[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81826.1

[Show Plain Result]


## Summary of Sequence Search
    1::443
   24::438     4e-82  42%  442 aa  CDR_PYRFU RecName: Full=Coenzyme A disulfide reductase;       
   28::442     1e-80  43%  446 aa  CDR_PYRAB RecName: Full=Coenzyme A disulfide reductase;       
   24::438     3e-79  42%  442 aa  CDR_PYRKO RecName: Full=Coenzyme A disulfide reductase;       
   27::441     4e-75  41%  445 aa  CDR_PYRHO RecName: Full=Coenzyme A disulfide reductase;       
   23::441     4e-68  35%  448 aa  NAOX_METJA RecName: Full=Putative NADH oxidase;       
   29::455     2e-49  29%  456 aa  NAOX_STRP6 RecName: Full=Probable NADH oxidase;       
   22::438     3e-49  30%  438 aa  CDR_STAES RecName: Full=Coenzyme A disulfide reductase;       
   22::438     3e-49  30%  438 aa  CDR_STAEQ RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAAN RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAAM RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAA9 RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAA2 RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAA1 RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAAW RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-48  30%  438 aa  CDR_STAAS RecName: Full=Coenzyme A disulfide reductase;       
   22::438     4e-48  31%  438 aa  CDR_STAAB RecName: Full=Coenzyme A disulfide reductase;       
   22::438     2e-47  29%  438 aa  CDR_STAAR RecName: Full=Coenzyme A disulfide reductase;       
   23::442     1e-46  28%  447 aa  NAPE_ENTFA RecName: Full=NADH peroxidase;         Short=NPXase;    
   22::438     3e-45  29%  438 aa  CDR_STAAC RecName: Full=Coenzyme A disulfide reductase;       
   24::446     5e-45  28%  446 aa  NAOX_LACLM RecName: Full=NADH oxidase;         Short=NOXase;       
   22::438     5e-45  29%  438 aa  CDR_STAA8 RecName: Full=Coenzyme A disulfide reductase;       
   22::438     9e-45  28%  440 aa  CDR_STAHJ RecName: Full=Coenzyme A disulfide reductase;       
   22::438     9e-45  29%  438 aa  CDR_STAAT RecName: Full=Coenzyme A disulfide reductase;       
   22::438     9e-45  29%  438 aa  CDR_STAAE RecName: Full=Coenzyme A disulfide reductase;       
   22::438     9e-45  29%  438 aa  CDR_STAA3 RecName: Full=Coenzyme A disulfide reductase;       
   23::442     3e-43  27%  446 aa  NAOX_ENTFA RecName: Full=NADH oxidase;         Short=NOXase;       
   22::438     1e-41  28%  440 aa  CDR_STAS1 RecName: Full=Coenzyme A disulfide reductase;       
   23::468     7e-36  29%  479 aa  NAOX_MYCPN RecName: Full=Probable NADH oxidase;       
   23::418     2e-32  28%  478 aa  NAOX_MYCGE RecName: Full=Probable NADH oxidase;       
   53::277     1e-26  35%  427 aa  THCD_RHOER RecName: Full=Rhodocoxin reductase;         EC=1.18.1.-;
  217::451     1e-25  36%  547 aa  MERA_STAES RecName: Full=Mercuric reductase;       
  217::451     1e-25  36%  547 aa  MERA_STAAU RecName: Full=Mercuric reductase;       
   76::277     8e-25  40%  410 aa  TODA_PSEP1 RecName: Full=Toluene 1,2-dioxygenase system
  233::522     2e-24  32%  561 aa  MERA_ENTAG RecName: Full=Mercuric reductase;       
   50::277     2e-24  35%  410 aa  BEDA_PSEPU RecName: Full=Benzene 1,2-dioxygenase system
   60::322     3e-24  34%  422 aa  CAMA_PSEPU RecName: Full=Putidaredoxin reductase;       
  247::518     3e-24  32%  605 aa  AIFM3_MOUSE RecName: Full=Apoptosis-inducing factor 3;       
  203::508     4e-24  32%  547 aa  MERA_THIFE RecName: Full=Mercuric reductase;       
  232::525     4e-24  33%  564 aa  MERA_SHIFL RecName: Full=Mercuric reductase;       
  212::509     5e-24  32%  548 aa  MERA_PSEFL RecName: Full=Mercuric reductase;       
  230::518     2e-23  31%  557 aa  MERA_SHEPU RecName: Full=Mercuric reductase;       
  301::579     9e-23  31%  631 aa  MERA_BACCE RecName: Full=Mercuric reductase;       
