIKLIEEIGPISLALLFTADRA
KTHY_HELPJ      ---MYVVLEGVDGAGKSTQV----GLLKDRFKNALFTKEPGGTRESLRRIALNENISELARAFLFLSDRA
KTHY2_SULTO     --GVLIAFEGIDGSGKSSQATLLKDWIELK-RDVYLTEWNSSDWIHIKEAKKKDLLTPLTFSLIHATDFS
KTHY_TREPA      ----FVVFEGIDGTGTSTQLRALERHFQAR-KDMVFTQEPTGG--EIGTLIVLQKMSSKALGLLFAADRH
KTHY_NAUPA      ---MYIALEGIDTAGKSTQIELLK---NEYKNNILFIKEPGFTKTKIREIIFNDDISKKAELFLFLADRA
KTHY_METST      ---MYIVLEGIDGVGKTTQTEKLKEWLEKRGFSVKTIVEPTDS--DIGKIIREELLKPEATALLFAADRL
KTHY_LEPBL      ---IFVVFEGIDGSGKSTLCKSLTEKLTERGIPSVNFTEPTNGKYLRKFLRGEIDLERKEQIDAFLNDRE
KTHY_LEPBJ      ---IFVVFEGIDGSGKSTLCKSLTEKLTERGIPSVNFTEPTNGKYLRKFLRGEIDLERKEQIDAFLNDRE
KTHY2_SULSO     MRGLLIAFEGIDGSGKSSQAVLLKDWIEMR-RDVYLTEWNSSEWIHIKEAKKKNMLTSITFSLIHATDFS
KTHY_SULNB      ---MYILFEGIDTCGKSTQMELLT-----QKHPIITTHEPGGTAQQAREILLSDSLSKRAELLLFLADRA
KTHY_METTH      ---MYICFEGIDGSGKTTHAALTASWLRENGYMVHEVREPTDS--NIGSLIRSMLSSPDARALLFAADRL
KTHY_XANC5      --GLLIAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPTQLRQSAATGRLSAEEEAELLIRDRH
KTHY_XANAC      --GLLIAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPTQLRQSAATGRLSAEEEAELLIRDRH
KTHY_SYNY3      MAALFIVLEGIDGSGKTTQGDLLLAHFQRQGLAAVLSPEPTNGRQALQGDLFTYNDARQFEAYLFAADRH
KTHY_METKA      --GLYLGVEGIDGVGKSSVVNLAAEFLEIHGLEVTTVREPSTDIG--REALEWDD--PYLQALAFTLDRM
KTHY_LEPIN      ---IFVVFEGIDGSGKSTLCKSLTEKLIELGIPSAAFTEPTNGKYLRKFLRGEIELGKEEQIEAFLNDRE
KTHY_LEPIC      ---IFVVFEGIDGSGKSTLCKSLTEKLIELGIPSAAFTEPTNGKYLRKFLRGEIELGKEEQIEAFLNDRE
KTHY_CAMC5      ---MYVLFEGVDGVGKSTQIEMIARAHEDS----LVTKEPGGTKQKLREILLGGDLSARAEILLFLADRA
KTHY_CAMC1      ---MYVLFEGIDGVGKSTQIEILASFSDA-----IVTKEPGGTQLGVREILLRSKIGKRAEILLFLADRA
KTHY_XANOR      --GLLIAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPTKLRQSAATGRLSADEEAELLIRDRH
KTHY_XANOP      --GLLIAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPTKLRQSAATGRLSADEEAELLIRDRH
KTHY_XANOM      --GLLIAIEGIDGXXXXXXXXXXXXXXXXXXXXVVLSKEPTNGPTKLRQSAATGRLSADEEAELLIRDRH
KTHY_THEVO      ---MFIAVEGIDGAGKTTLAKXXXXXXEKEGFRVFLTREP---TDDIRN----YEGDDVELFIKFTLDRY
KTHY_METVS      ----FIVFEGIDGSGKTTQAKMLAEKLNAE-----YTCEPTTGKRTIREVLSGSECKKETLALLFAADRV
KTHY_METM7      ----FIVFEGIDGCGKTTQAKLIAEKLNAK-----FTFEPTDGKKSIREILSGSKCQKETLALLFAADRV
KTHY_METM6      ----FIVFEGIDGCGKTTQAKLIAERLNAK-----FTFEPTDGKKSIREILSGSKCQKETLALLFAADRV
KTHY_THEAC      ---MFIAIEGIDGAGKTTLARGIGNMLLGEGYRVYMTKEPTDGMENYAG-------DGVELFLKFTINRY
KTHY_CAEEL      --GLLIVFEGLDRSGKSTQAKRLVESIDASSSPSAVLQDRSSSIGKLIDQYLRKEIDMDALHLLFSADRF
KTHY_CAMFF      ---MLVNFEGVDGVGKSTQISLLKEFRN----DAVITKEPGGGLM-VRDYLLASKISNKTEIFLFLADRA
KTHY_CAMHC      ---MLIFFEGIDGVGKSTQIELLKS---VYNKNYLITKEPGGTLEKLREILLESDISKTAELFLFLADRA
KTHY_META3      ----FIVFEGIDGSGKTTQAKLLADYLNG-----IYTCEPTNGEQLIRKVLGGKNCEKESLALLFAGDRV
KTHY_HUMAN      --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
KTHY_MOUSE      --GALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERS-TEIGKLLNSTELEDHSVHLLFSANRW
KTHY_METS3      ---MYIVFEGIDGAGKSTQINLLKDWLDQNGFDVETVVEPTDS--EVGKLIRKILQRPDATTLLFAADRM
KTHY_SCHPO      --GRLIVIEGLDRSGKSTQCQLLVDKLISQHEKAELFKFPDRGKKIDDYLKESVQLNDQVIHLLFSANRW
KTHY_CAMJD      ---MYVVFEGIDCVGKSTQI----SLLKEIYKDAIFTLEPGGTEKHLREILLTHPISKRAELLLFLADRA
KTHY_CAMJ8      ---MYVVFEGIDCVGKSTQI----SLLKEIYKDAIFTLEPGGTEKHLREILLTHPISKRAELLLFLADRA
KTHY_PICTO      ---MFIAIEGIDGSGKTTLAGDIASY-----TGFYLTREPTDRFCYDYIEADYNDESSIINFFLFTLDRY
KTHY_CAMLR      ---MYIAFEGVDCVGKSTQIELLKKCF----KDAIFTKEPGGSELGVRKILLESKMSKKAELLLFLADRA
KTHY_CAMJJ      ---MYVVFEGIDCVGKSTQI----SLLKEIYKDAIFTLEPGGTEKHLREILLTHPINKRAELLLFLADRA
KTHY_CAMJR      ---MYVVFEGIDCVGKSTQI----SLLKEIYKDAIFTLEPGGTEKHLREILLTHPINKRAELLLFLADRA
KTHY_CAMJE      ---MYVVFEGIDCVGKSTQI----SLLKEIYKDAIFTLEPGGTEKHLREILLTHPINKRAELLLFLADRA
KTHY_METM5      ----FIVFEGIDGCGKTTQAKLIAEKLNAK-----FTFEPTDGKKSIREILSGSQCQKETLALLFAADRV
KTHY_DICDI      --GLFILFEGVDRVGKSTQVQSLTNHINVQKLPTKSLRFPDRTTPQIINQYLATNMDDRALHLLFSSNRW
KTHY_YEAST      --GKLILIEGLDRTGKTTQCNILYKKLQPNCKPERSTRI--GGLINEYLTDDSFQLSDQAIHLLFSANRW
KTHY_ASFB7      MRGILITIEGINGVGKSTQAMRLKKALECMDYNAVCIRFPNGGL-ILQVLNKMTEMSSEQLHKLFTKHHS
KTHY_ASFWA      MRGILIAIEGINGVGKSTQAMRLKKALECMDYNAVCIRFPGDLILQVLNKMI--EMSSEQLHKLFTKHCS
KTHY_MYCTU      ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
KTHY_ASFP4      MRGILIAIEGVNRVGKSTQAMRLKKALECMDYNAVCIRFPGDLILQVLNKMI--EMSSEQLHKLFTKHCS
KTHY_ASFK5      MRGILIAIEGINGVEKSTQAIRLKNALENKRYDVIYLHFPSPNTDTGKLILLNKIVKMPSEQLLFTKHRC
KTHY_IIV6       --GLLIVFEGCDKTGKSTQCKLLFEELKQKNIEVRMINFPNGKLID-QYLKGKIYLSDEDIHILFSKNRW
POTA_MANSM      --GEFLTILGPSGCGKTTVLRLIAGFEEANGGQIILDGEDVTDLP-------------------------
ADA15_RAT       LPNIGGTEEEQQASPERTQSRSLENQVVQDSPPINLTEVLQTGLPE--TLRIGLELDGENHILELQQNRD
FTSY_NEIMC      -----IMLAGINGAGKTTSIGKLAKYFQAQGKSVLL----------------------------------
FTSY_NEIMB      -----IMLAGINGAGKTTSIGKLAKYFQAQGKSVLL----------------------------------
FTSY_NEIMA      -----IMLAGINGAGKTTSIGKLAKYFQAQGKSVLL----------------------------------
FTSY_NEIGO      -----IMLAGINGAGKTTSIGKLAKYFQAQGKSVLL----------------------------------
SSUB_RALME      -PGEFVAIVGRSGCGKSTLLRLVAGLESADAGAVALDGQPGGTPSSVRVMFQDARLLP------------
KTHY_VACCW      --GALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKYNDHIVNLLFCANRW
