[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81760.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
   88::188     5e-12  33%  228 aa  CG030_MOUSE RecName: Full=Uncharacterized protein C7orf30 homolog;
   94::194     2e-11  32%  234 aa  CG030_HUMAN RecName: Full=Uncharacterized protein C7orf30;
    5::105     6e-11  28%  105 aa  YBEB_SHIFL RecName: Full=Uncharacterized protein ybeB;
    5::105     6e-11  28%  105 aa  YBEB_ECOLI RecName: Full=Uncharacterized protein ybeB;
    5::105     6e-11  28%  105 aa  YBEB_ECOL6 RecName: Full=Uncharacterized protein ybeB;
    1::102     7e-10  30%  102 aa  Y034_HAEIN RecName: Full=Uncharacterized protein HI0034;
  112::216     1e-08  25%  228 aa  IOJAP_MAIZE RecName: Full=Protein Iojap;
   16::107     9e-07  26%  118 aa  YQEL_BACSU RecName: Full=Uncharacterized protein yqeL;
  131::173     2e-05  42%  190 aa  YM62_CAEEL RecName: Full=Uncharacterized protein K12H4.2;
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxEAVALIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQAXXXXXXXXXXXXXXRP
CG030_MOUSE     ----------IDMLVSLLRQENARDICVIQVPPEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKHLKCRS
CG030_HUMAN     ----------IDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKR
YBEB_SHIFL      --------ALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRAAGLLP
YBEB_ECOLI      --------ALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRAAGLLP
YBEB_ECOL6      --------ALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRAAGLLP
Y034_HAEIN      -------MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAGFET
IOJAP_MAIZE     -----ECLSFAVSLAKAASEIKATDIRVLCVRRLVYWTRFFIILTAFSNAQIDAISSKMRDIGEKQFSKV
YQEL_BACSU      -------------------DKRAEDILALDMEGISLVADYFLICHGNSDKQVQAIAREIKDQADENGIQV
YM62_CAEEL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAERL
CG030_MOUSE     DPEGKDADDWLCVDFGSMVIHLMLPETRETYELEKLW------
CG030_HUMAN     DPEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLW------
YBEB_SHIFL      LGVEGESADWIVVDLGDVIVHVMQEESRRLYELEKLWS-----
YBEB_ECOLI      LGVEGESADWIVVDLGDVIVHVMQEESRRLYELEKLWS-----
YBEB_ECOL6      LGVEGESADWIVVDLGDVIVHVMQEESRRLYELEKLWS-----
Y034_HAEIN      FGEEGKNTAWIVVDLGQAIVHIMQRDAREMYQLEKLWA-----
IOJAP_MAIZE     ASGDTKPNSWTLLDFGDVVVHIFLPQQRAFYNLEEFYGNA---
YQEL_BACSU      KKMEGDEARWXXXXXXXXXXXXFHKDERSYYNLEKLWGDA---
YM62_CAEEL      RRSTKRSNGWYVSEVERVQVHVMSEECREKYDLEAIWAGDDRI