  137::423     1e-22  30%  465 aa  DLDH_CHLMU RecName: Full=Dihydrolipoyl dehydrogenase;       
  233::522     2e-22  31%  561 aa  MERA_PSEAE RecName: Full=Mercuric reductase;       
  160::397     2e-22  37%  489 aa  GSHRP_SPIOL RecName: Full=Glutathione reductase, chloroplastic;    
  123::277     3e-22  43%  408 aa  BPHG_BURXL RecName: Full=Biphenyl dioxygenase system
   76::252     4e-22  40%  409 aa  TODA_PSEPU RecName: Full=Toluene 1,2-dioxygenase system
   76::252     4e-22  40%  409 aa  BNZD_PSEPU RecName: Full=Benzene 1,2-dioxygenase system
  142::420     5e-22  32%  475 aa  DLDH_HALVO RecName: Full=Dihydrolipoyl dehydrogenase;       
   41::288     8e-22  33%  377 aa  NORW_ECO5E RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     8e-22  33%  377 aa  NORW_ECO57 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-21  33%  377 aa  NORW_ECOLI RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-21  33%  377 aa  NORW_ECOLC RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-21  33%  377 aa  NORW_ECODH RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-21  33%  377 aa  NORW_ECOBW RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   29::332     2e-21  30%  805 aa  NASD_BACSU RecName: Full=Nitrite reductase [NAD(P)H];       
  133::421     2e-21  36%  461 aa  DLDH_THESC RecName: Full=Dihydrolipoyl dehydrogenase;       
   41::288     3e-21  33%  377 aa  NORW_SHIB3 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     5e-21  33%  377 aa  NORW_SHIBS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     5e-21  33%  377 aa  NORW_ECOSE RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  170::338     5e-21  39%  499 aa  GSHRC_ARATH RecName: Full=Glutathione reductase, cytosolic;        
  137::364     5e-21  38%  459 aa  DLDH1_PSEPU RecName: Full=Dihydrolipoyl dehydrogenase;       
   41::288     7e-21  33%  377 aa  NORW_ECOL5 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     7e-21  33%  377 aa  NORW_ECOHS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     7e-21  33%  377 aa  NORW_ECO8A RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     7e-21  33%  377 aa  NORW_ECO55 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  173::341     7e-21  37%  502 aa  GSHRC_BRARP RecName: Full=Glutathione reductase, cytosolic;        
  135::443     7e-21  30%  461 aa  DLDH_CHLPN RecName: Full=Dihydrolipoyl dehydrogenase;       
   24::307     9e-21  32%  393 aa  RURE_ACIAD RecName: Full=Rubredoxin-NAD(+) reductase;       
   41::288     9e-21  33%  377 aa  NORW_ECO27 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     1e-20  33%  377 aa  NORW_ECOUT RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     1e-20  33%  377 aa  NORW_ECOSM RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     1e-20  33%  377 aa  NORW_ECOK1 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     1e-20  33%  377 aa  NORW_ECO45 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     1e-20  33%  377 aa  NORW_ECO24 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     1e-20  33%  377 aa  NORW_SHISS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-20  33%  377 aa  NORW_ESCF3 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     3e-20  33%  377 aa  NORW_SHIDS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     3e-20  33%  377 aa  NORW_ECOL6 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     3e-20  33%  377 aa  NORW_SHIFL RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     3e-20  33%  377 aa  NORW_SHIF8 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   23::276     3e-20  31%  377 aa  NORW_KLEP7 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     3e-20  32%  377 aa  NORW_ECOLU RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   23::300     6e-20  29%  381 aa  NORW_VIBFM RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     6e-20  35%  377 aa  NORW_SALA4 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   23::288     6e-20  31%  377 aa  NORW_KLEP3 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  169::338     6e-20  36%  498 aa  GSHRC_PEA RecName: Full=Glutathione reductase, cytosolic;       
