[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81728.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
  617::691     1e-14  48%  703 aa  PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     1e-14  49%  753 aa  PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     1e-14  49%  772 aa  PNP_VARPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-14  49%  706 aa  PNP_RHOFD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::694     3e-14  49%  703 aa  PNP_HAHCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     4e-14  49%  707 aa  PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     6e-14  48%  703 aa  PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-14  47%  696 aa  PNP_COXBU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-14  47%  696 aa  PNP_COXBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-14  47%  696 aa  PNP_COXBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-14  47%  696 aa  PNP_COXB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-14  47%  696 aa  PNP_COXB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::692     7e-14  60%  705 aa  PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     1e-13  47%  757 aa  PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     1e-13  48%  706 aa  PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     1e-13  48%  727 aa  PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     1e-13  47%  727 aa  PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::693     2e-13  49%  708 aa  PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::694     2e-13  49%  703 aa  PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::693     2e-13  45%  697 aa  PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::693     2e-13  43%  698 aa  PNP_CLOPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     2e-13  47%  707 aa  PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-13  45%  758 aa  PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::702     3e-13  59%  722 aa  PNP_SACD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     5e-13  47%  700 aa  PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     5e-13  47%  698 aa  PNP_ALHEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::697     6e-13  55%  700 aa  PNP_PSYA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     6e-13  45%  751 aa  PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     6e-13  59%  710 aa  PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::697     8e-13  53%  700 aa  PNP_PSYCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     8e-13  47%  701 aa  PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     8e-13  43%  697 aa  PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    1::74      1e-12  42%  128 aa  YABR_BACSU RecName: Full=Uncharacterized protein yabR;
  635::693     1e-12  54%  702 aa  PNP_MARMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     1e-12  45%  704 aa  PNP_PSYWF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     1e-12  43%  767 aa  PNP_LEPCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::693     2e-12  45%  709 aa  PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-12  44%  697 aa  PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-12  46%  698 aa  PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     3e-12  46%  709 aa  PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     3e-12  46%  709 aa  PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     3e-12  46%  712 aa  PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::693     3e-12  45%  709 aa  PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::710     3e-12  43%  734 aa  PNP_PELTS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     3e-12  42%  698 aa  PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     3e-12  42%  698 aa  PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     3e-12  42%  696 aa  PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     3e-12  42%  696 aa  PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-12  41%  697 aa  PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-12  41%  697 aa  PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-12  41%  697 aa  PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-12  41%  697 aa  PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-12  41%  697 aa  PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::689     3e-12  52%  702 aa  PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  618::690     4e-12  44%  717 aa  PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     4e-12  44%  701 aa  PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     4e-12  44%  714 aa  PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     4e-12  45%  708 aa  PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::693     4e-12  54%  711 aa  PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::690     4e-12  44%  692 aa  PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     4e-12  44%  702 aa  PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     5e-12  44%  701 aa  PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     5e-12  44%  701 aa  PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     5e-12  44%  701 aa  PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     5e-12  44%  701 aa  PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     5e-12  42%  722 aa  PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     5e-12  42%  722 aa  PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     5e-12  42%  695 aa  PNP_NITOC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     5e-12  44%  705 aa  PNP_NITEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::693     5e-12  54%  711 aa  PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     5e-12  41%  699 aa  PNP_AZOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     7e-12  44%  724 aa  PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     7e-12  53%  709 aa  PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     7e-12  53%  709 aa  PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     7e-12  53%  709 aa  PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     7e-12  53%  709 aa  PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     7e-12  44%  715 aa  PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     7e-12  43%  714 aa  PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     7e-12  43%  714 aa  PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     7e-12  41%  699 aa  PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     9e-12  43%  720 aa  PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     9e-12  45%  709 aa  PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::702     9e-12  54%  722 aa  PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-11  44%  700 aa  PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-11  44%  700 aa  PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-11  44%  700 aa  PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-11  44%  700 aa  PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::689     1e-11  46%  705 aa  PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::694     1e-11  46%  707 aa  PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::699     1e-11  43%  712 aa  PNP_BURP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::689     1e-11  55%  712 aa  PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     1e-11  43%  715 aa  PNP_ACTPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     1e-11  43%  715 aa  PNP_ACTP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     1e-11  43%  715 aa  PNP_ACTP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::689     1e-11  50%  702 aa  PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  635::690     2e-11  55%  705 aa  PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  704 aa  PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  705 aa  PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  705 aa  PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  705 aa  PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  705 aa  PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  704 aa  PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  705 aa  PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  705 aa  PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-11  44%  704 aa  PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-11  43%  707 aa  PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  47%  723 aa  PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  47%  723 aa  PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  47%  723 aa  PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  47%  723 aa  PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::697     2e-11  44%  702 aa  PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     2e-11  52%  709 aa  PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::691     2e-11  54%  706 aa  PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::691     2e-11  54%  707 aa  PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::690     2e-11  48%  692 aa  PNP_ACIF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::688     2e-11  48%  690 aa  PNP_ACIF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     2e-11  46%  708 aa  PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     2e-11  46%  708 aa  PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::692     2e-11  54%  710 aa  PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  43%  702 aa  PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  47%  723 aa  PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     2e-11  47%  723 aa  PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     2e-11  55%  711 aa  PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::699     2e-11  43%  713 aa  PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-11  44%  694 aa  PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  705 aa  PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  706 aa  PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::694     3e-11  56%  706 aa  PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::695     3e-11  56%  707 aa  PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::694     3e-11  56%  706 aa  PNP_NEIMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::694     3e-11  56%  706 aa  PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::694     3e-11  56%  706 aa  PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::695     3e-11  56%  707 aa  PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::711     3e-11  41%  722 aa  PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::696     3e-11  44%  711 aa  PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::696     3e-11  44%  710 aa  PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::689     3e-11  46%  697 aa  PNP_GEOSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  710 aa  PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::693     3e-11  55%  711 aa  PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     3e-11  55%  711 aa  PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::712     3e-11  51%  762 aa  PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     3e-11  43%  703 aa  PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  701 aa  PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::688     3e-11  54%  691 aa  PNP_METCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::692     3e-11  53%  701 aa  PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-11  42%  716 aa  PNP_CAUSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     3e-11  39%  716 aa  PNP_BURXL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     3e-11  39%  718 aa  PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::685     3e-11  50%  702 aa  PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  635::690     4e-11  55%  711 aa  PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::688     4e-11  40%  709 aa  PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     4e-11  41%  697 aa  PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-11  42%  731 aa  PNP_BART1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::694     4e-11  51%  709 aa  PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     6e-11  54%  706 aa  PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     6e-11  54%  706 aa  PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::688     6e-11  47%  702 aa  PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::691     6e-11  47%  704 aa  PNP_SHESH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::688     6e-11  47%  701 aa  PNP_SHEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::691     6e-11  47%  704 aa  PNP_SHEPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::691     6e-11  47%  704 aa  PNP_SHEHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-11  42%  745 aa  PNP_METPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-11  42%  745 aa  PNP_METEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-11  42%  745 aa  PNP_METC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::688     6e-11  44%  716 aa  PNP_IDILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     6e-11  53%  713 aa  PNP_HAES2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     6e-11  53%  713 aa  PNP_HAES1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::729     6e-11  46%  913 aa  PNP_BIFLO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::729     6e-11  46%  914 aa  PNP_BIFLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::729     6e-11  46%  913 aa  PNP_BIFLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::691     8e-11  53%  705 aa  PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     8e-11  41%  725 aa  PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     8e-11  41%  723 aa  PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     8e-11  45%  703 aa  PNP_GEOLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     8e-11  45%  693 aa  PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     8e-11  41%  723 aa  PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::729     8e-11  46%  892 aa  PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     8e-11  43%  706 aa  PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::699     1e-10  42%  705 aa  PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  43%  699 aa  PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     1e-10  41%  704 aa  PNP_MANSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  39%  729 aa  PNP_LEGPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  644::698     1e-10  53%  713 aa  PNP_GLOVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::690     1e-10  41%  714 aa  PNP_FINM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     1e-10  41%  712 aa  PNP_CAUCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     1e-10  41%  712 aa  PNP_CAUCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     1e-10  41%  733 aa  PNP_BARBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::690     1e-10  55%  711 aa  PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     1e-10  40%  707 aa  PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     1e-10  42%  715 aa  PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     1e-10  50%  712 aa  PNP_HAEDU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::688     1e-10  45%  696 aa  PNP_GEOUR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-10  42%  712 aa  PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::688     1e-10  45%  696 aa  PNP_GEOSF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::690     1e-10  51%  721 aa  PNP_DEIDV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-10  41%  701 aa  PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     1e-10  44%  693 aa  PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     1e-10  43%  697 aa  PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     1e-10  42%  733 aa  PNP_BARHE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-10  42%  702 aa  PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-10  42%  710 aa  PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::691     2e-10  54%  706 aa  PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-10  42%  714 aa  PNP_SINMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-10  42%  717 aa  PNP_RHISN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-10  42%  717 aa  PNP_RHIME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-10  42%  712 aa  PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-10  42%  715 aa  PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-10  42%  712 aa  PNP_RHIL3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-10  42%  712 aa  PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-10  40%  728 aa  PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-10  41%  722 aa  PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::688     2e-10  43%  696 aa  PNP_GEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::688     2e-10  43%  696 aa  PNP_GEOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     2e-10  42%  704 aa  PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     2e-10  40%  693 aa  PNP_CHLMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     2e-10  41%  712 aa  PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-10  42%  713 aa  PNP_AGRT5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     2e-10  41%  697 aa  PNP_STAS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  610::683     2e-10  43%  686 aa  PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     2e-10  42%  722 aa  PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-10  38%  729 aa  PNP_LEGPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-10  38%  729 aa  PNP_LEGPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::689     2e-10  44%  704 aa  PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  291::348     3e-10  54%  392 aa  RS1_STAHJ RecName: Full=30S ribosomal protein S1;