KTHY_VACCT      --GALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKYNDHIVNLLFCANRW
KTHY_VACCC      --GALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKYNDHIVNLLFCANRW
KTHY_VACCA      --GALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKYNDHIVNLLFCANRW
SRP54_MYCTU     -PPTVVMLAGLQGSGKTTLAGKLAARLRGQGHTPLL----------------------------------
SRP54_MYCBO     -PPTVVMLAGLQGSGKTTLAGKLAARLRGQGHTPLL----------------------------------
KGUA_ANADE      LPGLLLVLSAPSGAGKTTLAHRLEASPDAVFSISATTRAPRGAEREVDYHFVTAERFTEAEWAEVHGQRY


                         .         .         *         .         .         .         .:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
KTHY_THET8      EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
KTHY_THET2      EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
KTHY_SYNJB      EHVSKVIAPALAAGQVVVCDRFTDSTLAYQGYGRGLDLEKIRQLNHLATGGLQPHLTLWLDLPPEVGLAR
KTHY_BIFLI      QHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDPALSHNR
KTHY_SYNJA      EHVNKVIAPALAVGQVVICDRFTDSTLAYQGYGRGLNLEQIRQLNHLATGGLQPQLTLWLDLAPEVGLAR
KTHY_BIFLD      QHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDPALSHNR
KTHY_DESOH      QHVRRLIEPALAEGKTVVCDRFADATEVYQGWARGLDMELVQVLNRVATGGRKPDITLLFDLPPEAGLKR
KTHY_BIFLO      QHVAETIRPALERGEVVITDRYLDSSLAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDPALSHHR
KTHY_CARHZ      QHVGEKIIPHLDKGVWVISDRYFDSTLAYQGYGRGFDLTLLKSFIAFATKGLIPDLTVLIDLPPEVGLSR
KTHY_CHLP8      ELMEKIIVPALEDGCDVILDRFFDSTTAYQGYGRGLNLDMLAEINRIASHGIRPDITFYLDLTPEDALLR
KTHY_CHLCH      ELVETLIRPALAEGKTVILDRFFDSTTAYQGHGRGISLEQLHSIIALSTGDLLPDVTFYLDLEPEEALRR
KTHY_BIFAA      QHVAEVILPALQRGAVVITDRYLDSSLAYQAGGRELTAAEIRNLSMWATNGLLPERTYLLDMDPAQSHAR
KTHY_PELLD      ELVSEVVRPALAEGKTVILDRFFDSTTAYQGYGRGLDLNMLRTLIAISTGALTPDITFYLDILPEEALIR
KTHY_SYMTH      EHVSRTIRPALEEGKVVICDRFVDSSLVYQGVAGGLPVEFLTQINEMATGALRPHRTIVLDLAPEVALRT
KTHY_PELCD      QHVAEVIRPALDQGKIVLCDRYCDATLAYQGYARGLDLPMVKQLNELAAGNCRPHLTLLLDMPHDRGLLR
KTHY_KOSOT      QIVREVIIPALKKKKLVLADRFLDSSVAYQGYGRGLSIQMVTTLNEFSTGGVTPHLTLFIDVPVDVAVKR
KTHY_PROVI      ELVNEVIRPALKEGTTVILDRFFDSTTAYQGYGRGIDLPTLNSIIALSTGGLKPDITFYLDILPEEALIR
KTHY_DINSH      DHLERLIQPALAEGRDVITDRFADSTRVYQGATRG-DLRALVDQLHSLMIGREPDLTFVIDMPPELALAR
KTHY_RHOSK      QHVRRVIAPALAQGQVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAEATGDLWPDLTLVLDLEAGIGLAR
KTHY_DESVH      QHVAQVVRPALDEGMVVLSDRYADSTVVYQGYGRGLDPMMLRQFNDVAVGGLWPDLTILLDLEPEAGLNR
KTHY_HALOH      QHVVELIKPALESGKVVLADRFIDSSIAYQGYGRGLDIDVVKTVNEWVIDGCWPDLTFVLDLDVEKGLER
KTHY_DESVV      QHVAQVVRPALDEGMVVLSDRYADSTVVYQGYGRGLDPMMLRQFNDVAVGGLWPDLTILLDLEPEAGLNR
KTHY_DESVM      QHVGQVIRPALDEGVVVLSDRYADSTVVYQGYGRGLDPERLRELNDMAVGGLWPDLTLVFDLPPEEGLRR
KTHY_GEOUR      QHVQEIVKPALAANKVVLCDRFTDATIAYQGYGRGLDPATIAYLNDLATDGLKPRLTVLLDCPVEVGLKR
KTHY_DESRM      QLVAQVIRPQLEQGTVVLCDRYIDSTLAYQGYGRGMDISFLAQINELASGGLMPNITILLDLPPEEGLQR
KTHY_DESAD      QHVGQVIKPAVEAGKIIISDRFADSTIVYQGYGRGLDPKLLRELNDVAVSGNWPDLTILLDIDPEIGLKR
KTHY_RHOS4      QHVRRVIAPALAQGRVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAEATGDLWPDLTLVLDLEAGIGLAR
KTHY_RHOS1      QHVRRVIAPALAQGRVVISDRYAGSTLAYQGTGRGLSEAFIRTLHAEATGDLWPDLTLVLDLEAGIGLAR
KTHY_SULSY      IHIQSIVKPSLDAGYIVLSDRYIDSTTAYQHYARGIDYEIVSYLNTLATDGLKPNLTFLIDIPVEISLKR
KTHY_THERP      EHVWDRIRPALERGTIVLCDRYVDSTLAYQGAGRGLDEGWLRELHRIATGDLWPDLTILLDVPVEVGLXX
KTHY_DEIRA      QLVREVLRPALERGETVLCDRYADSSLAYQGAGRGLSLPLLRQITAEXXXXXXXXXXXXXXXXXALGLQR
KTHY_PROA2      ELVQKVIKPALSDHATVLLDRFYDSTSAYQGYGRGLDLALLHQINRIASCSLEPDITFYLDLSPEDAMIR
KTHY_PELPB      ELVQEVIRPALASGKTIILDRFFDSTTAYQGYGRGIDMELLRSIIAISTCGITPDITFYLDLEPEEALKR
KTHY_METCA      HHLREVIEPALRRGDWVVCDRFTDASYAYQGAGRGIA-PGVIDFLRDWIQGLRPDLTLLLDAPVDTGLKR
KTHY_THETN      QLVEEKILPALSKGQMVIVDRFIDSSYVYQGYARGLGLEKVKIVNEIATKGLFPDITVYIDITPEEAIKR
KTHY_HERA2      QLVGEVILPYLKLGGIVLCDRYADSTFAHQGYGLGRNLTELREITRFATGGLQPDLTFFLDLPVEQGLQR
KTHY_GEOSF      QHVEEVIKPALADDCIVLCDRFTDATVAYQGYGRGLDLDSIGYLNQLATSGLKPQLTILLDCPVEVGLKR
KTHY_CHLTE      ELVQQVIQPALENDSDVILDRFFDSTTAYQGYGRGLDLDMLAEINRIASCRLVPDVTFYLDLTPEDALMR
KTHY_COXBU      QNIAHVVLPALRRGQWVLSDRFTDASFAYQGGGRGIPVKHIEELAGWVLGNLKPDLTLLLDAPVSVGLCR
KTHY_GLOVI      EHLARVVRPALASGAAVLCDRFSDSTVAYQGYGRGLDLGLIERLNAIATGGLLPDLTFWLKLDPQAGLRR
KTHY_THEMA      LLVTE-IKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKR
KTHY_METFK      EHIAEVIEPALARGAWVVSDRFTDASFAYQCGGRGVPCEKVEALEAWVHPDLQPDLTLLFDVPVEISVAR
KTHY_DESDG      QHVHQVIRPALAEGVAVISDRYADSTVVYQGYGRGLDPALLHRLNDVAVRGLWPDLTLLFDLEPEIGLKR
KTHY_PSEFS      QHLAEVIRPALARGAVVICDRFTDSTYAYQGGGRGLSLARIATLETFVQGDLRPDLTLVFDLPVEVGLAR
KTHY_LACAC      QHVEEIIKPAINEGKVVFSDRFVDSSLAYQGQGRDLGIAKVKQINDFATDKLDPDLTFFLDIAPEIGLSR
KTHY_ROSS1      QLVSEVIRPYLEQGGIVLCDRYADSTFAYQGYGLGRDLAELRVITAAATGGLRPDITFYLDISAAEGLER
KTHY_DEHE1      ILIDNVIKPALLDGNIVICDRYTDSTLAYQGYGRGLELDTVKCINSLASGGLVPDLTIWLDMDDKAALLR
KTHY_ROSCS      QLVSEVIRPYLEQGGIVLCDRYADSTYAYQGYGLGRDLAELRTITAAATGGLRPDITFYLDISAEDGLER
KTHY_RALPJ      EHIAEVIQPALDAGDWVISDRFTDATFAYQGGGRGLAIDRLEALEHWVQQGLQPTKTILFDLAPEIAAAR
KTHY_THIDA      QHLAELILPALARGAWVVSDRFTDASYAYQCGGXXXXXXXXXXLEDWVQRGFAPDLTLLFDVPPAVAEER