   41::288     7e-20  33%  377 aa  NORW_SALTY RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  142::369     7e-20  34%  464 aa  DLDH1_PSEAE RecName: Full=Dihydrolipoyl dehydrogenase;       
  133::427     1e-19  34%  474 aa  MERA_STRLI RecName: Full=Mercuric reductase;       
  141::324     1e-19  34%  477 aa  DLDH3_HALMA RecName: Full=Dihydrolipoyl dehydrogenase 3;       
   41::288     1e-19  32%  377 aa  NORW_CITK8 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-19  33%  377 aa  NORW_SALHS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-19  33%  377 aa  NORW_SALEP RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   96::288     2e-19  37%  379 aa  NORW_ERWCT RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  167::336     2e-19  36%  496 aa  GSHRC_ORYSJ RecName: Full=Glutathione reductase, cytosolic;        
  126::318     2e-19  33%  470 aa  DLDH1_BACSU RecName: Full=Dihydrolipoyl dehydrogenase;       
   41::288     2e-19  33%  377 aa  NORW_SALSV RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   77::328     2e-19  32%  488 aa  MDAR2_ARATH RecName: Full=Probable monodehydroascorbate reductase,
  144::426     3e-19  33%  469 aa  DLDH_CHLTE RecName: Full=Dihydrolipoyl dehydrogenase;       
  209::482     4e-19  29%  575 aa  YDGE_SCHPO RecName: Full=Putative flavoprotein C26F1.14C;
   41::288     5e-19  33%  377 aa  NORW_SALTI RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  137::348     1e-18  35%  463 aa  STHA_MARAV RecName: Full=Soluble pyridine nucleotide
  233::522     1e-18  30%  561 aa  MERA_ACICA RecName: Full=Mercuric reductase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAW RecName: Full=Dihydrolipoyl dehydrogenase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAU RecName: Full=Dihydrolipoyl dehydrogenase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAS RecName: Full=Dihydrolipoyl dehydrogenase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAR RecName: Full=Dihydrolipoyl dehydrogenase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAN RecName: Full=Dihydrolipoyl dehydrogenase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAM RecName: Full=Dihydrolipoyl dehydrogenase;       
  126::418     1e-18  29%  468 aa  DLDH_STAAC RecName: Full=Dihydrolipoyl dehydrogenase;       
  135::303     1e-18  38%  449 aa  GSHR_BURCE RecName: Full=Glutathione reductase;       
  126::417     1e-18  31%  454 aa  DLDH_RHOCA RecName: Full=Dihydrolipoyl dehydrogenase;       
   41::288     2e-18  33%  377 aa  NORW_SALG2 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  117::370     2e-18  36%  464 aa  DLDH_MYCTU RecName: Full=Dihydrolipoyl dehydrogenase;       
  117::370     2e-18  36%  464 aa  DLDH_MYCBO RecName: Full=Dihydrolipoyl dehydrogenase;       
  139::349     2e-18  32%  464 aa  STHA_PSEAE RecName: Full=Soluble pyridine nucleotide
  139::349     2e-18  32%  464 aa  STHA_PSEAB RecName: Full=Soluble pyridine nucleotide
  139::349     2e-18  32%  464 aa  STHA_PSEA8 RecName: Full=Soluble pyridine nucleotide
  137::423     2e-18  30%  465 aa  DLDH_CHLTR RecName: Full=Dihydrolipoyl dehydrogenase;       
  139::349     3e-18  31%  464 aa  STHA_PSEA7 RecName: Full=Soluble pyridine nucleotide
  133::303     3e-18  37%  450 aa  GSHR_ECOLI RecName: Full=Glutathione reductase;       
  125::320     3e-18  34%  472 aa  DLDH2_HALMA RecName: Full=Dihydrolipoyl dehydrogenase 2;       
  128::312     5e-18  33%  456 aa  GSHR_HAEIN RecName: Full=Glutathione reductase;       
  144::426     5e-18  36%  469 aa  DLDH_CHLP8 RecName: Full=Dihydrolipoyl dehydrogenase;       