  636::692     3e-10  47%  695 aa  PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     3e-10  40%  771 aa  PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::690     3e-10  49%  698 aa  PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     3e-10  42%  712 aa  PNP_RHIEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     3e-10  41%  705 aa  PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::713     3e-10  45%  747 aa  PNP_MOOTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::690     4e-10  51%  698 aa  PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::702     4e-10  45%  727 aa  PNP_DESHY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::702     4e-10  45%  723 aa  PNP_DESHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     4e-10  37%  704 aa  PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::691     4e-10  37%  704 aa  PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::692     4e-10  47%  707 aa  PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::687     4e-10  42%  710 aa  PNP_BACSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     4e-10  41%  714 aa  PNP_AGRVS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::694     5e-10  44%  703 aa  PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     5e-10  38%  729 aa  PNP_LEGPL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::689     5e-10  43%  697 aa  PNP_GEOMG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::690     5e-10  44%  694 aa  PNP_CHLPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     5e-10  41%  715 aa  PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     5e-10  41%  715 aa  PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     5e-10  41%  715 aa  PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::690     5e-10  41%  713 aa  PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     5e-10  41%  715 aa  PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     5e-10  41%  715 aa  PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     5e-10  41%  715 aa  PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     5e-10  41%  707 aa  PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     5e-10  41%  707 aa  PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     5e-10  41%  707 aa  PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::689     5e-10  52%  704 aa  PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::688     6e-10  40%  748 aa  PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::691     6e-10  50%  709 aa  PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::691     6e-10  50%  709 aa  PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     6e-10  47%  713 aa  PNP_THET8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::689     6e-10  47%  700 aa  PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::689     6e-10  47%  700 aa  PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     6e-10  43%  700 aa  PNP_SHEB9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     6e-10  43%  700 aa  PNP_SHEB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     6e-10  43%  700 aa  PNP_SHEB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::692     6e-10  48%  744 aa  PNP_RICBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::692     6e-10  48%  744 aa  PNP_RICB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::689     6e-10  51%  699 aa  PNP_PELCD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     6e-10  42%  715 aa  PNP_MESSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::696     6e-10  40%  705 aa  PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     6e-10  38%  705 aa  PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     6e-10  37%  695 aa  PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     6e-10  37%  695 aa  PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     6e-10  37%  695 aa  PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     6e-10  37%  695 aa  PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURP0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::692     6e-10  41%  713 aa  PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     6e-10  41%  717 aa  PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-10  41%  705 aa  PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-10  42%  705 aa  PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-10  41%  707 aa  PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  291::348     8e-10  53%  391 aa  RS1_STAAW RecName: Full=30S ribosomal protein S1;
  291::348     8e-10  53%  391 aa  RS1_STAAS RecName: Full=30S ribosomal protein S1;
  291::348     8e-10  53%  391 aa  RS1_STAAR RecName: Full=30S ribosomal protein S1;
  291::348     8e-10  53%  391 aa  RS1_STAAN RecName: Full=30S ribosomal protein S1;
  291::348     8e-10  53%  391 aa  RS1_STAAM RecName: Full=30S ribosomal protein S1;
  291::348     8e-10  53%  391 aa  RS1_STAAC RecName: Full=30S ribosomal protein S1;
  646::698     8e-10  47%  713 aa  PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     8e-10  47%  713 aa  PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     8e-10  40%  774 aa  PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     8e-10  39%  745 aa  PNP_RICM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     8e-10  39%  747 aa  PNP_RICFE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     8e-10  40%  747 aa  PNP_RICAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     8e-10  41%  723 aa  PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::686     8e-10  38%  720 aa  PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::686     8e-10  38%  720 aa  PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     8e-10  38%  702 aa  PNP_CLOPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     8e-10  38%  702 aa  PNP_CLOP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     8e-10  37%  694 aa  PNP_CHLFF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     8e-10  37%  694 aa  PNP_CHLCV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     8e-10  40%  719 aa  PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     8e-10  40%  719 aa  PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     8e-10  40%  719 aa  PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     8e-10  38%  718 aa  PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::729     8e-10  43%  873 aa  PNP_BIFA0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     8e-10  41%  733 aa  PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     1e-09  40%  700 aa  PNP_STAHJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     1e-09  40%  701 aa  PNP_STAES RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     1e-09  40%  701 aa  PNP_STAEQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::693     1e-09  48%  738 aa  PNP_EXISA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     1e-09  38%  719 aa  PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::694     1e-09  48%  697 aa  PNP_BLOFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     1e-09  40%  712 aa  PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     1e-09  37%  748 aa  PNP_RICRS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     1e-09  37%  748 aa  PNP_RICRO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     1e-09  37%  748 aa  PNP_RICPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     1e-09  37%  749 aa  PNP_RICCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     1e-09  37%  748 aa  PNP_RICAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::688     1e-09  42%  706 aa  PNP_PELPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::690     1e-09  47%  779 aa  PNP_DEIRA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     1e-09  39%  700 aa  PNP_CLOTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::689     1e-09  41%  710 aa  PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    4::77      1e-09  38%  130 aa  GS13_BACSU RecName: Full=General stress protein 13;       
  206::263     2e-09  49%  393 aa  RS1_STAS1 RecName: Full=30S ribosomal protein S1;
  270::344     2e-09  41%  382 aa  RS1H_BACC1 RecName: Full=30S ribosomal protein S1 homolog;
  636::692     2e-09  47%  695 aa  PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::696     2e-09  47%  773 aa  PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-09  41%  716 aa  PNP_HAMD5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-09  36%  702 aa  PNP_CLOPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-09  38%  705 aa  PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::700     2e-09  38%  721 aa  PNP_ANASK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::700     2e-09  38%  721 aa  PNP_ANADE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::700     2e-09  38%  721 aa  PNP_ANAD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     2e-09  39%  715 aa  PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::701     2e-09  47%  716 aa  PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::701     2e-09  47%  716 aa  PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     2e-09  37%  701 aa  PNP_STACT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::689     2e-09  44%  732 aa  PNP_GEMAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::697     2e-09  48%  698 aa  PNP_ELUMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  573::632     2e-09  51%  635 aa  ISPH_CLOTE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
  312::387     3e-09  39%  429 aa  RS1_LEULA RecName: Full=40S ribosomal protein S1;
  617::692     3e-09  32%  707 aa  PNP_SULAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     3e-09  48%  741 aa  PNP_STRTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     3e-09  48%  741 aa  PNP_STRT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     3e-09  48%  741 aa  PNP_STRT1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::692     3e-09  43%  747 aa  PNP_RICCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     3e-09  38%  716 aa  PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     3e-09  38%  714 aa  PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     3e-09  38%  716 aa  PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     3e-09  38%  716 aa  PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-09  40%  713 aa  PNP_OCHA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::691     3e-09  48%  720 aa  PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::691     3e-09  44%  703 aa  PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     3e-09  36%  694 aa  PNP_CHLAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   24::86      3e-09  43%  275 aa  IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit
  638::695     4e-09  48%  728 aa  PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     4e-09  37%  745 aa  PNP_RICTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::690     4e-09  47%  721 aa  PNP_DEIGD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUSI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUO2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-09  40%  714 aa  PNP_BRUA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     5e-09  37%  745 aa  PNP_RICPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::697     5e-09  38%  718 aa  PNP_NATTJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     5e-09  36%  713 aa  PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::689     5e-09  37%  716 aa  PNP_GLUOX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::707     5e-09  39%  740 aa  PNP_DESRM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::699     5e-09  49%  718 aa  PNP_CYAP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::690     5e-09  45%  708 aa  PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::690     5e-09  45%  708 aa  PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     5e-09  38%  705 aa  PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     7e-09  51%  717 aa  PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::686     7e-09  49%  690 aa  PNP_PELUB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     7e-09  36%  769 aa  PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::699     7e-09  49%  718 aa  PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   24::86      7e-09  43%  275 aa  IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit
   24::86      7e-09  43%  275 aa  IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit
  274::331     9e-09  44%  411 aa  RR1_SPIOL RecName: Full=30S ribosomal protein S1,
  618::692     9e-09  37%  693 aa  PNP_THISH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::686     9e-09  50%  701 aa  PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     9e-09  50%  710 aa  PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     9e-09  38%  711 aa  PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     9e-09  47%  717 aa  PNP_MICAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     9e-09  36%  696 aa  PNP_LEPBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     9e-09  36%  696 aa  PNP_LEPBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::707     9e-09  42%  741 aa  PNP_DESAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     9e-09  39%  722 aa  PNP_ANADF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  291::348     1e-08  49%  392 aa  RS1_STAEQ RecName: Full=30S ribosomal protein S1;
  635::691     1e-08  46%  698 aa  PNP_TREDE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::688     1e-08  40%  699 aa  PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     1e-08  38%  714 aa  PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::700     1e-08  45%  712 aa  PNP_SALRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     1e-08  38%  711 aa  PNP_ROSDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::694     1e-08  38%  711 aa  PNP_DINSH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     1e-08  37%  715 aa  PNP_CYAP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::695     1e-08  35%  714 aa  PNP_AKKM8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   25::83      1e-08  48%  275 aa  IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit
  285::344     2e-08  42%  382 aa  RS1H_BACSU RecName: Full=30S ribosomal protein S1 homolog;
  638::695     2e-08  48%  733 aa  PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     2e-08  36%  772 aa  PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-08  38%  710 aa  PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::692     2e-08  40%  703 aa  PNP_MACCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::693     2e-08  45%  706 aa  PNP_JANSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::691     2e-08  51%  806 aa  PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   25::86      2e-08  41%  266 aa  IF2A_METJA RecName: Full=Translation initiation factor 2 subunit
   23::83      2e-08  45%  266 aa  IF2A_HALMA RecName: Full=Translation initiation factor 2 subunit
  619::686     2e-08  37%  757 aa  PNP_SORC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     2e-08  32%  709 aa  PNP_PERMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::690     2e-08  41%  695 aa  PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::688     2e-08  44%  702 aa  PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::693     2e-08  40%  693 aa  PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   25::83      2e-08  45%  275 aa  IF2A_THEON RecName: Full=Translation initiation factor 2 subunit
  624::697     3e-08  38%  710 aa  PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::691     3e-08  46%  718 aa  PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::693     3e-08  38%  796 aa  PNP_EHRCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  210::267     4e-08  44%  307 aa  RS1_SYNP6 RecName: Full=30S ribosomal protein S1;
  638::695     4e-08  48%  710 aa  PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     4e-08  48%  710 aa  PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     4e-08  48%  710 aa  PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::694     4e-08  37%  715 aa  PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::691     4e-08  40%  721 aa  PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::692     4e-08  52%  815 aa  PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  209::266     5e-08  42%  328 aa  RS1A_SYNY3 RecName: Full=30S ribosomal protein S1 homolog A;
  632::672     5e-08  59%  701 aa  PNP_SOLUE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::694     5e-08  47%  739 aa  PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::691     5e-08  36%  697 aa  PNP_COPPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::697     5e-08  39%  838 aa  PNP_ANAPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   23::83      5e-08  43%  267 aa  IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit
   23::83      5e-08  43%  267 aa  IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit
  638::695     6e-08  48%  709 aa  PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     6e-08  48%  709 aa  PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     6e-08  48%  709 aa  PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::719     6e-08  48%  786 aa  PNP_SALAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::701     6e-08  44%  703 aa  PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::688     6e-08  50%  712 aa  PNP_BRAHW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  664::721     6e-08  54%  744 aa  PNP_BEUC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::684     8e-08  38%  796 aa  PNP_EHRCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  696::750     8e-08  46%  756 aa  PNP_CORA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::715     8e-08  53%  734 aa  PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     8e-08  45%  718 aa  PNP_ANAVT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     8e-08  45%  718 aa  PNP_ANASP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   25::83      8e-08  45%  273 aa  IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit
  648::700     1e-07  43%  790 aa  PNP_THERP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     1e-07  47%  737 aa  PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::730     1e-07  41%  750 aa  PNP_SACEN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::698     1e-07  43%  718 aa  PNP_NOSP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::688     1e-07  38%  789 aa  PNP_EHRRW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::688     1e-07  38%  789 aa  PNP_EHRRG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  664::720     1e-07  49%  782 aa  PNP_ACIC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  246::306     1e-07  48% 1200 aa  MOG5_CAEEL RecName: Full=Probable pre-mRNA-splicing factor