KTHY_THESQ      LLVTE-IKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDLATDGLIPDLTFYIDVDVETALKR
KTHY_THEEB      QHVAMGIRPQLQRGGIVLCDRYTASTVAYQGYGRGLDLQIIQHINQMATGGLGADLVLWLDLPVAVGLAR
KTHY_EXIS2      QHVNELIRPALAAGKIVLCDRFIDASIAYQGYGLGYTIEQVRSINQQATNHLTPDRTYLFDLTVSESKQR
KTHY_DEHSB      ILIDNVIKPALQDGKIVICDRYTDSTLAYQGYGRGLDLDTVKCVNSLASGGLVPDLTIWLDMDDKAALLR
KTHY_THEPX      QLVEEKILPAIEEGKIVLLDRFVDSSYVYQGYARGLGIEKVKVVNEIATMGILPDVTIYIDITPEEAMKR
KTHY_THEP3      QLVEEKILPAIEEGKIVLLDRFVDSSYVYQGYARGLGIEKVKVVNEIATMGILPDVTIYIDITPEEAMKR
KTHY_STRPS      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_RALSO      EHIAEVIQPALERGDWVISDRFTDATFAYQGGGRGLAIERLEALEQWVQQGLQPTRTLLFDLAPEVAAAR
KTHY_PSE14      QHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSQQRIAVLEEFVQGDLRPDLTLVFDLPVEIGLSR
KTHY_GEOSW      QHLLEKIIPAIKAGKIVLCDRFVDSSLAYQGFARGLGIDEILQINQFAIDGFFPSLTIYFDIDPKIGLER
KTHY_NITMU      EHLDKVILPALSRGEWVISDRFTDASFAYQGGGRGLSLQKLNELECWVQGEFQPDVTLYLDVSIASGRQR
KTHY_THEP1      LLVME-IKRYLSEGYVVLLDRYTDSSVAYQGFGRNLGKEIVEKLNDFATDSLVPDLTFYIDVDVETALNR
KTHY_STRPI      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_STRGC      QHLIEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDVADIEWLNQYATDGLKPDLTLYFDLDVEEGLAR
KTHY_DEHSC      ILIDNVIKPALQDGKIVICDRYTDSTLAYQGYGRGLDLDTVKCVNSLASGGLVPDLTIWLDMDDKAALLR
KTHY_BURCM      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_BURA4      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_SYNR3      QHVQTRLEPALAAGDWVLSDRYCGSTAAYQGYGRGLDLDLITQLEQLATAGLQPDLCLWLELSPELAAQR
KTHY_BURTA      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVPPQIASAR
KTHY_BURCH      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_BURCC      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_BURCA      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_STRZP      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_STRZJ      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_STRPN      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_STRP7      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_STRP4      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_CHLL2      ELVQQVILPAIDNGTTVILDRFFDSTIAYQGYGREIDQVMLQTIITLSTFSLQPDITFYLDISPENALMR
KTHY_STRR6      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_STRP2      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_JANSC      DHLERTIRPALASGRDVVTDRFADSTRVYQGATRGALRGLVDRIHAEAIEA-EPDLTLILDMDPELALAR
KTHY_ANAVT      QHVAQELKPKLAQGKYILCDRYVDSTIAYQGYGRNLDMNLIHQLNDIATGGLTSDITIWLDVDVEVGLAR
KTHY_STRZT      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_SILPO      DHLERTIEPALAAGRVVICDRFADSTRMYQGLSRG-DLRQLVDQLHALMIGREPDLTLLVDMDPETGLSR
KTHY_COPPD      EHVKKMIKPALAKGEWVVCERYADSTLAYQGYGMGLDKELINRMNEEAIDGLWPDKIFYLDIEPHLALAR
KTHY_CLAMS      HHVETVVRPALERGAVVLQDRYLDSSVAYQGAGRVLDAAEIRDLSLWAAQGXXXXXXXXXXXXQAAARIR
KTHY_BURS3      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_BURCJ      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDVAPQVASER
KTHY_STRPJ      QHLVEKVLPALEAGKLVIMDRFIDSSVAYQGFGRGLDIEAIDWLNQFATDGLKPDLTLYFDIEVEEGLAR
KTHY_PSEU2      QHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHQRIAALEQFVQGDLRPDLTLVFDLPVEIGLSR
KTHY_DESAP      QFTAEVVRPALARGEIVLSDRFLDSSLAYQGFGRGLELHRLRQVNFLATGGXXXXXXXXXXXXXXXXXXX
KTHY_CHLPD      ELVQQVIIPALQTDAVVILDRFYDSTRAYQGYGRGIDLTILETIIAFSTFNLIPDVTFYLDIKPEDAMIR
KTHY_LACLM      LHMQEKMLPALRAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDIDTDVALER
KTHY_GEOLS      QHLAEVVSPALAEGVIVLCDRFSDATRAYQSFGRGIDRQVIETLNSLACDGISPDLTVLLDCPVETGLGR
KTHY_LACH4      QHVEEIIRPALSEGKIVFSDRFVDSSLAYQGEGRDLGIEEVKQINDFATGKLDPDLTFFLDIAPEIGLSR
KTHY_EXISA      QNVEQVIRPALERGAIVLCDRFIDASIAYQGYGLQYDLDQIRSLNEWATNGLTPDLTFLFDLNPERASAR
KTHY_CHRVO      QHIAEVIEPALAAGRWLVSDRFTDSTYAFQGGGRGVPFERIRALEDWVQRGLQPDLTLLFDLPTEVAAGR
KTHY_BURVG      EHLARVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVAPQVASER
KTHY_PSEPF      QHLAEVIRPALARGAVVLCDRFTDSTYAYQGGGRGLSLERIAALETFVQGDLRPDLTLIFDLPVEIGLAR
KTHY_PELPD      QHVSEVIIPALKQGNIVLCDRFSDATLAYQGSGRGIAREKVDTLNQLACQSLRPDLTVLIDCDVSVGLER
KTHY_STRP3      QHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLDIQWLNEF---ATDGLEPDLTLYFDVPSEIGLAR
KTHY_CAUCR      DHIERVIRPGLARGAVVLCDRFADSTRAYQGAGGDAPASLIAALEEHVLGGTVPVLTLILDLPAEVGLQX
KTHY_BACCN      QHLVEKVMPALEADQLVLCDRFIDSSLAYQGYARGLGIDKVYEMNRFATEDCMPSLTIYLDIAPEVGLAR
KTHY_NOSP7      QHVEQELKPNLAAGKYILCDRYTDSTIAYQGYGRGLNMSLINQLNYIATAGLESDLTIWLDIDVEVGLTR
KTHY_SYNS3      QHVDRVIQPALERGDWVLSDRFTGSTMAYQGYGRGLNRELITDLERIATRGLTPDMTVWLDIPLALSVQR
KTHY_SYNAS      QHVREVILPSLARGQWILCDRFSDATAVYQGCVRGIDEAWIRQLDSFATSFLKPNLTLLFDLPAETGLHR
KTHY_PYRAB      EHVKKVILPALEKGKVVICDRYLYSSLAYQ-WARGLSLEWLMQINSFAPR---PDLAILLDLPVKESIRR
KTHY_PSESM      QHLAEVIRPALARGEVVLCDRFTDATYAYQGGGRGLSHERIAALEQFVQGDLRPDLTLVFDLPVEIGLSR
KTHY_STRSV      QHLTERVLPALAQGKLVLMDRFIDSSVAYQGYGRGLDVADIEWLNQFATDGLKPDLTLYFDIDVEEGLAR
KTHY_PYRHO      EHVKKIILPALSEGKVVICDRYFYSSLAYQ-WARGLDLNWLIQVNSFAPR---PDLAILLDLPVKESLRR
KTHY_LACLA      LHMQEKMLPALQAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDVDTDVALER
KTHY_NEIMF      QHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMAR
