[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81794.1

[Show Plain Result]


## Summary of Sequence Search
    1::125
   17::126     7e-11  33%  135 aa  Y254_BUCBP RecName: Full=Uncharacterized acyl-CoA thioester
   20::124     3e-10  35%  172 aa  YKHA_BACSU RecName: Full=Uncharacterized acyl-CoA thioester
   17::132     4e-10  34%  132 aa  YCIA_SHIFL RecName: Full=Acyl-CoA thioester hydrolase yciA;        
   17::129     4e-10  32%  133 aa  YCIA_SALTY RecName: Full=Acyl-CoA thioester hydrolase yciA;        
   17::129     4e-10  32%  133 aa  YCIA_SALTI RecName: Full=Acyl-CoA thioester hydrolase yciA;        
   17::132     4e-10  34%  132 aa  YCIA_ECOLI RecName: Full=Acyl-CoA thioester hydrolase yciA;        
   17::132     4e-10  34%  132 aa  YCIA_ECOL6 RecName: Full=Acyl-CoA thioester hydrolase yciA;        
   19::127     1e-09  32%  155 aa  Y654_CHLPN RecName: Full=Uncharacterized acyl-CoA thioester
   17::126     2e-09  28%  135 aa  Y274_BUCAI RecName: Full=Uncharacterized acyl-CoA thioester
   38::126     2e-09  33%  135 aa  Y263_BUCAP RecName: Full=Uncharacterized acyl-CoA thioester
  255::345     2e-09  32%  381 aa  BACH_RAT RecName: Full=Cytosolic acyl coenzyme A thioester
  255::345     2e-09  32%  381 aa  BACH_MOUSE RecName: Full=Cytosolic acyl coenzyme A thioester
   69::134     1e-08  39%  149 aa  Y511_ZYMMO RecName: Full=Uncharacterized acyl-CoA thioester
   24::132     3e-08  31%  159 aa  Y822_CHLMU RecName: Full=Uncharacterized acyl-CoA thioester
  254::344     9e-08  30%  380 aa  BACH_HUMAN RecName: Full=Cytosolic acyl coenzyme A thioester
   29::137     3e-07  29%  174 aa  VDLD_HELPY RecName: Full=Protein vdlD;
   29::137     3e-07  29%  174 aa  VDLD_HELPJ RecName: Full=Protein vdlD;
   22::129     4e-07  35%  154 aa  Y827_HAEIN RecName: Full=Uncharacterized acyl-CoA thioester
   46::132     5e-06  28%  607 aa  ACO11_HUMAN RecName: Full=Acyl-coenzyme A thioesterase 11;       
   48::134     8e-06  28%  594 aa  ACO11_MOUSE RecName: Full=Acyl-coenzyme A thioesterase 11;       
  103::143     3e-04  34%  169 aa  YLZ6_CAEEL RecName: Full=Putative esterase F42H10.6;       
  184::294     3e-04  28%  555 aa  ACO12_HUMAN RecName: Full=Acyl-coenzyme A thioesterase 12;       
  185::297     4e-04  28%  556 aa  ACO12_RAT RecName: Full=Acyl-coenzyme A thioesterase 12;       
  185::295     4e-04  28%  556 aa  ACO12_MOUSE RecName: Full=Acyl-coenzyme A thioesterase 12;       
    1::125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
Y254_BUCBP      -------LAMPADTNANGDIFGGWIMSQMDIGGAILAKEIARGRVVTVSVNGMTFLKSVSVGDVVSCYAH
YKHA_BACSU      --------VFPLDTNNHNTLFGGKLMSYIDDIASISAARHCRRETVTASMDSVDFLKPIGQKDSVCLESY
YCIA_SHIFL      -------LAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYAR
YCIA_SALTY      -------LAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYAR
YCIA_SALTI      -------LAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYAR
YCIA_ECOLI      -------LAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYAR
YCIA_ECOL6      -------LAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYAR
Y654_CHLPN      --------IFPNDLNANNTVFGGLLMSLLDRLALVVAERHTESVCVTAFVDALRFYAPAYMGENLICKAA
Y274_BUCAI      -------LSMPENINANGDIFGGWIMSQMDLGGAILAKEISGGKVATVRVDSINFLKSVSVGDIVNCYAN
Y263_BUCAP      ----------------------------MDMGGAILAKEIAGGRVVTVQVNGITFFKPVSVGDIVSCYAH
BACH_RAT        ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
BACH_MOUSE      ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
Y511_ZYMMO      ---------------------------------------------------SITFHAPVQVGDELSLYAR
Y822_CHLMU      --------IFPNDLNTNNTIFGGLLMSLLDRLALVVAERHCESICVTALVDAVRFYAPAYMGENLICCAS
BACH_HUMAN      ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
VDLD_HELPY      -------LVVPTTANFNNVMHGGELLNLLDKVAYVCSTRYCAKGTVTLSVDGVTFKYPIPVGNLLTFLAS
VDLD_HELPJ      -------LVVPTTANFNNVMHGGELLNLLDKVAYVCSTRYCAKGTVTLSVDGVTFKYPIPVGNLLTFLAS
Y827_HAEIN      -------LAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
ACO11_HUMAN     -EVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAK
ACO11_MOUSE     -EVQMSQLVLPCHTNHRGELSIGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFDHTISVGQVVNIKAK
YLZ6_CAEEL      ---------------------------------------------------AVSYLLPVKVGDVLEITAH
ACO12_HUMAN     ---QSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAI
ACO12_RAT       ---QSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCHGHPFLKSVDMFKFRGPSTVGDRLVFNAI
ACO12_MOUSE     ---QSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCHGHPFLKSVDMFKFRGPSTVGDRLVFSAI