  663::720     1e-07  52%  740 aa  PNP_STRAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::700     1e-07  35%  747 aa  PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::700     1e-07  35%  746 aa  PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::690     1e-07  45%  704 aa  PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::713     2e-07  53%  732 aa  PNP_CHLPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::695     2e-07  45%  737 aa  PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::720     2e-07  52%  737 aa  PNP_STRGG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::720     2e-07  52%  739 aa  PNP_STRCO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::720     2e-07  52%  738 aa  PNP_STRAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::696     2e-07  41%  698 aa  PNP_STAA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::719     2e-07  44%  785 aa  PNP_SALTO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::690     2e-07  41%  753 aa  PNP_RHOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::711     2e-07  41%  732 aa  PNP_NITSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::692     2e-07  35%  699 aa  PNP_BLOPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  217::272     3e-07  55%  556 aa  RS1_HELPY RecName: Full=30S ribosomal protein S1;
  642::701     3e-07  40%  719 aa  PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   30::90      3e-07  38%  267 aa  IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit
  705::759     4e-07  44%  765 aa  PNP_CORU7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::689     5e-07  35%  707 aa  PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::715     5e-07  43%  767 aa  PNP_THEFY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  649::708     5e-07  38%  721 aa  PNP_SULDN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  641::698     5e-07  36%  702 aa  PNP_SPICI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     5e-07  29%  697 aa  PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  690::744     5e-07  44%  764 aa  PNP_NOCFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  582::640     5e-07  38%  642 aa  ISPH_CLOAB RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
  681::735     7e-07  43%  756 aa  PNP_RHOE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::713     7e-07  49%  732 aa  PNP_PELLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     9e-07  35%  701 aa  PNP_PSESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::713     9e-07  51%  732 aa  PNP_PROVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::700     9e-07  33%  757 aa  PNP_NEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::696     9e-07  39%  755 aa  PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::696     9e-07  39%  755 aa  PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::696     9e-07  39%  755 aa  PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::726     9e-07  44%  746 aa  PNP_ARTS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::726     9e-07  47%  752 aa  PNP_ARTCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::726     9e-07  47%  750 aa  PNP_ARTAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  491::549     1e-06  40%  569 aa  RS1_CHLTR RecName: Full=30S ribosomal protein S1;
  613::686     1e-06  31%  689 aa  PNP_UNCTG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::732     1e-06  43%  752 aa  PNP_MYCTU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::732     1e-06  43%  752 aa  PNP_MYCTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  681::734     1e-06  43%  757 aa  PNP_MYCPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  681::734     1e-06  43%  762 aa  PNP_MYCMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::732     1e-06  43%  752 aa  PNP_MYCBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::732     1e-06  43%  752 aa  PNP_MYCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::732     1e-06  43%  752 aa  PNP_MYCBO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::725     1e-06  43%  748 aa  PNP_MYCA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::704     1e-06  41%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::726     1e-06  37%  728 aa  PNP_PHYMT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::692     1e-06  36%  736 aa  PNP_ORITI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::696     1e-06  36%  740 aa  PNP_ORITB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  681::734     1e-06  43%  762 aa  PNP_MYCUA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  677::730     1e-06  43%  755 aa  PNP_MYCA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::730     1e-06  45%  753 aa  PNP_MICLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  669::726     1e-06  48%  746 aa  PNP_KINRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::686     1e-06  31%  720 aa  PNP_DEHE1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  694::749     1e-06  42%  755 aa  PNP_CORDI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     1e-06  34%  703 aa  PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  491::549     2e-06  40%  570 aa  RS1_CHLMU RecName: Full=30S ribosomal protein S1;AltName: Full=70
  653::718     2e-06  32%  729 aa  PNP_SULNB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::715     2e-06  47%  733 aa  PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::708     2e-06  39%  731 aa  PNP_CARHZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  478::549     3e-06  32%  580 aa  RS1_CHLPN RecName: Full=30S ribosomal protein S1;
  658::716     3e-06  42%  729 aa  PNP_FRASN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  682::735     3e-06  42%  773 aa  PNP_MYCLE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  682::735     3e-06  42%  773 aa  PNP_MYCLB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  677::735     3e-06  45%  751 aa  PNP_KOCRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  691::745     3e-06  43%  752 aa  PNP_COREF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  653::714     3e-06  47%  732 aa  PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   25::83      3e-06  38%  260 aa  IF2A_METST RecName: Full=Translation initiation factor 2 subunit
  184::258     4e-06  39%  551 aa  RS1_COXBU RecName: Full=30S ribosomal protein S1;
  619::691     4e-06  33%  725 aa  PNP_METS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::695     4e-06  39%  707 aa  PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::665     4e-06  44%  714 aa  PNP_METFK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::693     4e-06  40%  693 aa  PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-06  33%  730 aa  PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     6e-06  32%  725 aa  PNP_METNO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::716     6e-06  42%  729 aa  PNP_FRASC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::693     6e-06  38%  693 aa  PNP_DICT6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  674::732     6e-06  44%  757 aa  PNP_CLAMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  674::732     6e-06  44%  757 aa  PNP_CLAM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::713     6e-06  39%  715 aa  PNP_ACHLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::705     7e-06  32%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;
  213::268     7e-06  49%  552 aa  RS1_HELPJ RecName: Full=30S ribosomal protein S1;
  665::722     7e-06  46%  733 aa  PNP_PROAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     7e-06  32%  720 aa  PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::696     7e-06  39%  750 aa  PNP_GRAFK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  664::721     1e-05  41%  746 aa  PNP_RENSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  675::728     1e-05  42%  754 aa  PNP_MYCVP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::725     1e-05  42%  759 aa  PNP_MYCSS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::725     1e-05  42%  759 aa  PNP_MYCSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::725     1e-05  42%  759 aa  PNP_MYCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  677::730     1e-05  42%  756 aa  PNP_MYCGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::697     1e-05  39%  777 aa  PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::705     1e-05  42%  717 aa  PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  716::770     1e-05  39%  775 aa  PNP_CORK4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  704::758     1e-05  39%  764 aa  PNP_CORJK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::715     1e-05  47%  728 aa  PNP_CHLCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   27::86      1e-05  35%  262 aa  IF2A_METTH RecName: Full=Translation initiation factor 2 subunit
   26::86      1e-05  40%  267 aa  IF2A_METKA RecName: Full=Translation initiation factor 2 subunit
  639::711     1e-05  33%  730 aa  PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-05  32%  739 aa  PNP_METRJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::691     1e-05  44%  711 aa  PNP_FLAPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     1e-05  32%  701 aa  PNP_ANATD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  729::787     1e-05  31%  827 aa  ISPH_FUSNN RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
  654::713     2e-05  47%  728 aa  PNP_PELPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     2e-05  31%  701 aa  PNP_MAGSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   24::83      2e-05  35%  265 aa  IF2A_METS3 RecName: Full=Translation initiation factor 2 subunit
  681::735     2e-05  39%  757 aa  PNP_RHOSR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  681::735     2e-05  39%  757 aa  PNP_RHOOB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  664::721     2e-05  43%  742 aa  PNP_NOCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  676::727     2e-05  41%  763 aa  PNP_MYCS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  659::714     2e-05  42%  729 aa  PNP_FRAAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     2e-05  31%  701 aa  PNP_CALS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::695     2e-05  38%  715 aa  PNP_BREBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::705     3e-05  31%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;
  614::672     3e-05  32%  758 aa  PNP_WOLPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::696     3e-05  36%  769 aa  PNP_LACLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::696     3e-05  36%  766 aa  PNP_LACLM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::689     3e-05  41%  713 aa  PNP_AERS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  205::263     4e-05  40%  566 aa  RS1_BUCBP RecName: Full=30S ribosomal protein S1;
  615::690     4e-05  28%  703 aa  PNP_SULSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::717     4e-05  46%  734 aa  PNP_PROA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::701     4e-05  45%  746 aa  PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  681::739     4e-05  42%  761 aa  PNP_LEIXX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    2::81      4e-05  35%  254 aa  IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit
  205::262     5e-05  39%  559 aa  RS1_BUCAP RecName: Full=30S ribosomal protein S1;
  205::262     5e-05  42%  263 aa  RR1_PORPU RecName: Full=30S ribosomal protein S1, chloroplastic;
  646::708     5e-05  32%  728 aa  PNP_SULMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::702     5e-05  29%  721 aa  PNP_PROM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  205::262     6e-05  37%  559 aa  RS1_PSEAE RecName: Full=30S ribosomal protein S1;
  272::331     6e-05  36%  378 aa  RS1_PROSP RecName: Full=30S ribosomal protein S1;Flags: Fragment;
  645::699     6e-05  31%  721 aa  PNP_PROMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::699     6e-05  31%  721 aa  PNP_PROMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::699     6e-05  31%  721 aa  PNP_PROM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::699     6e-05  31%  721 aa  PNP_PROM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::699     6e-05  31%  721 aa  PNP_PROM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::692     6e-05  44%  714 aa  PNP_FLAJ1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::701     6e-05  41%  708 aa  PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::701     6e-05  41%  708 aa  PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  670::704     6e-05  51%  725 aa  PNP_ARCB4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  198::271     8e-05  36%  565 aa  RS1_RHOPA RecName: Full=30S ribosomal protein S1;AltName:
  205::262     8e-05  40%  549 aa  RS1_HAEIN RecName: Full=30S ribosomal protein S1;
  205::262     8e-05  37%  558 aa  RS1_BUCAI RecName: Full=30S ribosomal protein S1;
  678::719     8e-05  38%  736 aa  PNP_WOLSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     8e-05  30%  697 aa  PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::701     8e-05  40%  708 aa  PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  205::262     1e-04  39%  557 aa  RS1_SHIFL RecName: Full=30S ribosomal protein S1;
  195::268     1e-04  34%  568 aa  RS1_RHIME RecName: Full=30S ribosomal protein S1;
  205::262     1e-04  39%  557 aa  RS1_ECOLI RecName: Full=30S ribosomal protein S1;
  205::262     1e-04  39%  557 aa  RS1_ECOL6 RecName: Full=30S ribosomal protein S1;
  205::262     1e-04  39%  557 aa  RS1_ECO57 RecName: Full=30S ribosomal protein S1;
  635::688     1e-04  31%  705 aa  PNP_WIGBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::701     1e-04  40%  711 aa  PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  307::363     1e-04  39%  481 aa  RS1_MYCTU RecName: Full=30S ribosomal protein S1;
  307::363     1e-04  39%  481 aa  RS1_MYCLE RecName: Full=30S ribosomal protein S1;
  617::689     1e-04  30%  712 aa  PNP_GLUDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  657::717     1e-04  49%  736 aa  PNP_CHLL2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     1e-04  32%  724 aa  PNP_AZOC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::664     1e-04  40%  805 aa  PNP_ANAMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::664     1e-04  40%  805 aa  PNP_ANAMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-04  30%  717 aa  PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   22::81      1e-04  39%  254 aa  IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit
  641::700     2e-04  38%  743 aa  PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  641::700     2e-04  38%  743 aa  PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  205::262     2e-04  39%  263 aa  RR1_PORYE RecName: Full=30S ribosomal protein S1, chloroplastic;
  614::672     2e-04  44%  755 aa  PNP_WOLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::695     2e-04  34%  712 aa  PNP_SYNJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::691     2e-04  36%  714 aa  PNP_METSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  682::712     3e-04  48%  791 aa  TEX_BORPE RecName: Full=Protein tex;
  190::263     3e-04  33%  561 aa  RS1_NEIMB RecName: Full=30S ribosomal protein S1;
  618::692     3e-04  28%  708 aa  PNP_RHORT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     3e-04  33%  728 aa  PNP_PARL1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  678::734     4e-04  38%  738 aa  PNP_TROWT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  675::731     4e-04  38%  735 aa  PNP_TROW8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     4e-04  29%  702 aa  PNP_STRMK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     4e-04  29%  702 aa  PNP_STRM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     4e-04  32%  720 aa  PNP_BRAJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::682     7e-04  32%  757 aa  YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;
  636::682     7e-04  32%  757 aa  YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;
  190::252     7e-04  31% 1145 aa  PRP22_YEAST RecName: Full=Pre-mRNA-splicing factor ATP-dependent
  638::669     7e-04  56%  714 aa  PNP_STRE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::701     7e-04  29%  723 aa  PNP_PROMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::699     7e-04  29%  721 aa  PNP_PROM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::680     7e-04  37%  703 aa  PNP_HYDS0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     7e-04  28%  716 aa  PNP_ACAM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::690     9e-04  30%  712 aa  PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::716     9e-04  40%  729 aa  PNP_CHLT3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::693     9e-04  34%  715 aa  PNP_BEII9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxNVELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEG
PNP_PSEA6       ------------------DVEAGKTYEGKVTRIVDFGAFVEILPGKEGLVHISQIAHERVNKVADHLSEG
PNP_DELAS       ------------------EVEIGKIYEGPVTKILDFGALVNLLPGKDGLLHISQIAHERVERVADYLQEG
PNP_VARPS       ------------------EVEIGKVYEGPVTKILDFGALINLLPGKDGLLHISQIAHERVEKVTDYLSEG
PNP_RHOFD       ------------------EVEIGKIYEGPITKILDFGALVNLLPGKDGLLHISQIAHERVEKVTDYLSEG
PNP_HAHCH       ------------------EAEVGKLYRGKVERIVEFGAFVNILPGKDGLVHISQIAQERVENVTDYLKEG
PNP_POLSJ       ------------------EVEIGKVYEGAITKILDFGALVNLLPGKDGLLHISQIAHERVEKVTDYLSEG
PNP_POLNA       ------------------EVEIGKVYEGAITKILDFGALVNLMPGKDGLLHISQIAHERVEKVTDYLSEG
PNP_COXBU       ------------------EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEG
PNP_COXBR       ------------------EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEG
PNP_COXBN       ------------------EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEG
PNP_COXB2       ------------------EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEG
PNP_COXB1       ------------------EVELGKVYEGTVVKITDFGAFVQILPNTQGLVHISQIAQERVENVRDYLEEG
PNP_TERTT       -----------------------------------FGAFVNFLPGKDGLVHISQIAHERVQNVTDYLKEG
PNP_VEREI       ------------------EIEIGKIYEGPVTKLLDFGALINLLPGKDGLLHISQIAHERVERVSDYLSEG
PNP_THIDA       ------------------EVEVGKVYEGPVIKLLDFGAIVNVLPGRDGLLHISQIAHERVNTIGDYLKEG