KTHY_NEIMA      QHIEDVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMAR
KTHY_BURPP      QHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDLAPEIANER
KTHY_TROWT      ENIAKNVIPALNAGKVVLQDRYLDSFLAYQLADNKLVETDIMRLFEFSSQGLRPDLTLLFDLTPACAQER
KTHY_TROW8      ENIAKNVIPALNAGKVVLQDRYLDSFLAYQLADNKLVETDIMRLFEFSSQGLRPDLTLLFDLTPACAQER
KTHY_SYNPX      QHVERLILPTLERGDWVISDRFSGSTMAYQGYGRGLDRQLIDQLERIATAGVQPDLTLWLTLPLEESLRR
KTHY_CLAM3      HHVETVVRPALDRGAVVLQDRYLDSSVAYQGAGRVLDAGEIRELSLWAAQGXXXXXXXXXXXXQAAARVR
KTHY_AGRT5      DHVEEVIRPALARGEIVLCDRFLDSSRVYQGTTGNLEPDFIETLQRIAIDGVVPELTLIFDIAAEKGLAR
KTHY_MESSB      DHVEQVIRPAVESGAIVLCDRFLDSSRVYQGVTGGLASDFMAALERVTVNGLIPDLTVILDIDPEEGLRR
KTHY_LACLS      LHMQEKMLPALRAGKVVIVDRFIDSSVAYQGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDIDTDVALER
KTHY_BURP8      EHLAQVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVPPDTASER
KTHY_PYRFU      EHVKKIIEPALREGKVVISDRYFYSSLAYQ-WARGLNLEWLIEINKFAPH---PDIAILLDIPPREGIKR
KTHY_NEIMB      QHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLKPDLTLLLDVPLEVSMAR
KTHY_BURPS      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BURP1      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BURP0      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BACP2      QHLAEKVEPALQRGETVLCDRFVDSSLAYQGYARGLGIDQVRSINDFAIDGTMPQMTIYFSITPEEGLKR
KTHY_BACCR      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKIFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACC2      QHLVEKVMPALNENYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_ACISJ      DHLRCVIEPALARGEVVLCDRFTDATFAYQGAGRGFDLEVLSYMERLAQTGVNPDLTLWFDVPPEVAAQR
KTHY_ACIBY      QHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSSM-PEVTFWLDAPIELGMNR
KTHY_ACIB5      QHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSSM-PEVTFWLDAPIELGMNR
KTHY_ACIB3      QHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSSM-PEVTFWLDAPIELGMNR
KTHY_NEIG2      QHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMAR
KTHY_NEIG1      QHIEEVILPALSDGIHVVSDRFTDATFAYQGGGRGMPSEDIEILEHWVQGGLRPDLTLLLDVPLEVSMAR
KTHY_LACJO      QHVSEVIRPALATGKVVLSDRFIDSSLAYQGVGRNLGIEEVKQINDFGTGGLEPDLTIFLDLDPAVGLAR
KTHY_DESAH      QHLSEVIIPALGAGKTVVCDRFTDATTVYQGAARGISKELIDIIHSVVVKDLCPDLTILFDLDPETGLAR
KTHY_BURP6      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BURMS      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BURMA      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BURM9      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BURM7      EHLALVIEPALARGDWVVSDRFTDATFAYQGGGRGLPRDKLEALERWVQGGFQPDLTVLFDVQPQVASAR
KTHY_BACCQ      QHLVEKVMPALNKDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACC4      QHLVEKVMPALNEKYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_ACIBS      QHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRM-PEVTFWLDAPIELGMNR
KTHY_ACIBC      QHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRM-PEVTFWLDAPIELGMNR
KTHY_STRP6      QHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLDIQWLNEF---ATDGLEPDLTLYFDVPSEIGLAR
KTHY_STRP1      QHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLDIQWLNEF---ATDGLEPDLTLYFDVPSEIGLAR
KTHY_BACWK      QHLVEKVMPALEENYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACHK      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACCZ      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACAN      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACAC      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACAA      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_STRPZ      QHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLDIQWLNEF---ATDGLEPDLTLYFDVPSEIGLAR
KTHY_FERNB      QLVESVIKPALKNGKIVIADRFAHSSVAYQGCGRELGPETVKILNDFATDKTYPDIVFYIDVPVNVAMER
KTHY_BACC7      QHLVEKVMPALNEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACC3      QHLVEKVMPALNDDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_BACAH      QHLVEKVMPALNDDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_STRU0      QHLVEKVLPSLSAGKLVFIDRFIDSSVAYQGEGRGLDIEWLNDF---ATDGIKPDLTLLFDVPSEIGIAR
KTHY_PYRKO      EHVDKLIKPSLEAGKVVISDRYFYSSLAYQ-WARGLDLEWLIDLNRFA---VKPDIVFLLDLPVKESMNR
KTHY_POLSJ      DHLVRVIAPALVRGDVVLCDRFTDATFAYQGAGRGFDLQWVQSMKPEVETVIEPHLTVWFDLPPEEALQG
KTHY_GEOTN      QHLLEKIVPALEAGRVVLCDRFVDSSLAYQGFARGLGVEEVWKINEFAIDGYMPSLTVYFDIDPQIGLER
KTHY_BACC1      QHLVEKVMPALDEDYLVLCDRFIDSSLAYQGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLAR
KTHY_ACIBT      QHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFVSRM-PEVTFWLDAPIELGMNR
KTHY_TRIEI      QHIEALIKPCLERGTIVLCDRFIDSTIAYQGYGRGLDVELIKQLNYIATGGLKSDLTFWLDIDVEIGLAR
KTHY_LISW6      QHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMDMEQVLQVNLYAIEDTIPDRTYYLDVPAEVGLAR
KTHY_CHLMU      QHIQEKILPALESGKTVICDRFHDSTIVYQGIAGGLGEAFVTDLCYRVVEPFLPDITFLLDLPKEGLLRK
KTHY_ACAM1      QHVSSCLLPHLQQGALVLCDRYTDSTIAYQGYGRELDLTLIHQLNQIATQGLVSDLTFWLDIDPEFGLAR
KTHY_STRPG      QHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLDIQWLNEF---ATDGLEPDLTLYFDVPSEIGLAR
KTHY_STRP8      QHLVEKVLPALEAGQLVFIDRFIDSSVAYQGAGRGLDIQWLNEF---ATDGLEPDLTLYFDVPSEIGLAR