   41::288     7e-18  31%  377 aa  NORW_SALAR RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  231::520     7e-18  30%  559 aa  MERA_ALCSP RecName: Full=Mercuric reductase;       
   74::298     7e-18  31%  433 aa  MDAR_PEA RecName: Full=Monodehydroascorbate reductase;       
   31::280     1e-17  25%  771 aa  NASB_BACSU RecName: Full=Assimilatory nitrate reductase electron
  135::320     1e-17  35%  478 aa  DLDH2_PSEPU RecName: Full=Dihydrolipoamide dehydrogenase;       
  122::311     2e-17  34%  468 aa  STHA_MYCTU RecName: Full=Probable soluble pyridine nucleotide
  122::311     2e-17  34%  468 aa  STHA_MYCTA RecName: Full=Soluble pyridine nucleotide
  122::311     2e-17  34%  468 aa  STHA_MYCBT RecName: Full=Soluble pyridine nucleotide
  122::311     2e-17  34%  468 aa  STHA_MYCBP RecName: Full=Soluble pyridine nucleotide
  122::311     2e-17  34%  468 aa  STHA_MYCBO RecName: Full=Probable soluble pyridine nucleotide
   23::307     2e-17  28%  382 aa  NORW_VIBVU RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  160::332     2e-17  33%  480 aa  GSHR_ASHGO RecName: Full=Glutathione reductase;       
  136::347     2e-17  32%  478 aa  DLDH2_PSEAE RecName: Full=Dihydrolipoamide dehydrogenase;       
  140::349     3e-17  31%  464 aa  STHA_PSEFS RecName: Full=Soluble pyridine nucleotide
  160::349     3e-17  35%  501 aa  DLDH_PEA RecName: Full=Dihydrolipoyl dehydrogenase, mitochondrial; 
  140::349     4e-17  30%  464 aa  STHA_PSEPK RecName: Full=Soluble pyridine nucleotide
  140::349     4e-17  30%  464 aa  STHA_PSEPG RecName: Full=Soluble pyridine nucleotide
  140::349     4e-17  30%  464 aa  STHA_PSEP1 RecName: Full=Soluble pyridine nucleotide
  169::391     4e-17  31%  557 aa  GSHRP_TOBAC RecName: Full=Glutathione reductase, chloroplastic;    
  136::347     4e-17  32%  478 aa  DLDH_PSEFL RecName: Full=Dihydrolipoyl dehydrogenase;       
  140::349     6e-17  30%  464 aa  STHA_PSEPW RecName: Full=Soluble pyridine nucleotide
  113::419     6e-17  30%  474 aa  DLDH_HALSA RecName: Full=Dihydrolipoyl dehydrogenase;       
  140::349     8e-17  30%  464 aa  STHA_PSEFL RecName: Full=Soluble pyridine nucleotide
  140::349     8e-17  30%  464 aa  STHA_PSEE4 RecName: Full=Soluble pyridine nucleotide
   23::307     8e-17  28%  382 aa  NORW_VIBVY RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     8e-17  31%  377 aa  NORW_ECO81 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  177::399     8e-17  31%  565 aa  GSHRP_ARATH RecName: Full=Glutathione reductase, chloroplastic;    
  134::309     8e-17  28%  336 aa  DLDH_ACHLA RecName: Full=Dihydrolipoyl dehydrogenase;       
  104::338     1e-16  30%  470 aa  DLDH1_BACST RecName: Full=Dihydrolipoyl dehydrogenase;       
  140::349     2e-16  30%  464 aa  STHA_PSEPF RecName: Full=Soluble pyridine nucleotide
   75::299     2e-16  30%  434 aa  MDARS_CUCSA RecName: Full=Monodehydroascorbate reductase, seedling
  139::349     2e-16  31%  464 aa  STHA_PSEU5 RecName: Full=Soluble pyridine nucleotide
  205::375     2e-16  32%  544 aa  GSHRP_SOYBN RecName: Full=Glutathione reductase, chloroplastic;    
  123::348     3e-16  32%  463 aa  STHA_CHRSD RecName: Full=Soluble pyridine nucleotide
  142::349     3e-16  32%  464 aa  STHA_AZOVI RecName: Full=Soluble pyridine nucleotide
  142::349     3e-16  32%  464 aa  STHA_AZOVD RecName: Full=Soluble pyridine nucleotide
   41::288     3e-16  34%  377 aa  NORW_ENT38 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     3e-16  31%  377 aa  NORW_ECO7I RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  140::349     4e-16  30%  464 aa  STHA_PSEF5 RecName: Full=Soluble pyridine nucleotide
  139::349     5e-16  30%  464 aa  STHA_PSESM RecName: Full=Soluble pyridine nucleotide
  139::349     5e-16  30%  464 aa  STHA_PSE14 RecName: Full=Soluble pyridine nucleotide