PNP_ACISJ       ------------------EVEVGKIYEGPVTKILDFGALINLLPGKDGLLHISQIAHERVEKVGDYLQEG
PNP_DIAST       ------------------EVEVGKVYEGPVTKILDFGALINLLPGKDGLLHISQIAHERVEKVGDYLQEG
PNP_PSEHT       ------------------ELEVGTIYEGKVVRIVDFGAFVNILPGKDGLVHISQISTERVNNVTDHLSEG
PNP_CLOD6       -----------------VEPEVGKTYKGKVSRIMNFGAFVEILPGKEGLLHISHIAHERVAKVEDVLNIG
PNP_ALCBS       ------------------EAEVGAIYEGKVTRVVDFGAFVAIMPGTEGLLHISQIAEERVEKVTDYVNEG
PNP_CLOPH       ------------------EFEEGQVFEGKVISIKEFGAFLEFAPGKEGMVHISKISKERINHVEDVLTLG
PNP_ACTSZ       ------------------EVEAGAVYTGKVTRLADFGAFVAILGNKEGLVHISQIAEERVEKVSDYLQVG
PNP_ACIAC       ------------------EVEIGKIYEGPVVKILDFGALINLLPGKDGLLHISQIAHERVEKVTDYLTEG
PNP_SACD2       -----------------------------------FGAFVNFLPGKDGLVHISQIAHERVQNVSDYLKEG
PNP_SHELP       ------------------EVEVGTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVG
PNP_ALHEH       ------------------DVEVGTVYEGKVSKLMDFGAFVNILPGRDGLVHISQISNERVERVGDYLKEG
PNP_PSYA2       -----------------------------------FGAFVNVLPNTDGLVHISQIADERVENVSDYLKEG
PNP_METPP       ------------------EAEIGKVYEGPVTKILDFGALVNILPGKDGLLHISQIAHQRVEKVTDFLTEG
PNP_CELJU       -----------------------------------FGAFVNFLPGKDGLVHISQIADERVNNVSDYLKEG
PNP_PSYCK       -----------------------------------FGAFINVLPNTDGLVHISQIADERVENVSDYLKEG
PNP_NITMU       ------------------EVEVGRVYDGTVLKLLDFGAIVSVLPGKDGLLHISQIANERVNNVGDHLKEG
PNP_ACIBS       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERITNVTDVLKEG
YABR_BACSU      -----------------MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKDINDHLKVG
PNP_MARMS       -----------------------------------FGAFVNILPGKDGLVHISQIAEERIRAVTDFLSEG
PNP_PSYWF       ------------------EVEVGKVYKGTVARVVDFGAFVTVLPGTDGLVHISQIADERVESVSDYLSEG
PNP_LEPCP       ------------------EAEIGKVYEGPVVKILDFGALINILPGKDGLLHISQIAHQRVEKVTDFLTEG
PNP_PHOLU       ------------------EIEVGRIYAGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVADYLQVG
PNP_ACIAD       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERVANVSDVLKEG
PNP_PSYIN       ------------------EVEVGTIYTGKVVRLADFGAFVNILPGKDGLVHISQICEERVQKVSDHLKEG
PNP_VIBCM       ------------------EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEG
PNP_VIBCH       ------------------EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEG
PNP_VIBC3       ------------------EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEG
PNP_PHOLL       ------------------EIEVARIYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVADYLQVG
PNP_PELTS       ------------------EVQTGEIYTGRVTRITDFGCFVEIIPGKEGLVHISQLAHHRVNRVEDVVKEG
PNP_LEPIN       ------------------EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEG
PNP_LEPIC       ------------------EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEG
PNP_LEPBL       ------------------EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEG
PNP_LEPBJ       ------------------EVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVNSVKDIVKEG
PNP_ACIBY       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEG
PNP_ACIBT       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEG
PNP_ACIBC       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEG
PNP_ACIB5       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEG
PNP_ACIB3       ------------------EVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEG
PNP3_ALKMQ      -----------------------------------FGAFVEILPGKEGLVHISNLAHERVTKVTDVLAEG
PNP_RALSO       ------------------EAEVGKIYSGTVLKLLDFGAIVNILPGKDGLLHISEIANERVNQVSDYVKEG
PNP_PSEU5       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDQRIEKVTDVLKEG
PNP_PASMU       ------------------EVEAGAVYKGKVTRLADFGAFVSIVGNKEGLVHISQIAEERVEKVSDYLAVG
PNP_NITEU       ------------------DVEVGRIYEGTVLKLLDFGAIVSVLPGKDGLLHISQIANERVENVADHLKEG
PNP_ECO27       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_DESPS       ------------------EVEVGAVYTGKVKTIKDFGAFVEILPGTDGLVHISELALERVKDVTDVVNEG
PNP_AZOVD       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDQRIEKVTDVLKEG
PNP_PSEAE       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEG
PNP_PSEAB       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEG
PNP_PSEA8       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEG
PNP_PSEA7       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRIDKVTDVLQEG
PNP_POLSQ       ------------------EAEVGKIYEGPVVKLLEFGALVNILPGKDGLLHISEISNERVKEVKDYLAEG
PNP_POLNS       ------------------EAEVGKIYEGPVVKLLEFGALVNILPGKDGLLHISEISNERVKEVKDYLAEG
PNP_NITOC       ------------------DVEVGKIYEGRVSRLMDFGAFVTILPGKDGLLHISQISAERVKNVSDKLSEG
PNP_NITEC       ------------------DVEVGKIYEGTVLKLLDFGAIVSILPGKDGLLHISQIANERVESVADHLKEG
PNP_KLEP3       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_AZOSE       ------------------EVEVGKVYNGTVVRLLDFGAIVNIMPGRDGLLHVSQIANERVNNVADYVKEG
PNP_RALPJ       ------------------EAEVGKIYNGTVLKLLDFGAIVNILPGKDGLLHISEIANERVNQVSDYVKEG
PNP_HAEIN       -----------------------------------FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVG
PNP_HAEIG       -----------------------------------FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVG
PNP_HAEIE       -----------------------------------FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVG
PNP_HAEI8       -----------------------------------FGAFVAIVGNKEGLVHISQIAEERVEKVSDYLQVG
PNP_DECAR       ------------------EVEIGKIYEGTVLKILDFGAIVSVLPGKDGLLHISQIAQERVNKVEDYVKEG
PNP_BURCM       -----------------VEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURA4       -----------------VEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_AZOSB       ------------------EVEVGKVYEGTVVRLLDFGAIVNILPGRDGLLHVSQIANERVNNVGDYVKEG
PNP_TOLAT       ------------------DVEIGRIYEGKVTRLAEFGAFVNILPGKDGLVHISQITDERVKDVSDYLKVG
PNP_PROMH       ------------------EVEVGRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVSDYLTMG
PNP_CHRVO       ------------------------------------GAIVSILPGKDGLVHISQIANERIKNVSDYLKEG
PNP_XYLFT       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEG
PNP_XYLFM       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEG
PNP_XYLFA       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEG
PNP_XYLF2       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVERVGDKLKEG
PNP_COLP3       ------------------EIEVGTLYTGKVVRIVDFGAFVNVLPGKDGLVHISQISEERVNNVSEVLTEG
PNP_CHRSD       ------------------EPEIGKLYRGTVARITDFGAFVTFMPGTDGLVHISQIVPERVNDVRDYLSEG
PNP_BURP8       ------------------EVEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIANERIKDINDYLKEG
PNP_AERHH       -----------------------------------FGAFVNILPGKDGLVHISQITDARVQNVADYLKIG
PNP_ACTPJ       ------------------EVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYLSVG
PNP_ACTP7       ------------------EVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYLSVG
PNP_ACTP2       ------------------EVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVERVADYLSVG
PNP1_ALKMQ      -----------------------------------FGAFVEILPGKEGLVHISNLAHERVAKVADVLAEG
PNP_YERPY       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPS       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPP       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPN       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPG       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPE       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPB       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERPA       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_YERP3       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_XANOR       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANOP       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANOM       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANCP       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANCB       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANC8       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANC5       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_XANAC       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERVEKVGDKLKEG
PNP_PHOPR       ------------------DVEVGRIYTGKVMRIVDFGAFVSVIGAKEGLVHISQIAQERVEKVSDHLQMG
PNP_LISMO       ------------------EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLG
PNP_LISMH       ------------------EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLG
PNP_LISMF       ------------------EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLG
PNP_LISMC       ------------------EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLG
PNP_HALHL       ------------------DVEVGKVYDGKVAKLMDFGAFVNILPGRDGLVHISQISNNRVENVADELSEG
PNP_HAEPS       -----------------------------------FGAFVSILGGKEGLVHISQITDARVERVADYLSVG
PNP_ERWCT       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_EDWI9       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ACIF5       -----------------------------------FGAFVTILPGRDGLLHISQISNERVSDVHDHLKEG
PNP_ACIF2       -----------------------------------FGAFVTILPGRDGLLHISQISNERVSDVHDHLKEG
PNP_VIBVY       ------------------EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEG
PNP_VIBVU       ------------------EVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEG
PNP_VIBHB       -----------------------------------FGAFVTVLPGKDGLVHISQIAEKRVEKVSDYLTEG
PNP_SHISS       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SHIFL       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SHIF8       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SHIBS       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SHIB3       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_PSEMY       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDQRVEKVTDVLKEG
PNP_LISW6       ------------------EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLG
PNP_LISIN       ------------------EVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERVGKVEDILKLG
PNP_ESCF3       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOUT       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOSM       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOSE       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOLU       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOLI       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOLC       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOL6       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOL5       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOK1       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOHS       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECODH       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECOBW       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO8A       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO81       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO7I       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO5E       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO57       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO55       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO45       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ECO24       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_BURTA       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_THICR       ------------------EPEIGKVYDAKVVKIVDFGAFVSYMPGREGLVHVSQIADERVEDVNEYLKEG
PNP_SERP5       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALTY       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALTI       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALPK       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALPC       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALPB       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALPA       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALG2       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALEP       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALCH       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SALAR       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_PECCP       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_NEIMF       ------------------------------------GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVG
PNP_NEIMB       ------------------------------------GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVG
PNP_NEIMA       ------------------------------------GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVG
PNP_NEIM0       ------------------------------------GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVG
PNP_NEIG2       ------------------------------------GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVG
PNP_NEIG1       ------------------------------------GAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVG
PNP_MARAV       ------------------EIEVGAIYKGRVERIVDFGAFVNILPGKDGLVHISQISERRIENVTDELSEG
PNP_KLEP7       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_JANMA       -------------------VEVGKIYEGTVLKLLDFGAIVQVMPGKDGLLHISQIANERVNAVADYLQEG
PNP_HERAR       -------------------VEVGKVYEGTVLKLLDFGAIVQVMPGKDGLLHISQIANERVNAVADYLKEG
PNP_GEOSL       ------------------EAEEGKLYMGTVKKVMDFGAFVEIFPGTDGLVHISELDTERVKNVTDVLNEG
PNP_ERWT9       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ENTS8       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_ENT38       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_CITK8       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
PNP_SYMTH       -----------------------------------FGAFVEILPGKEGLVHISELSDKRVARVEDVVNIG
PNP_PSEU2       ------------------EAEIGKIYIGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEPW       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEPU       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEPK       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEPG       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEPF       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEP1       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEFS       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEF5       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_PSEE4       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDVLKEG
PNP_PSE14       ------------------EAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKEG
PNP_METCA       -----------------------------------FGAFVTILPGKDGLVHISQISDEHVEKVSDKLAEG
PNP_LARHH       ------------------------------------GAIVQIMPGRDGLVHISQIANERIANVADHLQEG
PNP_CAUSK       ------------------EAEVGAIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEG
PNP_BURXL       -----------------LEVEVGQVYEGTVLKLLDFGAIVNILPGKDGLLHISEIANERIKDINDYLKDG
PNP_BURPP       -----------------LEVEVGQVYEGTVLKLLDFGAIVNILPGKDGLLHISEIANERIKDINDYLKDG
PNP2_ALKMQ      -----------------------------------FGAFVEILPGKEGLVHISNLAHERVAKVADVLAEG
PNP_SHIDS       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLLMG
PNP_HELMI       ------------------DVEVGKVYTGKVTRIMNFGAFVEVLPGKEGLIHISQLAEERVAKVEDVVKIG
PNP_BAUCH       ------------------EIEVGSIYHGKVTRIVDFGAFIAISSNKEGLVHISQITNKRVEKVADYLSID
PNP_BART1       ------------------EPEVGAIYQGTVVKTADFGAFINFFGSRDGLVHISQLASERVTKTTDIVKEG
PNP_ALISL       -----------------------------------FGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVG
PNP_YEREN       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVDKVTDYLQMG
PNP_YERE8       -----------------------------------FGAFVAIGGGKEGLVHISQIADKRVDKVTDYLQMG
PNP_SHEWM       ----------------------GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLQVG
PNP_SHESH       ----------------------GTIYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLQVG
PNP_SHEPW       ----------------------GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVG
PNP_SHEPA       ----------------------GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVG
PNP_SHEHH       ----------------------GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQIAEERVANVSDYLEVG
PNP_METPB       ------------------EPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAPQRVAKVGDVVKEG
PNP_METEP       ------------------EPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAAQRVAKVGDVVKEG
PNP_METC4       ------------------EPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAAQRVAKVGDVVKEG
PNP_IDILO       -------------------VEVGKIYQGKVARIVDFGAFVTVLPGKDGLVHISQIAEERVNDVNEYLKVG
PNP_HAES2       -----------------------------------FGAFVALVGNKEGLVHISQIAEERVEKVSDYLAIG
PNP_HAES1       -----------------------------------FGAFVALVGNKEGLVHISQIAEERVEKVSDYLAIG
PNP_BIFLO       --------------------EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNERIDAVEDVLKEG
PNP_BIFLI       --------------------EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNERIDAVEDVLREG
PNP_BIFLD       --------------------EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNERIDAVEDVLKEG
PNP_SODGM       -----------------------------------FGAFFAIGGGKEGLVHISQIADKRVEKVADYLELG
PNP_RALME       ------------------EAEVGKIYAGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEG
PNP_RALEH       ------------------EAEVGKIYAGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEG
PNP_GEOLS       ------------------EVEEGKLYMGTVKKIMEFGAFVEVLPGTDGLVHISELDETRVKNVTDILNEG
PNP_DICNV       ------------------EPEIGRIYDAKVTKITDFGAFLQFLPGKEGLVHISQIADYRVNDVRDELTEG
PNP_CUPTR       ------------------EAEVGKIYAGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEG
PNP_BIFAA       --------------------EAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNERIDAVEDVLKEG
PNP_ALKOO       ------------------EPEIGDIFKGKVIKLMNFGAFVEILPGKEGLVHISNLAHERVNKVEDVLAVG
PNP_SYNAS       ------------------DAEVGKIYRGTVKKVVDFGAFVEILPGTEGLLHISQLAKERVNKVTDIVNEG
PNP_SHESW       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHESR       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHESM       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHESA       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHEPC       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHEON       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHEB2       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHEAM       ------------------EVEVGRLYTGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLQLN
PNP_MANSM       ------------------EVEAGAVYTGKVTRLADFGAFVAIVGNKEGLVHISQIAEERVEKVSDYLXXX
PNP_LEGPA       ------------------EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICAERTQKVEEVLQEG
PNP_GLOVI       ----------------------------------NLGAFVEVMPGKEGLVHISQLAEHRVRKVEDELNVG