KTHY_PSEPW      QHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAALEQFVQGELRPDLTLVFDLPVEVXXXX
KTHY_PROM2      EHVYKIISPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGESPDLTFFLEISPEESIRK
KTHY_SYNS9      QHVDTVIRPALLRGDWVLSDRFAGSTLAYQGYGRGLDRQLITRLESIATTGLEPDLTAWLMVPVEVSLQR
KTHY_RALEH      EHIAEVIAPALERGKWVISDRFTDATFAYQGGGRGLATERLEVLEDWVQGGLQPDLTLLFDVPLETASER
KTHY_CHLTR      QHIQEKIIPALKSGKTVISDRFHDSTIVYQGIAGGLGESFVTNLCYHVVKPFLPDITFLLDIPAEGLLRK
KTHY_ACIAD      QHLQQVIVPALADEKLVLSDRFTDASYAYQCVGRGLSKDKLNTLNQTFVSHM-PDITFWLDAPIELGMSR
KTHY_GEOSM      QHVQEVIVPALERGETVLCDRFTDATVAYQGHGRGLDLSVIEELNTLATGRVQPALTVLIDCPVEVGLSR
KTHY_DICNV      EHLQTVILPHLAAGTWVISDRFNDATYAYQGYGRGIDLKIIKTLEQIIQASFQPDLACILCLPEHIAAER
KTHY_ANASP      QHVAQELKPKLAQGKYILCDRYVDSTIAYQGYGRNLDMNLIHQLNDIATGGLTSDITIWLDVDVEVGLAR
KTHY_CLONN      QHLAERVIPAIKEGKVVICDRFIDSSLAYQGYARGIGIDEVMAINEFAIDGYMPDLTLYLDIEPEVGLKR
KTHY_LACDB      QHVSEIINPALKRGDLVMSDRFVDSSLAYQGQGRGLGIDEVAQINAFATGHLEPDLTIFLDLDPAQGLAR
KTHY_LACDA      QHVSEIINPALKRGDLVMSDRFVDSSLAYQGQGRGLGIDEVAQINAFATGHLEPDLTIFLDLDPAQGLAR
KTHY_GEOBB      QHVQEVIVPALERGETVLCDRFTDATVAYQGHGRGLDLTVIEELNTLATGRVQPALTVLIDCPVEVGLSR
KTHY_BRASO      DHVRNVILPALNQGSWVLCDRFFDSTRAYQG-SQGKVAPDVLNAMQRVTIGLKPDLTLILDVPVEVGLQR
KTHY_BRAJA      DHVHTVIEPALKQGIWVLCDRFADSTRAYQG-SLGSVSPGLINAMQRVTIGLKPDLTIILDLPVEIGLQR
KTHY_RALEJ      EHIAEVIEPALARGDWVISDRFTDATFAYQGGGRGLATSRLETLETWVQDGLQPDLTLLFDVPLETASER
KTHY_MESFL      EHLEKVIKPYLKKGYIVISDRFMDSTTAYQGGARGLGVDYLNELQKNILEGFLPDLTLYFELSFEDAEKR
KTHY_CHLTA      QHIQEKIIPALKSGKTVISDRFHDSTIVYQGIAGGLGESFVTNLCYHVVKPFLPDITFLLDIPAEGLLRK
KTHY_BACSK      EHLIKKIVPALAEGALVLCDRYIDSSLVYQGHARGIGMEEVRAINGFAIETYMPDLTLYFDVEPEIGLER
KTHY_NITEC      EHLDKVILPALERGAWVISDRFTDASFAYQGGGRGVPSARLEILEQWVQKGFSPDLTVYFDVPVTISRQR
KTHY_LISIN      QHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTIPDRTYYLDVPAEVGLAR
KTHY_DESDA      QHVTEVIRPALEAGQVVLCDRFTDSTLAYQGYGRGLDTEYLRSLNTAAXXXXXXXXXXXXXXXVRCGLER
KTHY_PSEF5      QHLATVIRPALERGAVVLCDRFTDSTYAYQGAGRGLSLARIAALEDFVQGELRPDLTLVFDLPVDVGLAR
KTHY_LAWIP      QHVSECIQPAIMNGKTVFCDRYADSTIVYQGYGRGMNIGKLWEFNEVAIKGIWPQKTLLLDIDVEKALER
KTHY_BURXL      QHLAEVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLETLERWVQGGFQPDLTVLFDLDPEVASER
KTHY_WOLTR      EHVKKVILPALKKGKIVICDRFIDSTIAYQGYGLGVDLELIRDL-HKLVKIKYPDTTFILDIDVQIGLSR
KTHY_PSEU5      QHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSLERIAQLETFVQGDLRPDLTLIFDLPXXXXXXX
KTHY_PSEPG      QHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIATLEQFVQGGLRPDLTLVFDLPVEVXXXX
KTHY_PSEE4      QHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAILESFVQGELRPDLTLVFDLPVEVXXXX
KTHY_PROMA      QHVSQVIQPKINNGDWVISDRFSSSTLAYQGFGRRLDKSLIKELENIATQGITPDLTFLLEIPVSESIKR
KTHY_CUPTR      EHIAEVIAPALERGKWVISDRFTDATFAYQGGGRGLATERLEVLENWVQGSLQPDLTLLFDVPLETASAR
KTHY_ACIAC      DHLRSVIAPALVRGEVVLCDRFTDATFAYQGAGRGFDRAVLAQLERITQSGLQPHLTLWFDLAPDVAAAR
KTHY_WOLPP      EHMKELILPALKEGKTVICDRFIDSTIAYQGYGLGVDLSLIRDL-HKLVEIKYPDITFILDIDVQVGLSR
KTHY_PSEP1      QHLAQVIRPALARGAVVLCDRFTDATYAYQGGGRGLSVERIAVLEQFVQGDLRPDLTLVFDLPVEVXXXX
KTHY_LACSS      QHIVEKIQPALAADKLVICDRFVDSSIAYQGAGRGIGEEAVAQMNLFATDGLTPDLTLYLDVPSEVGLAR
KTHY_LACF3      QHVVETLKPALEAGKLILCDRYLDSSIAYQGGGRELGIDRIWELNQYAIDGLLPDLTIFLDLPVETGLAR
KTHY_HAHCH      QHLEQKIKPTIERGVHVLSDRFTDATYAYQGGGRGLSWAMIQDLEKLVQAGFKPDLTLLLRIDPETGMAR
KTHY_ALHEH      EHLDKRIWPALERGQWVVCDRFTDASYAYQGWGRGLGAERIAALEDWTQGALRPDLTLWLDVPVETGLAR
KTHY_SYNPW      QHVQRRILPALACGDWVLSDRFSGSTLAYQGDGRGLDRALILDLERIATAGLVPDVTLWLDLSLEASMRE
KTHY_LEIXX      HHVATVVRPALERGEVVLQDRYLDSSVAYQGAGRVLDAGEVRELSLWAAEGXXXXXXXXXXXXXXXARAR
KTHY_CHLTB      QHIQEKIIPALKSGKTVISDRFHDSTIVYQGIAGGLGESFVTNLCYHVVKPFLPDIIFLLDIPAEGLLRK
KTHY_CHLT2      QHIQEKIIPALKSGKTVISDRFHDSTIVYQGIAGGLGESFVTNLCYHVVKPFLPDIIFLLDIPAEGLLRK
KTHY_CHLCV      EHITKKIFPALESGNIVICDRFHDSTIVYQGIAEGLGKEYVTSLCHHVVGEKKPDLTCLLDIPADEGLRR
KTHY_BRASB      DHVRNVILPALSQGSWVLCDRFFDSTRAYQGSLGKVAPDVLNAMQRVTIGDLKPDLTLILDVPVEVGLKX
KTHY_BARQU      DHITEVIAPSLQKGKIVLCDRFIDSTRVYQGLNNTVGSSVLSVLEYVALNGIMPCLTFLLDIPARCGMER
KTHY_AQUAE      KLIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKGLDVEFIKNLNEFATRGVKPDITLLLDIPVDIALRR
KTHY_STRA5      QHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPSEVGLER
KTHY_STRA3      QHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPSEVGLER
KTHY_STRA1      QHLVEKVLPALEEGKIVLMDRFIDSSVAYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPSEVGLER
KTHY_ONYPE      EHLSKLIIPALQQNKIVICDRYLDSTIAYQVYARGLSQDFVLNINNFALNYI-PNITFYLDLDPKIGIQR
KTHY_METAC      EHLAKLVKPALEDGKTVISDRYSDSRYAYQGIRLDNPLEWVRDLHRGWT--VIPDLTFLFDIEPEIAVKR
KTHY_LISMF      QHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPAEVGLAR
KTHY_LISMC      QHVVETIRPALAAGKTVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPAEVGLAR
KTHY_LACCB      QHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLKMNQFATAGLEPALTLYLDVPVQVGLDR
KTHY_LACC3      QHLVEVIQPALAQGDIVVCDRFVDSSVAYQGGGREIGPDAVLKMNQFATAGLEPALTLYLDVPVQVGLDR
KTHY_GEOSL      QHVAEVIAPALAEGAVVLCDRFTDSTLVYQGFGRNLDRDLIARLNTLAAGQIRPDLTILLDCPVAVGLRQ
KTHY_ENTFA      QHLVEKILPALEAGHLVLCDRFVDSSLAYQGAGRRIGIAPIASINAFATEGVSPDFTIYLDVDSDTGLRR