                         .         .         *         .         .         .         .:140
query           VVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVExxxxxx
Y254_BUCBP      CIRTGNTSITIKIEVWKKVSSEPLGKYCTTEAIFVYVAVDEFGQP----------
YKHA_BACSU      VTWVGTSSMEVFVKVIKEHLMTGE-RELAATSFLTFVALDSNGK-----------
YCIA_SHIFL      CVQKGTTSVSINIEVWVKKVASEGQRYKATEALFKYVAVDPEGKPLPVE------
YCIA_SALTY      CVKRGTTSISINIEVWVKKVASEGQRYKATEALFIYVAVDPDGKPRPL-------
YCIA_SALTI      CVKRGTTSISINIEVWVKKVASEGQRYKATEALFIYVAVDPDGKPRPL-------
YCIA_ECOLI      CVQKGTTSVSINIEVWVKKVASEGQRYKATEALFKYVAVDPEGKPLPVE------
YCIA_ECOL6      CVQKGTTSVSINIEVWVKKVASEGQRYKATEALFKYVAVDPEGKPLPVE------
Y654_CHLPN      VNRTWRTSLEVGVKVWAENIYKQERRHI-TSAYFTFVAVNEDNQPIPV-------
Y274_BUCAI      CIKIGKSSIKINVEIWKKIYSKPLGQYCAAEAIFIYVAINKTGQP----------
Y263_BUCAP      CIKTGNSSITINLEVWKKIYSKPLGQYCAAEAIFIYVAIDETGKP----------
BACH_RAT        MTFTSNKSMEIEVLVDADPVVDNSKRYRAASAFFTYVSLNQEGKPLPV-------
BACH_MOUSE      MTFTSNKSMEIEVLVDADPVVDNSKRYRAASAFFTYVSLNQEGKPMPV-------
Y511_ZYMMO      LVKVGRTSMKIEVEGWR-RVRHELETIKAISGLFTFVAIDEDRRPCQV-------
Y822_CHLMU      VNRSWRTSLEVGVKVWAENIYKQEQRHI-TSAYFTFVAVDENNSPVEI-------
BACH_HUMAN      MTFTSNKSMEIEVLVDADPVVDSSKRYRAASAFFTYVSLSQEGRSLPV-------
VDLD_HELPY      INYVGNTSCEVGIKVLSEDI--KTREITHTNSCYFTMVAVENGKPTPM-------
VDLD_HELPJ      INYVGNTSCEVGIKVLSEDI--KTREITHTNSCYFTMVAVENGKPTPM-------
Y827_HAEIN      CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
ACO11_HUMAN     VNRAFNSSMEVGIQVASE-------------------------------------
ACO11_MOUSE     VNRAFNSSMEVGIQVVSE-------------------------------------
YLZ6_CAEEL      VLKVGRTMAFTDCEFRRKSDGK---------------------------------
ACO12_HUMAN     VNNTFQTCVEVGVRVEAQEWAEGRGRHI-NSAFLIYNAADDK-------------
ACO12_RAT       VNNTFQNSVEVGVRVEAREWAEGQGRHI-NSAFLIYNAVDDQEE-----------
ACO12_MOUSE     VNNTFQNSVEVGVRVEAQEWAEGQGRHI-NSAFLIYNAVDDQ-------------