PNP_FINM2       ------------------EPEIGEKYLGRVTKIMNFGAFVEILPGKEGLLHISNIAHERTNKVEDVLKEN
PNP_CAUCR       ------------------EAEVGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEG
PNP_CAUCN       ------------------EAEVGKIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEG
PNP_BARBK       ------------------EPEVGTIYQGTVVKTTEFGAFINFFGSHDGLVHISQLASKRVAKTTDVVKEG
PNP_VIBPA       -----------------------------------FGAFVTVLPGKDGLVHISQIAEKRVEKVSDYLTEG
PNP_RHOCS       ------------------EPEVGEIYEGKVVKIMDFGAFVNFLGSRDGLVHISELKNERVAKVTDVVKQG
PNP_PHEZH       ------------------EPEVGQIYTGKVVKIVDFGAFVNFFGAKDGLVHVSQISNERVAKVSDVLTEG
PNP_HAEDU       -----------------------------------FGAFVTILGGKEGLVHISQITDARVERVSDYLSVG
PNP_GEOUR       ------------------EAEEGKLYMGLVKKVMEFGAFVEIFPGTDGLVHISELDTERVKNVTDILKEG
PNP_GEOSW       ------------------EVEVGQIYLGKVKRIEKFGAFVELFNGKDGLVHISELAEERVGRVEDVVSIG
PNP_GEOSF       ------------------EAEEGKLYMGLVKKVMEFGAFVEIFPGTDGLVHISELDTERVKNVTDVLKEG
PNP_DEIDV       -----------------------------------FGAFVNLYAGQDGMLHISQISEERLSAVEDALNVG
PNP_CLOB8       ------------------EVKAGEVYLGKVTKITTFGAFVEILPSKEGLVHISKLAKERVNKVEDVVSIG
PNP_BUCBP       ------------------EVEVGSVYTGKVTRIVDFGAFVSIGIGKEGLVHISQIAHKRVDKVSDHLRLH
PNP_BDEBA       ------------------EAEVGKTYKGRIVKIAEFGAFVEILPNTQGLLHISEISNERVRAVSDVLKEG
PNP_BARHE       ------------------EPEVGVIYQGTVVKTAEFGAFVNFFGSRDGLVHISQLTTERVTKTTDVVKEG
PNP_ANOFW       ------------------EVEVGQVYLGKVKRIEKFGAFVELFSGKDGLVHISELAEERVGKVEDVVSIG
PNP_AGRRK       ------------------EPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEG
PNP_VIBSL       -----------------------------------FGAFVTILPGKDGLVHISQIADKRVEKVSDYLTEG
PNP_SINMW       ------------------EPEVGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEG
PNP_RHISN       ------------------EPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEG
PNP_RHIME       ------------------EPEVGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEG
PNP_RHILW       ------------------EPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEG
PNP_RHILO       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLANERVAKTSDVVKEG
PNP_RHIL3       ------------------EPEIGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEG
PNP_RHIE6       ------------------EPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEG
PNP_RALEJ       ------------------EAEVGKIYNGTVLKLLDFGAIVNILPGKDGLLHISEIVNERVKDIKDWLKEG
PNP_GEOTN       ------------------EVEVGQVYLGKVKRIEKFGAFVELFNGKDGLVHISELAEERIGKVEDIVSIG
PNP_GEOSM       ------------------EAEEGKLYMGTVKKIMEFGAFVEIFPGTDGLVHVSELDTERVKNVSDILKEG
PNP_GEOBB       ------------------EAEEGKLYMGTVKKIMEFGAFVEIFPGTDGLVHVSELDTERVKNVSDILKEG
PNP_ENTFA       -------------------VEVGQVYLAKVVRIEKFGAFVNLIKGKDGLIHISQLANERVNNVEDVVKLG
PNP_CHLMU       ------------------EVEVGKIYNGRVTSVVAFGAFVEVLPGKEGLCHISELSKQKVDNVADFVKEG
PNP_BACHK       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACCZ       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACCR       ------------------EVQVGEIYEAKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACCQ       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACC7       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACC4       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACC3       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACC2       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACC1       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACAN       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACAH       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACAC       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACAA       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_AGRT5       ------------------EPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTSDVVKEG
PNP_STAS1       ------------------EAEVGQVYEGKVKRIEKYGAFVELFPGKDALVHISQIANERIDKVEDVLKVG
PNP_RUBXD       ------------------EVEAGDIYVGKVVKTTNFGAFVELTPGRDGLLHISRLAKQRVRRVEDVLNEG
PNP_MYXXD       ------------------EAEIGKIYTGTVRKIAEFGAFVELFPGTDGLIHISELSDKRVKSVSDVLNEG
PNP_LEGPH       ------------------EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICADRTQKVEEVLQEG
PNP_LEGPC       ------------------EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICADRTQKVEEVLQEG
PNP4_ALKMQ      ----------------------------------NFGAFLEILPGKEGLLHVSNIAHERVNKVEDVLEVG
RS1_STAHJ       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHEHIGTPGEKLEPG
PNP_VESOH       -----------------------------------FGAFINIMPNQDGLLHISEISHERVEKVKDHIREG
PNP_SPHAL       ------------------EAEVGKIYDGKVVNLVDFGAFVNFMGGKDGLVHVSEIRNERVEKVADVLSEG
PNP_SHEDO       -----------------------------------FGAFINILPGKDGLVHISQISDERVANVSDHLEMN
PNP_RHIEC       ------------------EPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTTDVVKEG
PNP_OCEIH       ------------------EVEVGQIYLGKVKRIEKFGAFVELFKGKDGLVHISELAEERTNKVEDVVSID
PNP_MOOTA       ------------------DVETGKVYNGKVTRVTDFGAFVEVIPGKEGLVHISQLANERVEKVEDVVQEG
PNP_SHEFN       -----------------------------------FGAFVNILPGKDGLVHISQISDERVANVSDHLEMN
PNP_DESHY       ------------------EVEVGRIYNGRVTRIMDFGAFVEVISGKEGLVHISQLAHGRVEKVEDVVKLG
PNP_DESHD       ------------------EVEVGRIYNGRVTRIMDFGAFVEVISGKEGLVHISQLAHGRVEKVEDVVKLG
PNP_CLOBB       ------------------DVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERVNKVEDVVSVG
PNP_CLOBA       ------------------DVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERVNKVEDVVSVG
PNP_BUCAP       -----------------------------------FGAFISIGIGKEGLVHISQISNKRVEKVSDHLTVD
PNP_BACSK       ------------------EVQVGETYHGKVKRIEKFGAFVELFKGKDGLLHISQIAEERINKVEDVFKLG
PNP_AGRVS       ------------------EPEIGVVYEGTVVKTADFGAFVNFFGSRDGLVHISQLAVDRVAKTQDVVKEG
PNP_SYNWW       ------------------EVEVGKTYMGTVKRIMDFGAFVEITSGKEGLVHISQLAEERVNKVRDVVDIG
PNP_LEGPL       ------------------EIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICAARTQKVEEVLQEG
PNP_GEOMG       ------------------EAEEGKLYMGTVRKVMDFGAFVEIFPGTDGLVHISELDTERVKDVTDILKEG
PNP_CHLPN       ----------------------------------AFGAFVEVLPGKEGLCHISECSRQRIENISDVVKEG
PNP_BURVG       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURS3       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURM1       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURCJ       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURCH       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURCC       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURCA       ------------------EIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BUCAT       ------------------EIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVDKVSNHLKID
PNP_BUCAI       ------------------EIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVDKVSNHLKID
PNP_BUCA5       ------------------EIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVDKVSNHLKID
PNP_BACHD       -----------------------------------FGAFVELFKGKDGLVHISQLAEERVNKVEDVVKIG
PNP_ZYMMO       ------------------EPEVGKIYNGKVVNIVDFGAFVNFMGGRDGLVHVSEIKNERVNKVSDVLSEG
PNP_VIBFM       -----------------------------------FGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVG
PNP_VIBF1       -----------------------------------FGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVG
PNP_THET8       -----------------------------------FGAFISLFPGTEGLLHISQIAPGRVARVEDHLKVG
PNP_THEPX       -----------------------------------FGAFVEIAPGKEGLVHISKLSKKRVQKVEDVVKVG
PNP_THEP3       -----------------------------------FGAFVEIAPGKEGLVHISKLSKKRVQKVEDVVKVG
PNP_SHEB9       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHEB8       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_SHEB5       ------------------EVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVANVSDHLELN
PNP_RICBR       ------------------------------------GAFVNYLGNKDGFVHISEIAEERIESVGSVLKQG
PNP_RICB8       ------------------------------------GAFVNYLGNKDGFVHISEIAEERIESVGSVLKQG
PNP_PELCD       -----------------------------------FGAFVEIFPGTEGLVHISELAKERVKKVTDILQEG
PNP_MESSB       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAPERVQKTTDVVKEG
PNP_HALOH       ------------------EVEVGDIYEGRVKKITNFGAFVEILPGREGLVHISELADHHVKKVEDIVKIG
PNP_CLOTE       ------------------DVEAGEIYLGKVTRTTNFGAFVEILPGKEGLVHISKLDFTRVNKVEDVVSVG
PNP_CHLTR       ------------------EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEG
PNP_CHLTB       ------------------EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEG
PNP_CHLTA       ------------------EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEG
PNP_CHLT2       ------------------EVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKVDNISDFVKEG
PNP_BURPS       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURP6       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURP1       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURP0       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURMS       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURMA       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURM9       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BURM7       ------------------EIEVGHVYEGTVLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEG
PNP_BACWK       ------------------EVQVGEIYLGKVKRVEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACSU       ------------------EVEVGQLYLGKVKRIEKFGAFVEIFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACLD       ------------------EVEVGQLYLGKVKRIEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
PNP_BACA2       ------------------EVEVGQLYLGKVKRIEKFGAFVEIFSGKDGLVHISELALERVGKVEDVVKIG
RS1_STAAW       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPG
RS1_STAAS       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPG
RS1_STAAR       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPG
RS1_STAAN       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPG
RS1_STAAM       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPG
RS1_STAAC       ----------------------------------NFGAFVEIAPGVQGLVHISEIAHKHIGTPGEVLEPG
PNP_THETH       -----------------------------------FGAFISLFPGTEGLLHISQIAPGRVERVEDHLKVG
PNP_THET2       -----------------------------------FGAFISLFPGTEGLLHISQIAPGRVERVEDHLKVG
PNP_SPHWW       ------------------EPEVGKIYTGKVVNLVDFGAFVNFMGGKDGLVHVSEIKNERVEKVADALSEG
PNP_RICM5       -----------------VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISEERIETVSSVLKQG
PNP_RICFE       -----------------VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISEERIETVSSVLKQG
PNP_RICAH       -----------------VEPEIGEIFNGTVMKVLDSGAFINYLGTKDGFVHISEIAEERIETVGSVLKQG
PNP_GEOKA       ------------------EVEVGQVYLGKVKRIEKFGAFVELFNGKDGLVHISELAEGRVGKVEDVVSIG
PNP_DEHSC       ------------------DIEAGSIYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRVEKVEDIVKVG
PNP_DEHSB       ------------------DIEAGSIYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRVEKVEDIVKVG
PNP_CLOPE       ------------------EVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEKVEDVVSVG
PNP_CLOP1       ------------------EVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEKVEDVVSVG
PNP_CHLFF       ------------------EVEVGKIYEGRVTSIVPFGAFVEILPGKEGLCHISEFSKQRIENVGDFVKQG
PNP_CHLCV       ------------------EVEVGKIYEGRVTSIVPFGAFVEILPGKEGLCHISEFSKQRIENVGDFVKQG
PNP_BORPE       ------------------DVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVG
PNP_BORPA       ------------------DVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVG
PNP_BORBR       ------------------DVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVG
PNP_BORA1       ------------------DVEVGQVYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVG
PNP_BIFA0       --------------------QAGETYKGTVVKTTSFGAFVNLTPGIDGLLHISQIRNQRIDAVEDVLKEG
PNP_BARQU       ------------------EPEVGGIYQGTVVKTAEFGAFVNFFGSRDGLVHISQLTTERVTKTTNVVKEG
PNP_STAHJ       ------------------EAEVGQVYNAKVKRIEKYGAFVELFAGKDALLHISQISKERINKVEDVLSIG
PNP_STAES       ------------------EAEVGQVYHAKVKRIEKYGAFVELFPGKDALLHISQISQERINKVEDVLKIG
PNP_STAEQ       ------------------EAEVGQVYHAKVKRIEKYGAFVELFPGKDALLHISQISQERINKVEDVLKIG
PNP_EXISA       -----------------------------------FGAFVELFKGKDALVHVSEFSLERVANVEDVVKLG
PNP_BORPD       ------------------DVEVGQVYDGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVG
PNP_BLOFL       -----------------------------------FGAFVTLFAGKEGLVHISQITEKRVNRVSDYLKLG
PNP_BACC0       ------------------EVQVGEIYEGKVKRVEKFGAFVELFSDKDGLVHISELALERVGKVEDVVKIG
PNP_RICRS       -----------------VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQG
PNP_RICRO       -----------------VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQG
PNP_RICPU       -----------------VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQG
PNP_RICCN       -----------------VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQG
PNP_RICAE       -----------------VEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERIETVSSVLKQG
PNP_PELPD       ------------------EAEEGKLYMGIVKKIMDFGAFVEILPGTDGLVHISELDTKRVKTVTEVLNEG
PNP_DEIRA       -----------------------------------FGAFVNLFPGQDGMLHISQLSEQRVENVEDVLTVG
PNP_CLOTH       ------------------DIEPGQVFLGRVIRVTSFGAFVEFLPGKEGLVHISKLDKKRVERVEDIVRVG
PNP_BACCN       ------------------EVQVGEIYLGKVKRIEKFGAFVELFSGKDGLVHISELALERVGKVEDVVKIG
GS13_BACSU      ------------------KFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVG
RS1_STAS1       ----------------------------------NFGAFVDI-GGVDGLVHVSELSHEHVKSPEDVVSIG
RS1H_BACC1      ------------------EVKAGDIREGIVKRLVTFGAFVEILPGVEGLVHVSQIANRHVKNPNEVLEMG
PNP_RUTMC       -----------------------------------FGAFINIKPNQDGLLHISEIAHERVDKVENHLKEG
PNP_LACLA       ----------------------------------SFGAFVNLFGKQDAMVHISEMAWARTENVEDVVKLG
PNP_HAMD5       -------------------IEVGRIYQGTVTRIADYGAFVSIASAKEGLVHISQIAEGRVEKVTDHLKLK
PNP_CLOPS       ------------------EVKSGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRVEKVEDIVSVG
PNP_CLONN       ------------------EVKEGEVYLGKVTKIANFGAFVEILPGKEGLVHISKLDVKRVNKVEDVVSVG
PNP_ANASK       ------------------EAEVGRIYLGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRVKSVSDVLSEG
PNP_ANADE       ------------------EAEVGRIYMGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRVKSVSDVLSEG
PNP_ANAD2       ------------------EAEVGRIYLGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRVKSVSDVLSEG
PNP_THEEB       ------------------KLNAGDVYLGRVTRIIPIGAFVELLPGKEGMIHISQLAEYRVGKVEDEVKIG
PNP_SYNP6       ------------------------------------GAFVEFLPGKEGMIHISQIADYRVARVEDELTVG
PNP_SYNE7       ------------------------------------GAFVEFLPGKEGMIHISQIADYRVARVEDELTVG
PNP_STACT       ------------------EAEVGQVYNAKVRRIEKYGTFVELFPGKDALLHISQIANQRINKVEDVLKLG
PNP_GEMAT       ----------------------------------AFGAFVEIMPGNEALLHVSEMRWERVEKPEDVVKKG
PNP_ELUMP       -----------------------------------FGAFVELIPGKDGLLHISEIDKKRINKVEDVLKMG
ISPH_CLOTE      ----------------------------------SFGAFVELEPGVDGLIHISQISHKRVDRVEDELSIG
RS1_LEULA       ------------------QIAAGSVLEGTVKRVKDFGAFVEILPGIEGLVHVSQISNKRIENPSEVLKSG
PNP_SULAA       -----------------LDVEVGEVYMGKVTRVEDYGAFVELLPGRLSLLHVSQITGERLKSAKEKIKVG
PNP_STRTD       -----------------------------------FGAFVHLFNKTDALVHISELAWKHTEHVEDVVKVG
PNP_STRT2       -----------------------------------FGAFVHLFNKTDALVHISELAWKHTEHVEDVVKVG
PNP_STRT1       -----------------------------------FGAFVHLFNKTDALVHISELAWKHTEHVEDVVKVG
PNP_RICCK       ------------------------------------GAFINYLGNKDGFVHISEISEERIDTVSSVIKQG
PNP_RHOSK       ------------------EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEG
PNP_RHOS5       ------------------EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEG
PNP_RHOS4       ------------------EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEG
PNP_RHOS1       ------------------EPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRLTHPNEVLKEG
PNP_OCHA4       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLASDRVAKTTDVVKEG
PNP_NITHX       -----------------------------------FGAFVNFFGAKDGLVHISQLAANRVQKSSDIVKEG
PNP_CLOAB       ----------------------------------NFGAFVEVLPGKEGLVHISKLDINKVNKVEDVVSVG
PNP_CHLAB       ------------------EVEVGKIYEGRVTSVVPFGAFVEILPGKEGLCHISEFSKQRIDNVGDFVKQG
IF2A_PYRFU      ----------------------------------NYGAFLDLDEGKEGFMHISEVASTWVKNIRDYLREG
PNP_STRGC       -----------------------------------FGAFVNLFDKTDALVHISELAWTRTNNVEDVVQIG
PNP_RICTY       -----------------VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISETRIDKVSSVLKQG
PNP_DEIGD       -----------------------------------FGAFVNLFPGQDGMLHISQMSENRVNAVEDVLNVG
PNP_BRUSU       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUSI       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUO2       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUME       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUMB       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUC2       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUAB       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUA2       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_BRUA1       ------------------EPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADRVAKTTDVVKEG
PNP_RICPR       -----------------VEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISDARIDKVSSVLKQG
PNP_NATTJ       ------------------EPEVGEVYLGKVVRTEKYGAFVEILPGKEGLVHISELAEDRVGKTEDVAKVG
PNP_HYPNA       ------------------EAEVGEIYEGKVVSMKDFGIFVNFFGPKDGLVHVSQMANKRIGHPKEMVKEG
PNP_GLUOX       ------------------EPEIGRIYEGKVVKTADFGAFVNFLGPRDGLVHISELAEGRVAKTSDVVKQG
PNP_DESRM       ------------------EVQVGKLYNGKVTRVTDFGCFVEVIPGKEGLVHISQLAFQRVEKTEDIVKEG
PNP_CYAP8       ------------------------------------GAFVEVLPGKEGMIHISQLAEGRVGKVEDEVAVG
PNP_CLOK5       ----------------------------------NFGAFVEIHKGKEGLVHISKLDFTRVNKVEDIVSVG
PNP_CLOK1       ----------------------------------NFGAFVEIHKGKEGLVHISKLDFTRVNKVEDIVSVG
PNP_BACP2       ------------------EVEVGQLYLGKVKRIEKFGAFLEIFSGKDGLVHISELALDRVGKVEDVVKIG
PNP_TRIEI       ------------------------------------GAFVEVFAGKEGMVHISQIADYRVGKVEDELAIG
PNP_PELUB       -----------------------------------FGAFVNFLGKQDGLVHISELATKRVEKVTDIVKEG
PNP_ERYLH       ------------------EAEVGKIYNGKVVNIVDFGAFVNFMGGKDGLVHVSEMKNERVEKPTDVVSEG
PNP_CYAP7       ------------------------------------GAFVEIMPGKEGMIHISQLAEGRVGKVEDELAVG
IF2A_PYRHO      ----------------------------------NYGAFLELDEGKEAFMHISEVASTWVRNIRDYLKEG
IF2A_PYRAB      ----------------------------------NYGAFLELDEGKEAFMHISEVASTWVRNIRDYLKEG
RR1_SPIOL       -----------------------------------YGAFIDI-GGINGLLHVSQISHDRVSDIATVLQPG