KTHY_BACA2      QHLAEKVQPALKEGRIVLCDRFIDSSLAYQGYARGLGIDEVLSINQFAIGDTMPDVTIYFSIEPEEGLKR
KTHY_ALCBS      QHLEQKIRPALARGEWVLCDRFLDATWAYQGAGRGLDSAAIAALEALVIRDTRPDMTILFDVPVEVGMAR
KTHY_PARUW      QHIEELIQPALKAGKIVLCDRFNDSTIAYQGAARGLNAKKIQEFCQLVCAEILPNWTLFLDVSPEIGLAR
KTHY_METMA      EHLAKLVKPALANGKNVISDRYSDSRYAYQGVTLKSPLEWVRSLHSGWT--VVPDLTFLFDIEPEIAVER
KTHY_THEON      EHVHKLIKPSLKTGKIVISDRYFYSSLAYQ-WARGLDLEWLIDLNRFAVR---PDLVILLDLPVKESMKR
KTHY_LISMO      QHVVETIRPALAAGKSVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPAEVGLAR
KTHY_BACLD      QHLVEKVKPALEEGKIVLCDRFIDSSLAYQGYARGLGIDEVFSVNQFAIGSLMPNVTIYFDIDPEEGIKR
KTHY_LISMH      QHVVETIRPALAVGKTVLCDRFMDSSLAYQGAGRDMDMEQVLQVNLYAIEDTLPDRTYYLDVPAEVGLAR
KTHY_BARHE      DHVSEVIMPSLQKGKVVLCDRFIDSTRVYQGLNDKVSSSTLAVLECLALNKIKPQITFLLDIPARCSMKR
KTHY_STRS7      QHLVEKIMPALEAGHLVLVDRFIDSSVAYQGAGRGLDKQAIQWLNHFATDGVDPDLTLYFDVPSELGLAR
KTHY_PROM5      EHVSKIISPALKKEDWVISDRFSDSTLAYQGYGRHINLEIIKNIESIVCQGEYPDLTIFLEISAEESILR
KTHY_CHLPN      QHIQEVIIPALRDGYIVICERFHDSTIVYQGIAEGLGADFVADLCSKVVTPFLPNFVLLLDIPADIGLQR
KTHY_CHLAB      QHITEKILPALELGKIVVCDRFHDSTIVYQGIVGGLGKEYVTNLCHSVVKKILPNLTCLLDIPADEGLKR
KTHY_STRMU      QHLVERILPELKKGNLVLVDRFIDSSVAYQGYGRGLDADAVTWLNNFATDGLQPDLTLYFDVDSQIGLTR
KTHY_STAS1      EHLVGKVIPSLENGKLVLCDRYIDSSLAYQGYARGIGIEEVKSINEFAINGLYPDITIYLDVSRERILKN
KTHY_WOLPM      EHMKKLILPALAEGKIVICDRFIDSTIAYQGYGFGVDLRLIRDL-HKLVEIKYPDITFILDIDVKVGLNR
KTHY_STRE4      QHLVEKIMPALESGHLVLVDRFIDSSVAYQGAGRGLDKQAIQWLNHFATDGVDPDLTLYFDVPSELGLAR
KTHY_MARMS      QHLAEKIQPALEKGTWVISDRFLDSSYVYQGKARGGDIAMLDQLANWVVGDNKPDATLVLDVPVELGQER
KTHY_GLUOX      DHLDNAILPALERGEIVVCDRFHDSTLAYQGYGIGQGAPEVLAFLNGARKDFEPDLTLMLELPRPQALAR
KTHY_BACSU      QHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKR
KTHY_THESM      EHVKKLIEPSIKAGKVVISDRYFYSSLAYQ-WARGLDLNWLINLNAFAPRA---DLVILLDLPVKESINR
KTHY_CHRSD      QHLAARIRPALARGAWVVCDRFTDATFAYQGGGRGLDETRIATLEALVQQGLQPDLTLLLDMPVEAAXXX
KTHY_VESOH      EHIKTKIIPALNRGDWVLSDRFTDASYAYQGGGRGLSIERIALLEQWVLQDFSPDVTLLLDVPVALGMLR
KTHY_RUTMC      EHIRTKIIPSLEKGDWVLSDRFTDASYAYQGGGRGLSIERITQLEKWVLQDFTPDVTLLLDVSVALGMSR
KTHY_RHOFD      DHLQQLIEPALARGDVVLCDRFTDATFAYQGAGRGFDLKILSFLERQSIQGLEPDLTVWFDLXXXXXXXX
KTHY_NITEU      EHLDKVILPALDRGAWVVSDRFTDASFAYQGGGRGVAQSKLDNLEQWVQAELSPDLTVYFDVPGRERLQS
KTHY_LEUCK      QHIVETILPALSAGKVLISDRYVDSSLAYQGGGRDLGVDNIWQINQFAIDGLLPDLTIYFDVPSELGLSR
KTHY_PROMP      EHISKTISPALENQDWVLSDRFCDSTLAYQGYGRNINLEIIKNIESIVCQGESPDLTIFLEISAEESVLR
KTHY_PROM9      EHISKIISPALNNNDWVISDRFSDSTLAYQGYGRKINLEIIKKVESIVCQGEYPDLTFFLEISPEESIMR
KTHY_SYNSC      QHVETLIRPALERGDWVISDRFSGSTLAYQGYGRGLDRDLIQRLEQIATAGLQPDITLWLRLSVQESLQR
KTHY_RALME      EHIAEVIEPALARGDWVISDRFTDATFAYQXXXXXXXXXXXXXXEQWVQSGLQPDLTLLFDVPLETASAR
KTHY_PROM0      EHVSKIILPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGASPDLTFFLEISPEESIRK
KTHY_CYAP4      QHVATRLQPHLEAGGLILCDRFTDSTVAYQGYGRGLSLALIDQLNQIAXXXXXXXXXXXXXXXVEMGLER
KTHY_BACHD      QHLVEKVLPALEAGHVVLCDRFIDSSLAYQGYARGIGFEDILAINEFAIEGRYPDLTLLFRVDPDVGLSR
KTHY_PSEMY      QHLQQVIRPALAKGCVVLCDRFTDATYAYQGGGRGLSIERIAQLEQFVQGELRPDLTLIFDLPVEVXXXX
KTHY_MYCS5      IHIDKVILPALAQNKIVFCDRYYDSFYAYQGYGRNLGMEFTKTLTELAVGKTIPNLTFFFDISPETRKRR
KTHY_LACRJ      QHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQINQFAIDGLMPALTIYLDIESEIGLKR
KTHY_LACRD      QHIVSEIIPGLKAGKVILCDRFVDSSIAYQGAGRGLGEKEIWQINQFAIDGLMPALTIYLDIESEIGLKR
KTHY_AYWBP      EHLSKLIIPALQQNKIVICDRYLDSTIAYQVYARGLSKDFVLNINNLALNYM-PNITFYLDLDPKIGIQR
KTHY_LACBA      QHLAQTILPALAADKLVLCDRYVDSSVAYQGAGRQIGEDAVAQMNTFATDGLLPAVTVYFDVPAEIGLRR
KTHY_CHLFF      QHITEKIIPALESGKIVICDRFHDSTIVYQGIAEGLGKEYVTNLCHHVVGEKKPDLTCLLDIPVDTGIKR
KTHY_ANOFW      QHLVEKVIPALKDGKVVLCDRFIDSSLAYQGVARGLGIDEILAINAFAIENWMPILTIYFDIDPSLGLAR
KTHY_PSEA7      QHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIXXXX
KTHY_METBF      EHLAKLIKPALENGKIVISDRYSDSRYAYQGITLKTPLEWVKDLHRSWT--IVPDLTFLFDIRPEISIER
KTHY_ACHLI      QHLDEVIIPNL--DKVILCDRYIDSSYAYQAFGRNLGMEFVQSINSYALKYL-PDLTFYIDLDPKTGIDR
KTHY_PSEAB      QHIAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEVRIAALESFVQGDLRPDLTLVFDLPVEIXXXX
KTHY_JANMA      EHIAQVIAPALERGDWVISDRFTDATFAYQGGGRKLDRAKLNALEQWVHPHLQPHLTLLFDVPLDVARAR
KTHY_STAHJ      EHLVEKVVPALNDNKIVLCDRYIDSSLAYQGYARGIGIEEVKQLNDFAINGLYPDLTIYLDITAEVGLKN
KTHY_PSEAE      QHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIXXXX
KTHY_PSEA8      QHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIXXXX
KTHY_PYRCJ      EHYKREIEPKLREGYIVITERYVESSIAYQG-AAGVPIEYILYINSVVPR---PHLTIILDVDPAEAIKR
KTHY_PROMS      EHVSKIISPALNNNDWVISDRFSDSTLAYQGYGRNINLEIIKNIESIVCQGASPDLTFFLEISPEESIRK
KTHY_NITHX      DHVHTVIKPALEQGIWVLCDRFADSTRAYQG-RLGDVLPGVLNALERVTIGLKPDLTVILDVPVEIGMQR
KTHY_RHOPB      DHVHTVIEPALAQGSWVLCDRFTDSTRAYQGQMGAVAPALLNAMQRVTIGDLKPDLTIILDVPVEIGVKR
KTHY_LEUMM      QHLVENIKPALDQNKIVISDRYVDSSLAYQGGGRGLGIDNIWEINQFAIDGLLPDMTIYLDVPVEIGLAR
KTHY_STRTD      QHLVEKVLPELENGNMVIMDRFIDSSVAYQGAGRGLDQDEVAWLNNYATDGHKPDLTLLFDVDSETGLAR
KTHY_STRT2      QHLVEKVLPELENGNMVIMDRFIDSSVAYQGAGRGLDQDEVAWLNNYATDGHKPDLTLLFDVDSETGLAR
KTHY_STRT1      QHLVEKVLPELENGNMVIMDRFIDSSVAYQGAGRGLDQDEVAWLNNYATDGHKPDLTLLFDVDSETGLAR