  132::438     5e-16  31%  459 aa  GSHR_ANASP RecName: Full=Glutathione reductase;       
  139::349     6e-16  30%  464 aa  STHA_PSEU2 RecName: Full=Soluble pyridine nucleotide
   30::281     6e-16  25%  957 aa  NIRB_KLEOX RecName: Full=Nitrite reductase [NAD(P)H] large subunit;
  115::366     6e-16  33%  451 aa  GSHR_PSEAE RecName: Full=Glutathione reductase;       
  195::376     8e-16  39%  522 aa  GSHR_HUMAN RecName: Full=Glutathione reductase, mitochondrial;     
  145::347     8e-16  32%  477 aa  DLDH_AZOVI RecName: Full=Dihydrolipoyl dehydrogenase;       
  141::311     1e-15  32%  464 aa  STHA_PSEMY RecName: Full=Soluble pyridine nucleotide
  141::349     1e-15  33%  464 aa  STHA_HAHCH RecName: Full=Soluble pyridine nucleotide
   68::277     1e-15  30%  400 aa  HCAD_ECOLU RecName: Full=3-phenylpropionate/cinnamic acid
  173::354     1e-15  38%  500 aa  GSHR_MOUSE RecName: Full=Glutathione reductase, mitochondrial;     
  195::376     1e-15  37%  522 aa  GSHR_CALJA RecName: Full=Glutathione reductase, mitochondrial;     
  154::330     1e-15  34%  492 aa  TYTR_TRYBB RecName: Full=Trypanothione reductase;         Short=TR;
   41::288     1e-15  31%  377 aa  NORW_SALPB RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  106::421     1e-15  26%  473 aa  DLDH_BUCAI RecName: Full=Dihydrolipoyl dehydrogenase;       
  129::315     1e-15  39%  467 aa  DLDH3_PSEAE RecName: Full=Dihydrolipoyl dehydrogenase 3;       
   79::299     2e-15  28%  434 aa  MDAR3_ARATH RecName: Full=Probable monodehydroascorbate reductase,
   41::288     2e-15  33%  377 aa  NORW_SALPK RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     2e-15  33%  377 aa  NORW_SALPA RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   23::300     3e-15  27%  381 aa  NORW_VIBF1 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  139::311     4e-15  31%  465 aa  STHA_PROMH RecName: Full=Soluble pyridine nucleotide
   41::288     4e-15  31%  377 aa  NORW_SALNS RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     4e-15  31%  377 aa  NORW_SALDC RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   80::301     4e-15  30%  441 aa  MDAR1_ARATH RecName: Full=Probable monodehydroascorbate reductase,
   69::334     5e-15  26%  847 aa  NIRB_ECOLI RecName: Full=Nitrite reductase [NAD(P)H] large subunit;
  134::304     5e-15  34%  450 aa  GSHR_STRTR RecName: Full=Glutathione reductase;       
  145::323     5e-15  30%  465 aa  GSHR_DICDI RecName: Full=Glutathione reductase;       
   41::288     7e-15  31%  377 aa  NORW_SALPC RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   41::288     7e-15  31%  377 aa  NORW_SALCH RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  129::312     9e-15  31%  466 aa  STHA_YERE8 RecName: Full=Soluble pyridine nucleotide
  140::312     9e-15  34%  466 aa  STHA_VIBVY RecName: Full=Soluble pyridine nucleotide
  140::312     9e-15  34%  466 aa  STHA_VIBVU RecName: Full=Soluble pyridine nucleotide
  138::414     9e-15  32%  474 aa  DLDH_SHIFL RecName: Full=Dihydrolipoyl dehydrogenase;       
  138::414     9e-15  32%  474 aa  DLDH_ECOLI RecName: Full=Dihydrolipoyl dehydrogenase;       
  138::414     9e-15  32%  474 aa  DLDH_ECOL6 RecName: Full=Dihydrolipoyl dehydrogenase;       
  138::414     9e-15  32%  474 aa  DLDH_ECO57 RecName: Full=Dihydrolipoyl dehydrogenase;       
  247::518     9e-15  27%  605 aa  AIFM3_HUMAN RecName: Full=Apoptosis-inducing factor 3;       
  137::337     1e-14  31%  465 aa  STHA_SERP5 RecName: Full=Soluble pyridine nucleotide
  110::308     1e-14  33%  388 aa  NORW_AERS4 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
   68::277     1e-14  30%  400 aa  HCAD_ECO5E RecName: Full=3-phenylpropionate/cinnamic acid
   68::277     1e-14  30%  400 aa  HCAD_ECO57 RecName: Full=3-phenylpropionate/cinnamic acid
  143::428     1e-14  30%  474 aa  DLDH_SYNY3 RecName: Full=Dihydrolipoyl dehydrogenase;       