PNP_THISH       ------------------DVEVGRIYEGRVVKIMDFGAFVTILPGRDGLVHISQISEERVESVSDRLTEG
PNP_STRPZ       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRPM       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRPD       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRPC       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRPB       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRP8       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRP6       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_STRP1       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVG
PNP_SILST       ------------------EPEEGAVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEG
PNP_MICAN       ------------------------------------GAFVEVLPGKEGMIHISQLAEGRVGKVEDEVAVG
PNP_LEPBP       ------------------EIEVGKIYDGVIKRIADFGAFVEILPGKEGLCHISKLDVKRVQSVRDIVSEG
PNP_LEPBA       ------------------EIEVGKIYDGVIKRIADFGAFVEILPGKEGLCHISKLDVKRVQSVRDIVSEG
PNP_DESAP       ------------------EVKVGEVYLGRVVKIMDFGCFVEVIPGKDGLVHISHLAHNRVRKVEDVVREG
PNP_ANADF       ------------------EAEIGKTYLGTVRKIAEFGAFVELFPGTDGLIHISELSDKRVKSVSDVLSEG
RS1_STAEQ       ----------------------------------NFGAFVEIAPSVQGLVHISEIDHKHIGSPNEVLEPG
PNP_TREDE       -----------------------------------FGAFVEILPGKEGLCHISKLSRSRVEKVSDVLKEG
PNP_SYNFM       ------------------EPEVGQLYMSRIVRVTDFGAFAEILPNIEGLIHISQLEHRRVRKVTDVVQEG
PNP_SILPO       ------------------EPEEGQVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEG
PNP_SALRD       -----------------------------------FGAFVEIMPEKTGLLHVSEIDYDYVENVEDYLEVG
PNP_ROSDO       ------------------EPEEGMVYTGTVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEG
PNP_DINSH       ------------------EPEEGKVYTGTVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEG
PNP_CYAP4       ------------------KLSAGDVYVGKVTRIIPIGAFVEFLPGKEGMIHISQLADYRVNKVEDEVSVG
PNP_AKKM8       -------------------IEIGELYTGKIVSTTTFGAFMEVLPGKDGLIHISELAEGRTAKTEDVVSVG
IF2A_PYRKO      -----------------------------------YGAFLTLDEGKEGFMHISEVAPTWVKNIRDYLKEG
RS1H_BACSU      ----------------------------------SFGAFVEILPGVEGLVHISQISNKHIGTPHEVLEEG
PNP_STRSV       -----------------------------------FGAFVNLFDKTDALVHISELAWTRTNNVEDVVQIG
PNP_NOVAD       ------------------EAEVGKIYKGKVVNIVDFGAFVNFMGGKDGLVHVSEMKNERVEKPTDVVKEG
PNP_MARMM       ------------------EPEEGQIYKGKVVKVMDFGAFVNFFGPKDGLVHVSQLKAERVNHPSDVVKEG
PNP_MACCJ       ------------------EAEVGQIYMATVKRIEKFGAFVEIFPGKDALVHISQIALERINKVEDVVKLG
PNP_JANSC       -----------------------------------FGAFVNFFGKRDGLVHVSQIKNERLNHPSDVLSEG
PNP_ACIC5       -----------------------------------FGAFVEIFPGTDGLLHISEIAEHRVKEVKDELHEG
IF2A_METJA      -----------------------------------YGAFVELLEGKEGMIHISEVTSGWVKNIRDHVKVG
IF2A_HALMA      -----------------------------------FGVFVDLDEGKRGLCHISEVASGWIKNVRDHVNEG
PNP_SORC5       ------------------EPEVGATYKGTVKRITDFGAFVEILPNTDGLLHISEMAHTRVERVEDVVKEG
PNP_PERMH       -----------------MDIELGEVYMGKVTRVEDYGAFVELMPGKLSLLHVSQISPERIRSAKEKIKVG
PNP_DESAH       -----------------------------------FGAFVRIKTGTDGLVHISELANHRVKKVTDVVKEG
PNP_CLOBM       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_CLOBL       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_CLOBK       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_CLOBJ       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_CLOBH       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_CLOB6       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_CLOB1       ----------------------------------NFGAFVEILPGKEGLVHISKLDFARVEKVEDVVSVG
PNP_BUCCC       -----------------------------------FGAFVSIGFGKEGLIHISQISNKRIDKVINHLKIN
IF2A_THEON      -----------------------------------YGAFLKLDEGKEGFMHISEVASTWVKNIRDYVKEG
PNP_THEYD       ------------------EAELGRIYMGKVTRIVDFGAFVEIMPGVEGLLHISQIADKRIQKVSEVLKTG
PNP_NITWN       -----------------------------------FGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEG
PNP_EHRCR       ------------------EPEIGKVFEGTVVEIMKFGAFVSFLGGKKGLVHISEIRNEHISSVGSVISLN
RS1_SYNP6       -----------------------------------YGAFIDI-GGVSGLLHISEISHDHIETPHSVFNVN
PNP_STRPG       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVG
PNP_STRPF       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVG
PNP_STRP3       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVG
PNP_PARDP       ------------------EPEEGKIYVGKVVKLVDFGAFVNFFGKRDGLVHVSQIAGKRLNHPNEVLKEG
PNP_DESOH       -----------------------------------FGAFIQIKNGTDGLCHISELEHHHVKSVTDVVKMG
PNP_ACIBL       -----------------------------------FGAFVEILPGTDGLLHISEVAEHRIKDVKDELHEG
RS1A_SYNY3      -----------------------------------YGAFIDI-GGVSGLLHISEISHDHIDTPHSVFNVN
PNP_SOLUE       -----------------------------------FGAFVEIFPGTDGLLHISEIAENRIKDVRDELKEG
PNP_EXIS2       -----------------------------------FGAFVELFKGKDALVHISELALERVGQTEDVVKLG
PNP_COPPD       -------------------------------------AIVEIAPGKTGLLHVSEVSETRIRSLEDVLSVG
PNP_ANAPZ       ------------------EPEVGKIYSGEVCELAKYGAFVTFLGARKGLVHISEIRNEHINAVADVLAVG
IF2A_HALSA      -----------------------------------FGVFVDLEQDKRGLVHVSEVASGWIKNVRDHVNED
IF2A_HALS3      -----------------------------------FGVFVDLEQDKRGLVHVSEVASGWIKNVRDHVNED
PNP_STRA5       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTANVADVLEIG
PNP_STRA3       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTANVADVLEIG
PNP_STRA1       -----------------------------------FGAFVNLFDKTDALVHISEIAWTRTANVADVLEIG
PNP_SALAI       ----------------------------------AFGAFVSLLPGRDGLLHISKVGDKRVEKVEDYLNVG
PNP_FUSNN       -----------------------------------FGAFMEILPGKEGLLHISEISPERVEKVEDVLSVG
PNP_BRAHW       -----------------------------------FGAFVEILPGVEGLCHISELAYKHVMNVEEVLKIG
PNP_BEUC1       ----------------------------------SFGAFVSLTPGKDGLLHISQIRRKRVENVEDVLGVG
PNP_EHRCJ       ------------------EPEIGKVFEGTVVEIVKFGAFVNFLGGKRGLIHISEIKNEHISAVGSVISVN
PNP_CORA7       ----------------------------------AFGAFVSLTPGRDGLVHISKLGDERIEKVEDVVNVG
PNP_CHLPB       ------------------------------------GAFVEILPRTDGLVHISEIARERVNKVSDHLKQG
PNP_ANAVT       ------------------------------------GAFVEFLPGKEGMIHISQLADYRVGKVEDEVAVG
PNP_ANASP       ------------------------------------GAFVEFLPGKEGMIHISQLADYRVGKVEDEVAVG
IF2A_THEGJ      -----------------------------------YGAFLILDEGKEGFMHISEVAPTWVKNIRDYVKEG
PNP_THERP       ------------------------------------GAFVEILPGKDGFLHISEIAPERVRSVEDVLKVG
PNP_STRPI       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNNVEDLVAIG
PNP_SACEN       ----------------------------------AFGAFVSLLPGKDGLVHISKLGNKRIGKVEDVVNVG
PNP_NOSP7       ------------------------------------GAFVEFLPGKEGMIHISQLADYRVGKVEDEVAVG
PNP_EHRRW       ------------------EPEIGKVFDGTVIEIVKFGAFVSFLGGKRGLIHISEIKNEHINAVGSVISVN
PNP_EHRRG       ------------------EPEIGKVFDGTVIEIVKFGAFVSFLGGKRGLIHISEIKNEHINAVGSVISVN
PNP_ACIC1       -----------------------------------FGVFVSLLPGKDGLLHISELRKRRVENVEDVLKVG
MOG5_CAEEL      ----------------------------------SFGAFITLEGFRQGLVHISQIRNERVQTVADVLKRG
PNP_STRAT       ----------------------------------TFGAFVSLLPGKDGLLHISQIGGKRVENVEDVLGVG
PNP_ROSS1       ------------------EIKVGDIFLGKVVRIMPFGAFVNLAPGKDGMVHVSELDVGRVENVEDVIKMG
PNP_ROSCS       ------------------EIKVGDIFLGKVVRIMPFGAFVNLAPGKDGMVHVSELDVGRVENVEDVIKMG
PNP_LYSSC       -----------------------------------FGAFCEIFPGKDGLLHISEIQEERTKQVEDVLKLG
PNP_CHLPD       ------------------------------------GAFVEFLPKTDGLVHISEISKERVTKVSDHLKVG
PNP_STRZT       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRZJ       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRR6       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRPS       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRPN       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRPJ       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRP7       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRP4       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRP2       -----------------------------------FGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIG
PNP_STRGG       ----------------------------------TFGAFVSLMPGKDGLLHISQIGGKRVENVEDVLGVG
PNP_STRCO       ----------------------------------TFGAFVSLLPGKDGLLHISQIGGKRVENVEDVLGVG
PNP_STRAW       ----------------------------------TFGAFVSLLPGKDGLLHISQIGGKRVENVEDVLGVG
PNP_STAAW       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAT       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAS       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAR       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAN       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAM       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAE       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAC       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAAB       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAA9       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAA8       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAA3       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAA2       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_STAA1       -----------------------------------YGAFVGLFPGKDALLHISQISKNRIEKVEDVLKIG
PNP_SALTO       ----------------------------------AFGAFISLLPGRDGLLHISKVGDKRVEKVEDFLNVG
PNP_RHOBA       -----------------------------------FGAFVEILPGRDGLVHISEMSGGYISSLDQVIAVG
PNP_NITSB       -----------------VKFQEGDILKGKIKRTTNFGAFVELPGGVDGLLHISKLSSGRVERVEDVVNIG
PNP_BLOPB       -------------------VEIGAVYTGKVSHIVEFGAFVTILSGKEGLVHISQISERRINKVTDYXXXX
RS1_HELPY       -----------------------------------FGIFVE-AKGIEGLVHYSEISHKGPVNPEKYYKEG
PNP_AZOPC       -----------------------------------YGAFIEFLPGKEGLLHISEISWKHLESIEEALNEG
IF2A_ARCFU      -----------------------------------FGAFVSLDEGREGMVHISEVASGWIKDIREHVKKG
PNP_CORU7       ----------------------------------AFGAFISLLPGRDGLLHISNIGGDRIEKVEDELNVG
PNP_THETN       ------------------DIEVGGIYLGKVLRIAPFGAFVEIAPGKEGLVHISNLSXXXXXXXXXXXXXG
PNP_THEFY       ----------------------------------AFGAFVSLLPGKDGLLHISQIGGQRIENVEDVISIG
PNP_SULDN       -----------------IEYKVGDIHKGIVKKIVEFGAFIELPDGVDGLLHISKISDQRVEKVSDILKEG
PNP_SPICI       -----------------------------------FGVFVHLKENLDGLIHISKLAKQHVEKAEDIVQLN
PNP_PARUW       ------------------EIEIGRIYSGKAISIAPFGVFVEILPGKEGLCHISEFDVNRINSLDEFVKQG
PNP_NOCFA       ----------------------------------AFGAFVSLLPGRDGLVHISKLGNKRVAKVEDVVNVG
ISPH_CLOAB      -----------------------------------FGAFVKLEPGVDGLVHISEISHKRIAKPSDALNVG
PNP_RHOE4       ----------------------------------AFGAFVSLLPGRDGLVHISKLSGKRIAKVEDVVNVG
PNP_PELLD       ------------------------------------GAFVEFIPKTDGLVHISEISRERVTKVSDHLKVG
PNP_PSESM       ------------------EAEIGKIYLGKVERIVDFGAFVNILPGKDGLVHISMLSDARVEKVTDILKXX
PNP_PROVI       ------------------------------------GAFVEFIPKTDGLVHISEIANERVAKVSDHLKVG
PNP_NEOSM       ------------------QLKIGELYDGKIVSVVDFGLFVVLPNKQEGLVHISEISKNRVNDIRADYTEG
PNP_CHLSY       -----------------------------------FGAFVNILPGKDGMVHVSELDEKRVENVEDVVSLG
PNP_CHLAD       -----------------------------------FGAFVNILPGKDGMVHVSELDEKRVENVEDVVSLG
PNP_CHLAA       -----------------------------------FGAFVNILPGKDGMVHVSELDEKRVENVEDVVSLG
PNP_ARTS2       ----------------------------------TFGAFISLTPGKDGLLHISELGGKRVDNVEDVVSVG
PNP_ARTCA       ----------------------------------TFGAFVSLTPGKDGLLHISELRKKRVDNVDDVVSVG
PNP_ARTAT       ----------------------------------TFGAFVSLTPGKDGLLHISELRKKRVDNVDDVVSVG
RS1_CHLTR       ----------------------------------AFGAFVELQNGIEGLIHVSELSEKPFAKIEDVLSIG
PNP_UNCTG       -----------------VEAEVGKIYKSRVTKIMAFGAFAEILPGKEGLIHISQLSNRHTXXXXXXXXXX
PNP_MYCTU       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCTA       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCPA       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCMM       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCBT       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCBP       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCBO       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCA1       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_AMOA5       -----------------------------------FGAFVEFMPGKEGLLHISEVKWERIENLDQVLELG
PNP_PHYMT       ----------------------------------TFGAIAEIFPGIEGFIHISKLENYKVDKVEDVLKIG
PNP_ORITI       ------------------------------------GAFIKYVTGRDGFVHISEINDTHIKDINAHVKLG
PNP_ORITB       ------------------------------------GAFIKYVTGRDGFVHISEINDTHIKDINAHVKLG
PNP_MYCUA       -----------------------------------FGAFVALLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCA9       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVKVG
PNP_MICLC       ----------------------------------TFGAFVSLTPGKDGLLHVSELRKKRVDDVEDVLGVG
PNP_KINRD       ----------------------------------TFGAFVSLMPGKDGLLHISQLGGKRVDNVEDVVAVG
PNP_DEHE1       ------------------DVEAGSVYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRXXXXXXXXXXX
PNP_CORDI       ----------------------------------AFGAFVSLLPGRDGLVHISKLGGKRIEKVEDVVNVG
PNP_CLOCE       ------------------DIEPGEVYLGKVVRITTFGAFVEILPGKDGLVHISXXXXXXXXXXXXXXSIG
RS1_CHLMU       ----------------------------------AFGAFVELQNGIEGLIHVSKLSDKPFAKIEDILSIG
PNP_SULNB       -----------------MQYEVGKTYVGKVKKIVDFGIFVEMPDGFDALLHISKVAKERVNNLNERYHEG
PNP_CHLTE       ------------------------------------GAFVEFLPKTDGLVHISEIARERIAKVSDVLKVG
PNP_CARHZ       ------------------EIEVGKVYLGKVTRIADFGAFXXXXXXXXXXXHISQLAHSRVKRVEDVVKEG
RS1_CHLPN       ---------------------AGTVISGVVTKITAFGAFVELQNGIEGLIHVSELSDKPFAKIEDIISIG
PNP_FRASN       ----------------------------------NFGAFVSLTPGKDGLLHVSKLKQKRVEKVEDVLSVG
PNP_MYCLE       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_MYCLB       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVNVG
PNP_KOCRD       ----------------------------------TFGAFVSLTPGKDGLLHISEMRQKRVNEVDDVLSVG
PNP_COREF       ----------------------------------AFGAFVSLLPGRDGLVHISKLGNKRVEKVEDVVTVG
PNP_CHLP8       ------------------------------------GAFVEFLPKTDGLVHISEIARERIAKVSDVLKPG
IF2A_METST      -----------------------------------YGAFAKLEEGKEAFIHISEVSSGWVKNIRDYVREN
RS1_COXBU       ------------------ELQEGQEIKGVIKNITDYGAFVDL-GGVDGLLHITDMAWGRVKHPSDLLNVG
PNP_METS4       ------------------EPEAGMIYDGTVVKTMEFGAFVNFFGAKDGLVHISELAPQRVAXXXXXXXXX
PNP_METI4       -----------------------------------FGCFIEIKGKGEGLVHISELSDTPVRRVDQVVRVG
PNP_METFK       ------------------EVEVGQVYDGTVLKLLDFGAIVSLLPGKDGLLHISQIAHQRVNAVADF----
PNP_DICTD       -----------------------------------YGAFVEILPGKIGLLHISKYKTTGTNQTREEINLG
PNP_XANP2       ------------------EPEVGQIYEGTVVKVVDFGAFVNFFGSKDGLVHVSQMANERVAKPSXXXXXX
PNP_METNO       ------------------EPEAGMIYDGTVVKTMEFGAFINFFGAKDGLVHISELAPQRVAXXXXXXXXX
PNP_FRASC       ----------------------------------NFGAFVSLTPGRDGLLHVSKLGGKRVEKVEDVLTVG
PNP_DICT6       -----------------------------------YGAFVEILPGKIGLLHISKYKTTGTNQTREEINLG
PNP_CLAMS       ----------------------------------TFGAFVSLLPGKDGLLHISEVGGKRVENVEDVLGVG
PNP_CLAM3       ----------------------------------TFGAFVSLLPGKDGLLHISEVGGKRVENVEDVLGVG
PNP_ACHLI       ------------------------------------GVFAEIFPGTEGLVHISKWEKERTESLDGKVKVG
YHGF_ECOLI      ------------------DLQPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLSNKFVEDPHTVVKAG
RS1_HELPJ       -----------------------------------FGIFVKFKGID-GLVHYSEISHKGPVNPEKYYKEG
PNP_PROAC       ----------------------------------SFGAFVSLLPGKDGLLHISKMRDKRVEAVEDVLSVG
PNP_MAGSA       ------------------EPELGVIYNGKVVKVVDFGAFVNFLGSRDGLVHISELARERVAKTAXXXXXX
PNP_GRAFK       --------------------EKGSVYEVKVIKVLDFGAVVEYAPGNEVLLHISELAWERTNDVNDVLKLG
PNP_RENSM       ----------------------------------TFGAFVSLTPGKDGLLHVTELRKKRVDNVDDVVSVG
PNP_MYCVP       -----------------------------------FGAFVSLLPGRDGLVHISKLGRKRINKVEDVAKVG
PNP_MYCSS       -----------------------------------FGAFVSLLPGRDGLVHISKLGRKRIAKVEDVAKVG
PNP_MYCSK       -----------------------------------FGAFVSLLPGRDGLVHISKLGRKRIAKVEDVAKVG
PNP_MYCSJ       -----------------------------------FGAFVSLLPGRDGLVHISKLGRKRIAKVEDVAKVG
PNP_MYCGI       -----------------------------------FGAFVSLLPGRDGLVHISKLGRKRINKVEDVAKVG
PNP_HERA2       -----------------------------------YGAFVNVLPGKDGMVHVSELDEKRVENVEDVVKIG
PNP_CYTH3       ----------------------------------AFGAFVEFLPGKDGLLHISEIKWERLDTMEGVLEVG
PNP_CORK4       ----------------------------------AFGAFVSILPNRDGLVHISKLGKKRIEKVEDVVNVG
PNP_CORJK       ----------------------------------AFGAFVSLLPGRDGLIHISNLGGDRIERVEDEVSVG
PNP_CHLCH       ------------------------------------GAFVEFLPKTDGLVHISEISSTRVAKVSDHLKVG
IF2A_METTH      ----------------------------------NYGAFATLEEGKEAFIHISEVSSGWVKNIRDFVREN
IF2A_METKA      ------------------------------------GAFVTLDEGVDGYIHISEVASGWVKNIRDYVKEG
PNP_OPITP       -------------------IEVGKIYTGRVTGVKEFGCFVECTPGNEGLCHVSELADFRVRRTEDVVKMG
PNP_METRJ       ------------------EPEVGVIYDGTIVKCMEFGAFVNFFGAKDGLVHISELAAQRVAXXXXXXXXX
PNP_FLAPJ       -----------------------------------FGAVVEYTAGNEVLLHVSELAWERTENVTDVVNMG
PNP_ANATD       ------------------EIEVGQFFLGKVTRTASYGAFVEIYPGKEGLVHISQLDERRLKSXXXXXXXX
ISPH_FUSNN      ------------------EYKVGTTVEKKIKTVADFGLFIELIKGIDGFIPTQFASKEFIKNIRDKFSEG
PNP_PELPB       ------------------------------------GAFVEFLPKTDGLVHISEISSERVTKVSDHLKIG
PNP_MAGSM       ------------------EVEKGQVYEGKVVRITDFGAFVNILPNKDGLVHISQLANRRVQNXXXXXXXX
IF2A_METS3      ----------------------------------NYGAFAKLEEGKEAFIHISEVSSGWVKNIRDHVREN
PNP_RHOSR       ----------------------------------AFGAFVSLLPGRDGLVHISKLSGKRIAKVEDVVSVG
PNP_RHOOB       ----------------------------------AFGAFVSLLPGRDGLVHISKLSGKRIAKVEDVVSVG
PNP_NOCSJ       ----------------------------------NFGAFVSLMPGKDGLLHISKLGGKRVDAVEDVVSVG
PNP_MYCS2       -----------------------------------FGAFVSLLPGRDGLVHISKLGKKRIAKVEDVVKVG
PNP_FRAAA       ----------------------------------NFGAFVSLTPGRDGLLHVSKLGGKRVEKVEDVLTVG
PNP_CALS8       ------------------EIEVGQFFLGKVTRTASYGAFVEIYPGKEGLVHISQLDNKKLKSXXXXXXXX
PNP_BREBN       -----------------------------------YGAFIELFAGKEGLCHISQLAEERVAKTEXXXXXX
Y568_HAEIN      ------------------DLKSGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVEDPHQVVKTG
PNP_WOLPP       ------------------ELEQGSIIDAKVVKIEKSIVELELLNGRKGKMHISEVANQHVESIEDILKQG
PNP_LACLS       ----------------------------------SFGAFVNLFGKQDAMVHISEMAWARTAKVEDVMKLG
PNP_LACLM       ----------------------------------SFGAFVNLFGKQDAMVHISEMAWARTAKVEDVMKLG
PNP_AERS4       -----------------------------------FGAFVNILPGKDGLVHISQITDARVQNVAXXXXXX