KTHY_PROAC      QHVDEVVIPALREGKVVVCDRYVDSTIAYQGAGRALDPGEVGQLACWAXXXXXXXXXXXXXXXXCEGAGK
KTHY_GEOKA      QHLLEKIVPALEAGCVVLCDRFVDSSLAYQGFARGLGIEEVWKINEFAIDGYMPSLTIYFDIDPQXXXXX
KTHY_THEAB      QLVEEVIKPHLKRGFFVLADRFSDSSIAYQGGARNIGVETVSTLNDFATDNIYPDIVFYIDIPTKIAMER
KTHY_SHEAM      QLVANVIKPSLASGRWVLGDRHNLSSIAYQGGGRGL-MSLVKTISDATLGGFKPDLTLYLDIDPLLGLER
KTHY_PROMM      QHVAQLIRPALEQGHWVLSDRFSGSTLAYQGYGRXXXXXXXXXXXXXATAGLVPDLTFWLELPVEESLRD
KTHY_FRATW      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_FRATT      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_FRATO      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNNNFLNGCEPDLVIYLDIDPILGLQR
KTHY_FRAT1      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_BLOPB      QLIENVIKPALSKGYWVIGDRFDLSSQAYQGGGRGIDILLLHALSNKITNTLSPDLTFYLDISPELSISR
KTHY_PEDPA      QHLVETILPALKKNHVVFCDRFVDSSIAYQGAGRKIGTDAVYQMNLFATEGALPEKTIYLDVPSELGLKR
KTHY_FRATN      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_OENOB      QHMVEKIEPALADGKIVLSDRFVDSSIAYQGGGRELGIEAVGEINNFATNGXXXXXXXXXXXPSEVGIAR
KTHY_LACS1      QHLVDTVLPALNEGKLVLCDRFVDSSVVYQGVARDIGVEPVIKLNEFATENLKPDLTLYYDVEPEISLKR
KTHY_HERAR      EHIAQLIEPALARGDWVISDRFTDATFAYQGGGRKLDRQKLSVLEQWVHPHLQPDLTLLFDVPLDVARAR
KTHY_FRATH      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_FRATF      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_FRATM      QHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQR
KTHY_STAAW      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAAS      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_SHESR      QLVANVIKPALAEGKWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPDLTLYLDLDPKLGLQR
KTHY_SHESM      QLVANVIKPALAEGKWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPDLTLYLDLDPKLGLQR
KTHY_RHILO      DHVEQVIRPAVERGSIVLCDRFLDSSRVYQGVTGGIDPAFMATLEQIAINGMMPDMTLIFDIDPAEGLRR
KTHY_PROM4      EHIHSLIQPKLDKGDWVISDRFSGSTLAYQGFGRGLDINLIRRLDAIARQGLVPEITIFLKISVLTSMRR
KTHY_KLEP7      QLVETVIKPALARGQWVIGDRHDLSTQAYQGGGRGIDRTMLATLRDAVLGDFRPNLTLYLDVTPEVGLQR
KTHY_EHRRW      EHFMKVIKPALTQQKIVICDRFIDSTIAYQGYGHGIDCKLIEEL-NDLVVDIYPNITFVLDSDINQSVAR
KTHY_EHRRG      EHFMKVIKPALTQQKIVICDRFIDSTIAYQGYGHGIDCKLIEEL-NDLVVDIYPNITFVLDSDINQSVAR
KTHY_KLEP3      QLVETVIKPALARGQWVIGDRHDLSTQAYQGGGRGIDRTMLATLRDAVLGDFRPNLTLYLDVTPEVGLQR
KTHY_HAEDU      QLVENVIKPALSAGKWVLGDRHDMSSQAYQGGGRQLDVALLNSLKESVLGPFEPDLTIYLDIDPAIGLAR
KTHY_ANAMM      ESFVKVVLPGLLAGKIVISDRFTDSTVAYQGYGCGVDLA-LVGMLNSLVADVVPDITFVIDASIELALAR
KTHY_ANAMF      ESFVKVVLPGLLAGKIVISDRFTDSTVAYQGYGCGVDLA-LVGMLNSLVADVVPDITFVIDASIELALAR
KTHY_STAES      EHLVEKIIPSLQAGKIVLCDRYIDSSLAYQGYARGIGIKEVKLLNEFAINGLYPDLTIYLDVDAEIGRQR
KTHY_STAEQ      EHLVEKIIPSLQAGKIVLCDRYIDSSLAYQGYARGIGIKEVKLLNEFAINGLYPDLTIYLDVDAEIGRQR
KTHY_STAAR      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAAN      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAAM      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAAC      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAAB      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAA9      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAA8      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAA3      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAA2      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_STAA1      EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
KTHY_NITWN      DHVHTVIKPALEQGIWVLCDRFADSTRVYQGQ-LGNVLPGVLNAMERVTIGLKPDLTVILDVPVEVGLQR
KTHY_EHRCR      EHFVKIIKPSLMQKKIVICDRFIDSTIAYQGYGQGIDCSLIDQL-NDLVIDVYPDITFIIDVDINESLSR
KTHY_DESMR      QHVAEVIRPALAAGQVVVCDRYTDSTVAYQGYGRGLDTTLLQNLNAVAAAG-------------------
KTHY_RHIME      DHVEEVIRPALEQGTIVLCDRFMDSSRVYQGVTGNLEPAFVETLERVAVNGVIPDCTIIFDLPASVGLER
KTHY_CLOB8      QHLVEKVIPALNQGVIVLCDRFIDSSLAYQGYARNLGIEEVLSINKFAIGEYMPDISVLFDLDPKIGLAR
KTHY_ACTSZ      QLVENVIKPALAAGKWVIGDRHDLSSQAYQGGGRGLDRHFMQTLKDSVLGGFEPDFTLYLDIEPAEGLAR
KTHY_YERE8      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDINLMTSLRDTVLGEFRPDLTLYLDLPPVIGLAR
KTHY_MAGSM      EHIRQVIRPALASGHWVLCDRFEDSTLAYQXXXXXXXXPWLRQLGQWIRGDVFXXXXXXXXXXXXVGLAR
KTHY_EDWI9      QLVENVIKPALARGAWVVGDRHDLSSQAYQGGGRGIDTHLMQTLRDTVLGDFKPDLTLYLDIPPQQGLER
KTHY_THEGJ      EHVHKLIKPALESGKVVISDRYFYSSLAYQ-WARGLDLQWLIDLNRFA---XXXXXXXXXXXXXKESMRR
KTHY_BRUSU      DHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_SHEON      QLVANVIKPALAQGNWVLGDRHNLSSLAYQGGGRGL-MPLVEAVSNATLKGFKPDLTLYLDLDPKLGLQR
KTHY_BRUO2      DHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_BRUME      DHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_BRUMB      DHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_BRUA1      DHVDQLIRPTLAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_OCEIH      QHLVEKVFPALEQGKVVLCDRFVDSSLAYQGYARGLGIDEVYAINHFVIQDCMPDLTLFFDIEPKKGLER
KTHY_BRUSI      DHVDQLIRPALAEGRIVLCDRFIDSSRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_HALHL      EHLAQVIRPTLDAGRWVISDRFTDATYAYQGGGRGLGDERIAVLERWVHGGFTPDRTLLLDVDPTVGRSR
KTHY_ENTS8      QLVETVIKPALARGEWVIGDRHDLSTQAYQGGGRGIDRQLLATLRQAVLGDFAPDLTLYLDVDPRIGLER
KTHY_BRUC2      DHVDQLIRPALAEGRIVLCDRFIDSGRAYQGVTGNLDATYMAAIERIAIDGAMPDLTLVLDICAERGLSR