RS1_BUCBP       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNIG
PNP_SULSY       -----------------MDIELGEVYLGKVTRVEDYGAFVELMPGKLSLLHVSQISSERLKSAXXXXXXX
PNP_PROA2       ------------------------------------GAFVEFLPKTDGLVHISEISNERVAKVSDHLKPG
PNP_PARD8       -----------------------------------YGAFVEFMPGKDGLLHISEIDWKRLETVEQALKEG
PNP_LEIXX       ----------------------------------AFGAFVSLLPGKDGLLHISEVGGKRVESVDDVLSIG
IF2A_THEVO      ----------------NIKLEVGDLVVVKITEVKNFGAILEEYPGVEGYIHISEVATGWVKHIRSYLREG
RS1_BUCAP       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
RR1_PORPU       -----------------------------------YGLFIK-AGNLKGLVHISEINVKQVERIPSQFKIG
PNP_SULMW       --------------------KVGTIYKAKVKNIKKFGVFVKISKYLEGLLHIYEIS--WLTKVESFIRKG
PNP_PROM9       ------------------------------------GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXX
RS1_PSEAE       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRIKHPSEIVNVG
RS1_PROSP       -----------------------------------FGIFIGLEGGIDGLVHLSDISWNVAGEVREYKKGD
PNP_PROMS       ------------------------------------GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXX
PNP_PROMP       ------------------------------------GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXX
PNP_PROM5       ------------------------------------GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXX
PNP_PROM2       ------------------------------------GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXX
PNP_PROM0       ------------------------------------GAFVEILPGKEGMVHISQLSEAXXXXXXXXXXXX
PNP_FLAJ1       -----------------------------------FGAVVEYAPGNEVLLHVSELAWERTENVADVVKMG
PNP_BACFR       -----------------------------------YGAFVEFLPGKDGLLHISEIDWKRLETVEEAIKEG
PNP_BACFN       -----------------------------------YGAFVEFLPGKDGLLHISEIDWKRLETVEEAIKEG
PNP_ARCB4       -----------------------------------FGAFILLPKGGEGLLHISKISKDRVKNVADVLSIG
RS1_RHOPA       -------------------LEEGQVIDGVVKNITDYGAFVDL-GGIDGLLHVTDIAWRRVNHPTEVLTIG
RS1_HAEIN       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
RS1_BUCAI       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
PNP_WOLSU       -----------------------------------FGAFIELPKGGDGLLHVSKIVQHRDQRIDEVIKEG
PNP_THEAB       ------------------DIEVGDVFEGKITRIEPYGIFVELMPGKIGLAHSSKLG-EDSKNFKEKYKIG
PNP_BACTN       -----------------------------------YGAFIEFLPGKDGLLHISEIDWKRLETVEEAIKEG
RS1_SHIFL       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
RS1_RHIME       -------------------LEEGQVVEGVVKNITDYGAFVDL-GGIDGLLHVTDMAWRRVNHPSEILNIG
RS1_ECOLI       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
RS1_ECOL6       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
RS1_ECO57       -----------------------------------YGAFVDL-GGVDGLLHITDMAWKRVKHPSEIVNVG
PNP_WIGBR       -----------------------------------FGIFACLINNKEGLIHVSKIPYKKFSDINNNFKIG
PNP_BACV8       -----------------------------------YGVFVEFLPGKDGLLHISEIDWKRLETIEEALKEG
RS1_MYCTU       -----------------------------------FGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVG
RS1_MYCLE       -----------------------------------FGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVG
PNP_GLUDA       ------------------EPELGAIYTGKVVKTADFGAFVNFLGARDGLVHISELAQGRVAKTTXXXXXX
PNP_CHLL2       ------------------------------------GAFVEFLPKTDGLVHISEIATERVAKVSDHLKIG
PNP_AZOC5       ------------------EPEVGAIYDGTVVKVVDFGAFVNFFGSKDGLVHISQLSKERVAXXXXXXXXX
PNP_ANAMM       ------------------EPEVGKVFSGVISEIAKYGAFVSFLGGRRGLVHISEIKNEHI----------
PNP_ANAMF       ------------------EPEVGKVFSGVISEIAKYGAFVSFLGGRRGLVHISEIKNEHI----------
PNP_ACICJ       ------------------EPEVGQIYTGKVVKIADFGAFVNFFGARDGLVHISELAQGRVARXXXXXXXX
IF2A_THEAC      ----------------------------------NFGAVLEEYPGVEGYIHISEVATGWVKHIRSYLREG
PNP_PORGI       -----------------------------------YGCFVEFLPGKEGLLHISEVDWKRFETIEDNLKEG
PNP_PORG3       -----------------------------------YGCFVEFLPGKEGLLHISEVDWKRFETIEDNLKEG
RR1_PORYE       -----------------------------------YGLFIKV-GNLKGLVHISEINIKNLEQISSQFKIG
PNP_WOLTR       ------------------ELEQGAXXXXXXXXXXXXXXELELFNGRKGKMHISEVANQHIESIESILKQG
PNP_SYNJA       ------------------------------------GAFVEFLPGKEGMIHISQLAEYRVSRXXXXXXXX
PNP_METSB       -----------------------------------FGAFVNFFGSKDGLVHISQLAKGRVAKSSDXXXXX
TEX_BORPE       ----------------------------------NFGAFVDIGVHQDGLVHISALAEKFVKDPRD-----
RS1_NEIMB       -------------------LQEGSVIKGIVKNITDYGAFVDL-GGIDGLLHITDLAWRRVKHPSEVLEVG
PNP_RHORT       ------------------EPEIGVVYTGKVVKIMDFGAFVNFLGTRDGLVHISELSQDRXXXXXXXXXXX
PNP_PARL1       ------------------EPEVGKIYEGTVVKAVDFGAFVNFFGPRDGLVHISQMAPTRVEQVSXXXXXX
PNP_TROWT       -----------------------------------FGSFISLVPGKDGLLHISEIRKRHLESVDEVLSVG
PNP_TROW8       -----------------------------------FGSFISLVPGKDGLLHISEIRKRHLESVDEVLSVG
PNP_STRMK       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSDRVEXXXXXXXXX
PNP_STRM5       ------------------DVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSDRVEXXXXXXXXX
PNP_BRAJA       ------------------EPEVGQIYDGTVVKVMEFGAFVNFFGSKDGLVHISQLASARVQKTSXXXXXX
YHGF_NEIMB      ------------------DLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPRE-----
YHGF_NEIMA      ------------------DLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPRE-----
PRP22_YEAST     ----------------------------------TFGCFVQIFGTRMGLVHISEMSDQRTLDPHDVVRQG
PNP_STRE4       -----------------------------------FGAFVNLFDKTDALVHISEIAWSRTTNVSDVL---
PNP_PROMM       ------------------------------------GAFVEILPGKEGMIHISQLSEARXXXXXXXXXXX
PNP_PROM3       ------------------------------------GAFVEILPGKEGMIHISQLSEARXXXXXXXXXXX
PNP_HYDS0       ----------------------------------NYGLFVEVLPGKVGLLHASAMTEKPTINV------G
PNP_ACAM1       ------------------KLAAGDVFLGKVTRIIPIGAFVEIAPSKEGMIHISQLADYRXXXXXXXXXXX
PNP_DESAA       --------------------EVGAVYEGTVVKIMDFGAFVAILPGTEGLCHISQLDTKHVKKVSDXXXXX
PNP_CHLT3       ------------------------------------GAIVEILPGVTGLLHISELSHQRGTKPSDILKVG
PNP_BEII9       -----------------------------------FGAFVNFFGSKDGLVHISQLAKGRVAKTSXXXXXX


                         .         .         *         .         .         .         .:140
query           DIVQVLIKGRDAKGRLDLSIKDLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PNP_PSEA6       QIINVKVMEIDRQNRVRLSIKEL-----------------------------------------------
PNP_DELAS       QIIKVKVMETDEKGRVKLSLKALT----------------------------------------------
PNP_VARPS       QIVKVKVLETDEKGRVKLSMKALT----------------------------------------------
PNP_RHOFD       QIVKVKVMETDEKGRIKLSMKVL-----------------------------------------------
PNP_HAHCH       QEVVVKVLDIDARGRIKLSMKEVT----------------------------------------------
PNP_POLSJ       QIVKVKVLETDEKGRVKLSMKAL-----------------------------------------------
PNP_POLNA       QIIKVKVLETDEKGRVKLSMKAL-----------------------------------------------
PNP_COXBU       QVIRVKVIEIDRQGRVRLSMKQI-----------------------------------------------
PNP_COXBR       QVIRVKVIEIDRQGRVRLSMKQI-----------------------------------------------
PNP_COXBN       QVIRVKVIEIDRQGRVRLSMKQI-----------------------------------------------
PNP_COXB2       QVIRVKVIEIDRQGRVRLSMKQI-----------------------------------------------
PNP_COXB1       QVIRVKVIEIDRQGRVRLSMKQI-----------------------------------------------
PNP_TERTT       QEVDVKCMDIDQRGRIKLSIKEL-----------------------------------------------
PNP_VEREI       QIVRVKVMEADERGRVKLSMKVL-----------------------------------------------
PNP_THIDA       QVVRVKILEADEKGRLRLSMKAL-----------------------------------------------
PNP_ACISJ       QIVKVKVLETDDKGRVKLSMKAL-----------------------------------------------
PNP_DIAST       QVVKVKVLETDDKGRVKLSMKAL-----------------------------------------------
PNP_PSEHT       QEVKVKVLEVDRQGRVRLSIKE------------------------------------------------
PNP_CLOD6       DEVEVKVTEIDEKGRVNLSRKVL-----------------------------------------------
PNP_ALCBS       EIIKVKVLDVDQRGRIKLSMKE------------------------------------------------
PNP_CLOPH       DVVKVVCLGKDKMGRISFSIKD------------------------------------------------
PNP_ACTSZ       QDVQVKVVEIDRQGRIRLTMKDI-----------------------------------------------
PNP_ACIAC       QVVKVKVLETDEKGRVKLSMRAL-----------------------------------------------
PNP_SACD2       QDIEVKCMDIDQRGRIKLSIK-------------------------------------------------
PNP_SHELP       QEVKVKVMEVDRQGRVRLSMKE------------------------------------------------
PNP_ALHEH       DTVRVKVLEVDRQGRIRLSMK-------------------------------------------------
PNP_PSYA2       QIVKVLVQDVDNRGRIKLTMKGI-----------------------------------------------
PNP_METPP       QIVKVKVLETDEKGRIKLSLKAL-----------------------------------------------
PNP_CELJU       QVVKVKCLDVDQRGRIKLSIK-------------------------------------------------
PNP_PSYCK       QIVKVLVQDVDNRGRIKLTMKGI-----------------------------------------------
PNP_NITMU       QVVRVKVLEADDKGRLRLSMK-------------------------------------------------
PNP_ACIBS       QEVKVQVQDVDNRGRIKLTMKDI-----------------------------------------------
YABR_BACSU      DQVEVKVINVEKDGKIGLSIK-------------------------------------------------
PNP_MARMS       QEVIVKVLDVDARGRIKLSMKDVT----------------------------------------------
PNP_PSYWF       QQINVLVQDVDNRGRIKLTMK-------------------------------------------------
PNP_LEPCP       QVVKVKVLETDEKGRIKLSMKAL-----------------------------------------------
PNP_PHOLU       QETSVKVLEIDRQGRVRLSIKEAT----------------------------------------------
PNP_ACIAD       QDVKVQVADVDNRGRIKLSMKDI-----------------------------------------------
PNP_PSYIN       QEVKVKVLEVDRQGRVRLSIKE------------------------------------------------
PNP_VIBCM       QEVQVKVLEIDRQGRVRLSMKE------------------------------------------------
PNP_VIBCH       QEVQVKVLEIDRQGRVRLSMKE------------------------------------------------
PNP_VIBC3       QEVQVKVLEIDRQGRVRLSMKE------------------------------------------------
PNP_PHOLL       QEVSVKVLEIDRQGRVRLSIKEAT----------------------------------------------
PNP_PELTS       DVILVKVTGYDSQGRLKLSKKEAT----------------------------------------------
PNP_LEPIN       DIIRVKVLNVDKTGKIDLSRKD------------------------------------------------
PNP_LEPIC       DIIRVKVLNVDKTGKIDLSRKD------------------------------------------------
PNP_LEPBL       DIIRVKVLNVDKTGKIDLSRKD------------------------------------------------
PNP_LEPBJ       DIIRVKVLNVDKTGKIDLSRKD------------------------------------------------
PNP_ACIBY       QEVKVQVQDVDNRGRIKLTMKDI-----------------------------------------------
PNP_ACIBT       QEVKVQVQDVDNRGRIKLTMKDI-----------------------------------------------
PNP_ACIBC       QEVKVQVQDVDNRGRIKLTMKDI-----------------------------------------------
PNP_ACIB5       QEVKVQVQDVDNRGRIKLTMKDI-----------------------------------------------
PNP_ACIB3       QEVKVQVQDVDNRGRIKLTMKDI-----------------------------------------------
PNP3_ALKMQ      DLIEVKLMEINPQGKIGLSRKAL-----------------------------------------------
PNP_RALSO       QMVRVKLLSTDEKGRMRLSIK-------------------------------------------------
PNP_PSEU5       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PASMU       QEVTVKVVEIDRQGRIRLTMKEV-----------------------------------------------
PNP_NITEU       QTVRVKVLEADEKGRLRLSMK-------------------------------------------------
PNP_ECO27       QEVPVKVLEVDRQGRIRLSIKEAT----------------------------------------------
PNP_DESPS       DTIEVKVLDVDNRGRIRLSRKAL-----------------------------------------------
PNP_AZOVD       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEAE       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEAB       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEA8       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEA7       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_POLSQ       QVVRVKLLAADERGRLRLSLK-------------------------------------------------
PNP_POLNS       QVVRVKLLAADERGRLRLSLK-------------------------------------------------
PNP_NITOC       DVIRVKVLEVDKQGRVRLSVK-------------------------------------------------
PNP_NITEC       QIIRVKVLEADDKGRLRLSMK-------------------------------------------------
PNP_KLEP3       QEVPVKVLEVDRQGRVRLSIKEAT----------------------------------------------
PNP_AZOSE       QAVRVKVLETDERGKIRLSMKAL-----------------------------------------------
PNP_RALPJ       QAVRVKLLSTDEKGRMRLSIK-------------------------------------------------
PNP_HAEIN       QEVNVKVVEIDRQGRIRLTMKDL-----------------------------------------------
PNP_HAEIG       QEVNVKVVEIDRQGRIRLTMKDL-----------------------------------------------
PNP_HAEIE       QEVNVKVVEIDRQGRIRLTMKDL-----------------------------------------------
PNP_HAEI8       QEVNVKVVEIDRQGRIRLTMKDL-----------------------------------------------
PNP_DECAR       QIVRVKVLETDDRGRVKLSMK-------------------------------------------------
PNP_BURCM       QQVKVKVIQTDEKGRVRLSAKAL-----------------------------------------------
PNP_BURA4       QQVKVKVIQTDEKGRVRLSAKAL-----------------------------------------------
PNP_AZOSB       QAVRVKVLETDERGKIRLSMKAL-----------------------------------------------
PNP_TOLAT       DMVRTKVLEVDRQGRIRLSIKE------------------------------------------------
PNP_PROMH       QEVPVKVLEIDRQGRIRLSMK-------------------------------------------------
PNP_CHRVO       QVVKVKAIEMDDRGRIRLSIKAL-----------------------------------------------
PNP_XYLFT       DVVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XYLFM       DVVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XYLFA       DVVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XYLF2       DVVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_COLP3       QEVKVKVLEVDRQGRVRLSI--------------------------------------------------
PNP_CHRSD       QEVIVKVLDIDNRNRVKLSIKEVT----------------------------------------------
PNP_BURP8       QQVKVKVIQTDEKGRVRLSAKAL-----------------------------------------------
PNP_AERHH       DVVKVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_ACTPJ       QEVTVKVVEIDRQNRIRLTMKDL-----------------------------------------------
PNP_ACTP7       QEVTVKVVEIDRQNRIRLTMKDL-----------------------------------------------
PNP_ACTP2       QEVTVKVVEIDRQNRIRLTMKDL-----------------------------------------------
PNP1_ALKMQ      DLIEVKLMEINPQGKIGLSRKAL-----------------------------------------------
PNP_YERPY       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPS       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPP       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPN       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPG       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPE       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPB       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERPA       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_YERP3       QDVPVKVMEVDRQGRIRLSIK-------------------------------------------------
PNP_XANOR       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANOP       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANOM       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANCP       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANCB       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANC8       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANC5       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_XANAC       DLVRVKVLEVDKQGRIRLSIK-------------------------------------------------
PNP_PHOPR       QEVQVKVLEIDRQGRIRLSMKE------------------------------------------------
PNP_LISMO       DEVTVKVIEVDQQGRVNLSRKAL-----------------------------------------------
PNP_LISMH       DEVTVKVIEVDQQGRVNLSRKAL-----------------------------------------------
PNP_LISMF       DEVTVKVIEVDQQGRVNLSRKAL-----------------------------------------------
PNP_LISMC       DEVTVKVIEVDQQGRVNLSRKAL-----------------------------------------------
PNP_HALHL       DSVRVKVLEVDRQGRIRLSMK-------------------------------------------------
PNP_HAEPS       QDVQVKVVEIERQGRIRLTMKDL-----------------------------------------------
PNP_ERWCT       QEVPVKVLEVDRQGRVRLSIKE------------------------------------------------
PNP_EDWI9       QEVAVKVLEVDRQGRVRLSIKE------------------------------------------------
PNP_ACIF5       QAVRVKVLEVDRQGKIKLSMKDI-----------------------------------------------
PNP_ACIF2       QAVRVKVLEVDRQGKIKLSMKDI-----------------------------------------------
PNP_VIBVY       QEVQVKVLEIDRQGRVRLSM--------------------------------------------------
PNP_VIBVU       QEVQVKVLEIDRQGRVRLSM--------------------------------------------------
PNP_VIBHB       QEVQVKVLEIDRQGRVRLSMKE------------------------------------------------
PNP_SHISS       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_SHIFL       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_SHIF8       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_SHIBS       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_SHIB3       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_PSEMY       QEVKVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_LISW6       DEVTVKVIEVDHQGRVNLSRKAL-----------------------------------------------
PNP_LISIN       DEVTVKVIEVDHQGRVNLSRKAL-----------------------------------------------
PNP_ESCF3       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOUT       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOSM       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOSE       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOLU       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOLI       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOLC       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOL6       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOL5       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOK1       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOHS       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECODH       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECOBW       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO8A       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO81       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO7I       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO5E       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO57       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO55       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO45       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_ECO24       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_BURTA       QQVKVKVIQTDEKGRVRLSAKAL-----------------------------------------------
PNP_THICR       QEIKVRLTDVDKQGRVKLSIK-------------------------------------------------
PNP_SERP5       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALTY       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALTI       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALPK       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALPC       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALPB       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALPA       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALG2       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALEP       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALCH       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SALAR       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_PECCP       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_NEIMF       QVVNVKALEVDDRGRVRLSIKAL-----------------------------------------------
PNP_NEIMB       QVVNVKALEVDDRGRVRLSIKAL-----------------------------------------------
PNP_NEIMA       QVVNVKALEVDDRGRVRLSIKAL-----------------------------------------------
PNP_NEIM0       QVVNVKALEVDDRGRVRLSIKAL-----------------------------------------------
PNP_NEIG2       QVVNVKALEVDDRGRVRLSIKAL-----------------------------------------------
PNP_NEIG1       QVVNVKALEVDDRGRVRLSIKAL-----------------------------------------------
PNP_MARAV       QEVLVKVLDVDNRGRVKLSMKEV-----------------------------------------------
PNP_KLEP7       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_JANMA       QQVRVKVLETDDRGRLKLSMK-------------------------------------------------
PNP_HERAR       QQVRVKVLETDDRGRLKLSMK-------------------------------------------------
PNP_GEOSL       DKVLVKCIGIDKQGKIKLSRKE------------------------------------------------
PNP_ERWT9       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_ENTS8       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_ENT38       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_CITK8       QEVPVKVLEVDRQGRVRLSIK-------------------------------------------------
PNP_SYMTH       DEVTVKVTEIDRLGRINLSIKD------------------------------------------------
PNP_PSEU2       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEPW       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEPU       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEPK       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEPG       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEPF       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEP1       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEFS       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEF5       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSEE4       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_PSE14       QEVEVLVLDVDNRGRIKLSIKDV-----------------------------------------------
PNP_METCA       DMVKVKVLEIDRQGRVRLSMK-------------------------------------------------
PNP_LARHH       QQVRVKVLETDERGRIRLSIK-------------------------------------------------
PNP_CAUSK       QIVKVKLLGFDDRGKTKLSMK-------------------------------------------------
PNP_BURXL       QQVKVKVIQTDEKGRVRLSAKAL-----------------------------------------------
PNP_BURPP       QQVKVKVIQTDEKGRVRLSAKAL-----------------------------------------------
PNP2_ALKMQ      DLIEVKLMEINPQGKIGLS---------------------------------------------------
PNP_SHIDS       QEVPVKVLEVDRQGRIRLSIK-------------------------------------------------
PNP_HELMI       DEVTVKVVEIDKQGRINLSRKEV-----------------------------------------------
PNP_BAUCH       QIVLVKVLEVDRQGRIRLSMKD------------------------------------------------
PNP_BART1       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_ALISL       QEVQTKVLEIDRQGRIRLSIKEAT----------------------------------------------
PNP_YEREN       QEVPVKVIEVDRQGRIRLSMK-------------------------------------------------
PNP_YERE8       QEVPVKVIEVDRQGRIRLSMK-------------------------------------------------
PNP_SHEWM       QEVKVKVMEVDRQGRVRLSM--------------------------------------------------
PNP_SHESH       QEVKVKVMEVDRQGRVRLSM--------------------------------------------------
PNP_SHEPW       QEVKVKVMEVDRQGRVRLSM--------------------------------------------------
PNP_SHEPA       QEVKVKVMEVDRQGRVRLSM--------------------------------------------------
PNP_SHEHH       QEVKVKVMEVDRQGRVRLSM--------------------------------------------------
PNP_METPB       QKVKVKFLGADERGKIRLSMK-------------------------------------------------
PNP_METEP       QKVKVKFLGADERGKIRLSMK-------------------------------------------------
PNP_METC4       QKVKVKFLGADERGKIRLSMK-------------------------------------------------
PNP_IDILO       DVVPVKVLEIDRQGRVRLSM--------------------------------------------------
PNP_HAES2       QEVIVKVLEIDRQGRIRLTMKEL-----------------------------------------------
PNP_HAES1       QEVIVKVLEIDRQGRIRLTMKEL-----------------------------------------------
PNP_BIFLO       DTVEVIVQGVDDRGKISLAI--------------------------------------------------
PNP_BIFLI       DTVEVIVQGVDDRGKISLAI--------------------------------------------------
PNP_BIFLD       DTVEVIVQGVDDRGKISLAI--------------------------------------------------
PNP_SODGM       QEVPVKVLEVDRQGRVRLSIKE------------------------------------------------
PNP_RALME       QQVRVKLIQADEKGRLRLSLK-------------------------------------------------
PNP_RALEH       QQVRVKLIQADEKGRLRLSLK-------------------------------------------------
PNP_GEOLS       DKVLVKCIGVDKQGKIKLSRK-------------------------------------------------
PNP_DICNV       QEVKVKLLEIDRQGRVRLSIKE------------------------------------------------
PNP_CUPTR       QQVRVKLIQADEKGRLRLSLK-------------------------------------------------
PNP_BIFAA       DTVEVVVQGVDDRGKISLAI--------------------------------------------------
PNP_ALKOO       DEIDVKVIEIDQQGKVSLSRKAL-----------------------------------------------
PNP_SYNAS       DEVIVKVLEVDKQGKIRLSRKE------------------------------------------------
PNP_SHESW       QEVAVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHESR       QEVTVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHESM       QEVTVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHESA       QEVTVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHEPC       QEVAVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHEON       QEVTVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHEB2       QEVAVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_SHEAM       QEVTVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_MANSM       XXXXXXXXXIDRQGRIRLTMRDL-----------------------------------------------
PNP_LEGPA       QEIEVFVAGIDKQGRVKLEWKD------------------------------------------------
PNP_GLOVI       DEVVVKVKEIDQKGRINLT---------------------------------------------------
PNP_FINM2       DEIMVKLMDIDDQGKMTLSRKAL-----------------------------------------------
PNP_CAUCR       QMVKVKLLGFDDRGKTKLSMK-------------------------------------------------
PNP_CAUCN       QMVKVKLLGFDDRGKTKLSMK-------------------------------------------------
PNP_BARBK       DKVWVQLMGFDERGKIRLSMK-------------------------------------------------
PNP_VIBPA       QEVQVKVLEIDRQGRVRLSM--------------------------------------------------
PNP_RHOCS       DAVKVKVLGFDDRGKVKLSMK-------------------------------------------------
PNP_PHEZH       QQVKVKLLGFDDRGKTRLSMK-------------------------------------------------
PNP_HAEDU       QEVNVKVVEIDRQNRIRLTMKDL-----------------------------------------------
PNP_GEOUR       DKVLVKCIGIDKQGKIKLSRKE------------------------------------------------
PNP_GEOSW       DEILVKVMEIDKQGRVNLSRK-------------------------------------------------
PNP_GEOSF       DKVLVKCIGIDKQGKIKLSRKE------------------------------------------------
PNP_DEIDV       DKLRVKIAGIDDRGKIDL----------------------------------------------------
PNP_CLOB8       DEILVKVTEIDNQGRINLSRKD------------------------------------------------
PNP_BUCBP       QEIFVKVLEVDRQGRLRLSIK-------------------------------------------------
PNP_BDEBA       EIIDVKVLEVDRSGRVKLSRKAL-----------------------------------------------
PNP_BARHE       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_ANOFW       DEILVKVTEIDKQGRVNLSRK-------------------------------------------------
PNP_AGRRK       DKVWVKLLGFDERGKVRLSMK-------------------------------------------------
PNP_VIBSL       QEVPVKVLEIDRQGRVRLSMK-------------------------------------------------
PNP_SINMW       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_RHISN       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_RHIME       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_RHILW       DKVWVKLLGFDERGKVRLSMK-------------------------------------------------
PNP_RHILO       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_RHIL3       DKVWVKLLGFDERGKVRLSMK-------------------------------------------------
PNP_RHIE6       DKVWVKLLGFDERGKVRLSMK-------------------------------------------------
PNP_RALEJ       QQLRVKLIQADEKGRLRLSLK-------------------------------------------------
PNP_GEOTN       DEILVKVTEIDKQGRVNLSRK-------------------------------------------------
PNP_GEOSM       DKVLVKCIGIDKQGKIKLSRKE------------------------------------------------
PNP_GEOBB       DKVLVKCIGIDKQGKIKLSRKE------------------------------------------------
PNP_ENTFA       DEVLVKVTEIDKQGRVNVSRKAL-----------------------------------------------
PNP_CHLMU       DRLAVKLLSINEKGQLKLSHK-------------------------------------------------
PNP_BACHK       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACCZ       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACCR       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACCQ       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACC7       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACC4       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACC3       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACC2       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACC1       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACAN       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACAH       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACAC       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACAA       DVITVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_AGRT5       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_STAS1       DIFKIKVTEIDKQGRVNASHKAL-----------------------------------------------
PNP_RUBXD       DVVKVRVLEIDKQNRISLEM--------------------------------------------------
PNP_MYXXD       DEVLVKVVSIDKTGKIRLSRKE------------------------------------------------
PNP_LEGPH       QEIEVFVAGIDKQGRVKLEWKD------------------------------------------------
PNP_LEGPC       QEIEVFVAGIDKQGRVKLEWKD------------------------------------------------
PNP4_ALKMQ      QEIEVKVMEIDQQGKINLSRKAL-----------------------------------------------
RS1_STAHJ       QQVNVKILGIDEENRISLSIK-------------------------------------------------
PNP_VESOH       DKIDVKVIGLD-RGRIKLSRKVL-----------------------------------------------
PNP_SPHAL       QDVKVKVLEIDPRGKVRLSMR-------------------------------------------------
PNP_SHEDO       QDVKVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_RHIEC       DKVWVKLLGFDERGKVRLSMK-------------------------------------------------
PNP_OCEIH       DQIMVKVKEIDRQGRVNLSRK-------------------------------------------------
PNP_MOOTA       DYILVKAIGFDPQGRLKLSRKE------------------------------------------------
PNP_SHEFN       QEVAVKVMEVDRQGRVRLSIKE------------------------------------------------
PNP_DESHY       DDILVKATGIDKQGRLNLSRKE------------------------------------------------
PNP_DESHD       DEILVKATGIDKQGRLNLSRKE------------------------------------------------
PNP_CLOBB       DEILVKVTEIDSQGRINLSRKDV-----------------------------------------------
PNP_CLOBA       DEILVKVTEIDSQGRINLSRKDV-----------------------------------------------
PNP_BUCAP       QIISVKVLEIDRQGRLRLSIKEV-----------------------------------------------
PNP_BACSK       DEVDVRVTEIDNQGRVNLS---------------------------------------------------
PNP_AGRVS       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_SYNWW       DQILVKVTEIDRQGRVNLSRK-------------------------------------------------
PNP_LEGPL       QEIEVFVAGIDKQGRVKLEWKD------------------------------------------------
PNP_GEOMG       DKVLVKCIGIDKQGKIKLSRKE------------------------------------------------
PNP_CHLPN       DIIDVKLLSINEKGQLKLSHK-------------------------------------------------
PNP_BURVG       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURS3       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURM1       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURCJ       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURCH       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURCC       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURCA       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BUCAT       QIISVKVLEIDRQGRLRLSIKE------------------------------------------------
PNP_BUCAI       QIISVKVLEIDRQGRLRLSIKE------------------------------------------------
PNP_BUCA5       QIISVKVLEIDRQGRLRLSIKE------------------------------------------------
PNP_BACHD       DEILVKVMEIDNQGRVNLSRK-------------------------------------------------
PNP_ZYMMO       QEVKVKVLEIDNRGKVRLSMR-------------------------------------------------
PNP_VIBFM       QEVKTKVLEIDRQGRIRLSIK-------------------------------------------------
PNP_VIBF1       QEVKTKVLEIDRQGRIRLSIK-------------------------------------------------
PNP_THET8       DVIKVKVHRIDERGKIDL----------------------------------------------------
PNP_THEPX       DDILVKVTDIDKLGRISLSRKD------------------------------------------------
PNP_THEP3       DDILVKVTDIDKLGRISLSRKD------------------------------------------------
PNP_SHEB9       QEVAVKVMEVDRQGRVRLSI--------------------------------------------------
PNP_SHEB8       QEVAVKVMEVDRQGRVRLSI--------------------------------------------------
PNP_SHEB5       QEVAVKVMEVDRQGRVRLSI--------------------------------------------------
PNP_RICBR       DIVKVKLIGFDNKGKAKLTIKN------------------------------------------------
PNP_RICB8       DIVKVKLIGFDNKGKAKLTIKN------------------------------------------------
PNP_PELCD       DQVLVKCLDIDRQGKIKLSRKE------------------------------------------------
PNP_MESSB       DKVFVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_HALOH       DRIPVKVIEIDELGRINLSRK-------------------------------------------------
PNP_CLOTE       DEILVKVTDIDDQGRINLSRRD------------------------------------------------
PNP_CHLTR       DKLAVKLLSINEKGQLKLSHK-------------------------------------------------
PNP_CHLTB       DKLAVKLLSINEKGQLKLSHK-------------------------------------------------
PNP_CHLTA       DKLAVKLLSINEKGQLKLSHK-------------------------------------------------
PNP_CHLT2       DKLAVKLLSINEKGQLKLSHK-------------------------------------------------
PNP_BURPS       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURP6       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURP1       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURP0       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURMS       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURMA       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURM9       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BURM7       QQVKVKVIQTDEKGRV------------------------------------------------------
PNP_BACWK       DEISVKVIEIDKQGRVNLSRKVL-----------------------------------------------
PNP_BACSU       DEILVKVTEIDKQGRVNLSRK-------------------------------------------------
PNP_BACLD       DELLVKVTEIDKQGRVNLSRK-------------------------------------------------
PNP_BACA2       DEILVKVTEIDKQGRVNLSRK-------------------------------------------------
RS1_STAAW       QQVNVKILGIDEENRVSLSIK-------------------------------------------------
RS1_STAAS       QQVNVKILGIDEENRVSLSIK-------------------------------------------------
RS1_STAAR       QQVNVKILGIDEENRVSLSIK-------------------------------------------------
RS1_STAAN       QQVNVKILGIDEENRVSLSIK-------------------------------------------------
RS1_STAAM       QQVNVKILGIDEENRVSLSIK-------------------------------------------------
RS1_STAAC       QQVNVKILGIDEENRVSLSIK-------------------------------------------------
PNP_THETH       DVIKVKVHRIDERGKIDL----------------------------------------------------
PNP_THET2       DVIKVKVHRIDERGKIDL----------------------------------------------------
PNP_SPHWW       QEVKVKVLEIDNRGKVRLSMR-------------------------------------------------
PNP_RICM5       DIVKVKLIGFDNKGKAKLTIKN------------------------------------------------
PNP_RICFE       DIVKVKLIGFDNKGKAKLTIKN------------------------------------------------
PNP_RICAH       DIVKVKLIGFDNKGKAKLTIKN------------------------------------------------
PNP_GEOKA       DEILVKVTEIDKQGRVNLSRK-------------------------------------------------
PNP_DEHSC       DDITVKVIEIDNQGRVNLS---------------------------------------------------
PNP_DEHSB       DDITVKVIEIDNQGRVNLS---------------------------------------------------
PNP_CLOPE       DEILVKVTEIDSQGRINLSRKD------------------------------------------------
PNP_CLOP1       DEILVKVTEIDSQGRINLSRKD------------------------------------------------
PNP_CHLFF       DILPVKLLSINEKGQYKLSHK-------------------------------------------------
PNP_CHLCV       DILAVKLLSINEKGQYKLSHK-------------------------------------------------
PNP_BORPE       QPVRVKVIEADDKGRLRLSIK-------------------------------------------------
PNP_BORPA       QPVRVKVIEADDKGRLRLSIK-------------------------------------------------
PNP_BORBR       QPVRVKVIEADDKGRLRLSIK-------------------------------------------------
PNP_BORA1       QQVRVKVIEADEKGRLRLSVK-------------------------------------------------
PNP_BIFA0       DSVEVVVQGVDDRGKISLAI--------------------------------------------------
PNP_BARQU       DKVWVKLMGFDERGKVRLSMK-------------------------------------------------
PNP_STAHJ       DSIDVKITEIDKQGRVNASHKAL-----------------------------------------------
PNP_STAES       DTIEVKITEIDKQGRVNASHKVL-----------------------------------------------
PNP_STAEQ       DTIEVKITEIDKQGRVNASHKVL-----------------------------------------------
PNP_EXISA       DSIQVKVTEIDDKGRVNASRKAL-----------------------------------------------
PNP_BORPD       QQVRVKVIEADDK