KTHY_SALAR      QLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_PROM3      QHVAQLIRPALEQGHWVLSDRFSGSTLAYQGYGRXXXXXXXXXXXXXATAGLVPDLTFWLELSVEESLRD
KTHY_PELTS      XXXXXXILPALREGKVVLCDRFTDSSLAYQGYGRGVDIEMLEQVNRPAAAGXXXXXXXXXXXXREGQTER
KTHY_YERPY      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPS      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPP      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPN      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPG      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPE      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPB      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERPA      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_YERP3      QLVENVIKPALARGSWVVGDRHDLSSQAYQGGGRGIDSQLMASLRDTVLGEFRPDLTLYLDLPPAVGLAR
KTHY_SALTY      QLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALTI      QLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALSV      QLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALDC      QLVETVIKPALAQGVWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_RICM5      DHMARKIIPALQEGHIVICDRFIDSTACYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIKR
KTHY_RICBR      DHMVKKIIPALQAGNIVICDRFIDSTACYQGLELENGIELVYNLHKDLMPPLMPDLTFFIDVESSIAIER
KTHY_PSYWF      DHLAQVIMPALSAGKWVICDRFIDSTVAYQGYGRGFGNADMLHKIEALIAGFVPRLTLWLDLPVAEGMQR
KTHY_NEOSM      DHYNKVILPALKEGKVVVCDRFIYSTLAYQGYGDKIDLQTILDLHRLSGCLVEPDXXXXXXXXXXXXXXR
KTHY_ECOL6      QLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGVRPDLTLYLDVTPEVGLKR
KTHY_ACTPJ      QLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHLLETLKETVLGNFEPDLTIYLDIDPAVGLAR
KTHY_ACTP7      QLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHLLETLKETVLGNFEPDLTIYLDIDPAVGLAR
KTHY_ACTP2      QLVENVIKPALAEGKWVLGDRHDMSSQAYQGGGRQIDRHLLETLKETVLGNFEPDLTIYLDIDPAVGLAR
KTHY_SALPK      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALPC      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALPB      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALPA      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALNS      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALHS      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALG2      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALEP      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALCH      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_SALA4      QLVETVIKPALAQGIWVIGDRHDLSTQAYQGGGRGIDQTMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
KTHY_RICCK      DHMVRKIIPVLKEGYIVICDRFLDSTACYQGLELENGIDLVYNLHKTLMPPLMPDITFFIDVEPDTAIKR
KTHY_RICB8      DHMVKKIIPALQAGNIVICDRFIDSTACYQGLELENGIELVYNLHKDLMPPLMPDLTFFIDVESSIAIER
KTHY_ECOUT      QLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGFRPDLTLYLDVTPEVGLKR
KTHY_ECOK1      QLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGFRPDLTLYLDVTPEVGLKR
KTHY_ECO45      QLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGGFRPDLTLYLDVTPEVGLKR
KTHY_RICAE      DHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIKR
KTHY_METMJ      AHIDTVIRPALDEGRLVISDRYADSRFAYQPVVDGVPLSWLRRI--HEGWSIRPDRTFLLVLPVEDAVSR
KTHY_SHEFN      QLIANVIKPALSVGQWVLGDRHNLSSLAYQGGGRGL-MPLVKAVSDACLRGFKPDLTLYLDIDPTLGLSR
KTHY_RICAH      DHMARKIIPALQDGHVVICDRFIDSTACYQGLELENGIDLVYNLHKILMPSLMPEITFFIDVEPDTAIER
KTHY_MYCCT      QHLQKVIKPALEKNIIVISDRFIDSTSAYQGSARNIGVDVVSEVQQIVLKNCLPDLTLFFDVSFSEAEKR
KTHY_RICPR      DHMARKIIPALKDGYIVICDRFIDSTACYQGLELENGIDLVYSLHKTLMPSLMPDITFFIDVEPHTAIKR
KTHY_RHOBA      EMIESTLRSALADGVTVISDRFLLANVVYQSVGGEVDAQTLWQLGRLACGGVQPDVTLLLDLPAEISMQR
KTHY_OLICO      DHVHQVIEPALKKGVWVLCDRFTDSTAAYQGAAGKVDAAFIEALTHATIGDLEPDLTLILDVPVAVGLHR
KTHY_MYCMS      QHLQKVIKPALEKNIIVISDRFIDSTSAYQGSARNIGVDVVNQVQQIVLKNCLPDLTLFFDVSFSEAEKR
KTHY_MYCHJ      IHLERLIWPALKAGKIVLCDRYIDSSIAYQGFGNGLDIDLVTSLNSLISENTFPDLTIFLDIKISKAFER
KTHY_MYCH2      IHLERLIWPALKAGKIVLCDRYIDSSIAYQGFGNGLDIDLVTSLNSLISENTFPDLTIFLDIKISKAFER
KTHY_FRAP2      QHYRNLIAPALTKGVNVVSDRFYWSSIAYQGGGRELGVDKLNVLNETFLKDCQPDLIIYLDIDPAIGLAR
KTHY_ERWCT      QLVDNVIKPALADGKWVIGDRHDLSSQAYQGGGRGIDQQLLRSLRDTVLGNFRPDLTLYLDLPPAIGLQR
KTHY_RICPU      DHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIKR
KTHY_SHELP      QLVANVIKPALAQGNWVLGDRHNLSSLAYQGGGRQL-MPLVEAVSQATLKDFKPDLTLYLDIDPQLGLQR
KTHY_RICRS      DHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIKR
KTHY_RICRO      DHMARKIIPALQEGHIVICDRFIDSTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIKR
KTHY_RICCN      DHMARKIIPALQEGHIVICDRFIESTVCYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIKR
KTHY_PROM1      QHVNEIIRPTLDQGDWVISDRFCGSTLAYQGYGRKLDITLIKDLEAIATQGIAPDITFLL----------
KTHY_LEGPC      QLIEQVIKPALNEGQWVIADRFELSTLAYQGGGRKMDMRVINELSNFCLKGFKPDLTLYLDINPELGMIR
KTHY_CALS8      EHVKNVLIPALEDGYVVVCDRYILSSIVYQGIVRGVGVENIIKLNSIFEEKIKPDLYIILTLSPEIALQR
KTHY_THEM4      QLVEEVIRPSIEKGYFVLADRFSDSSIAYQGGARNLGKDLVEKLNIFATNGXXXXXXXXXXXXXQMAVRR
KTHY_RICTY      DHMVRKIIPALKDGYIVICDRFIDSTACYQGLELENGIDLVYSLHTTLMPSLMPDITFFIDVEPDTAIKR
KTHY_RICFE      DHMVRKIIPALQDGHIVICDRFIDSTACYQGLELENGIDLVYNLHKTLMPSLMPDITFFIDVEPDTAIE