   68::277     2e-14  30%  400 aa  HCAD_ECOSM RecName: Full=3-phenylpropionate/cinnamic acid
  129::312     2e-14  31%  466 aa  STHA_YERPY RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPS RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPP RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPN RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPG RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPE RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPB RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERPA RecName: Full=Soluble pyridine nucleotide
  129::312     2e-14  31%  466 aa  STHA_YERP3 RecName: Full=Soluble pyridine nucleotide
  143::315     4e-14  33%  469 aa  STHA_PHOPR RecName: Full=Soluble pyridine nucleotide
   79::299     4e-14  29%  433 aa  MDAR_SOLLC RecName: Full=Monodehydroascorbate reductase;       
   93::278     4e-14  38%  424 aa  GSHR_RAT RecName: Full=Glutathione reductase;         Short=GRase; 
  140::312     5e-14  32%  466 aa  STHA_VIBSL RecName: Full=Soluble pyridine nucleotide
  101::277     5e-14  31%  400 aa  HCAD_ECOLI RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     5e-14  31%  400 aa  HCAD_ECOLC RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     5e-14  31%  400 aa  HCAD_ECOHS RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     5e-14  31%  400 aa  HCAD_ECODH RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     5e-14  31%  400 aa  HCAD_ECOBW RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     5e-14  31%  400 aa  HCAD_ECO7I RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     5e-14  33%  400 aa  HCAD_ECO24 RecName: Full=3-phenylpropionate/cinnamic acid
  163::382     5e-14  28%  552 aa  GSHRP_PEA RecName: Full=Glutathione reductase,
  145::356     6e-14  31%  471 aa  STHA_VIBF1 RecName: Full=Soluble pyridine nucleotide
  101::277     6e-14  31%  400 aa  HCAD_ECOSE RecName: Full=3-phenylpropionate/cinnamic acid
  101::277     6e-14  31%  400 aa  HCAD_ECO55 RecName: Full=3-phenylpropionate/cinnamic acid
  138::313     8e-14  31%  467 aa  DLDH_MYCLE RecName: Full=Dihydrolipoyl dehydrogenase;       
  102::279     1e-13  32%  409 aa  TERPA_PSESP RecName: Full=Terpredoxin reductase;       
  134::353     1e-13  27%  493 aa  MDARP_ARATH RecName: Full=Monodehydroascorbate reductase,
  166::355     1e-13  33%  507 aa  DLDH2_ARATH RecName: Full=Dihydrolipoyl dehydrogenase 2,
  154::384     1e-13  33%  492 aa  TYTR_TRYCO RecName: Full=Trypanothione reductase;         Short=TR;
  139::311     1e-13  29%  465 aa  STHA_PHOLL RecName: Full=Soluble pyridine nucleotide
   80::414     1e-13  30%  466 aa  DLDH_ZYMMO RecName: Full=Dihydrolipoyl dehydrogenase;       
  179::470     1e-13  30%  507 aa  DLDH1_ARATH RecName: Full=Dihydrolipoyl dehydrogenase 1,
    1::127     2e-13  38%  277 aa  DLDH_RHIET RecName: Full=Probable dihydrolipoyl dehydrogenase;     
  140::312     3e-13  31%  466 aa  STHA_VIBPA RecName: Full=Soluble pyridine nucleotide
  101::277     3e-13  31%  400 aa  HCAD_SHISS RecName: Full=3-phenylpropionate/cinnamic acid
  144::318     3e-13  35%  468 aa  GSHR_NEUCR RecName: Full=Glutathione reductase;       
  140::314     4e-13  36%  466 aa  DLDH3_PSEPU RecName: Full=Dihydrolipoyl dehydrogenase 3;       
  169::403     5e-13  34%  511 aa  TRXR2_BOVIN RecName: Full=Thioredoxin reductase 2, mitochondrial;  
  140::314     5e-13  30%  468 aa  STHA_HAMD5 RecName: Full=Soluble pyridine nucleotide
  143::314     5e-13  29%  468 aa  STHA_ERWCT RecName: Full=Soluble pyridine nucleotide
  105::312     5e-13  28%  466 aa  STHA_COLP3 RecName: Full=Soluble pyridine nucleotide
  168::418     7e-13  32%  526 aa  TRXR2_RAT RecName: Full=Thioredoxin reductase 2, mitochondrial;    
  100::277     9e-13  31%  394 aa  HCAD_PHOLL RecName: Full=3-phenylpropionate/cinnamic acid
  154::336     1e-12  38%  491 aa  TYTR_CRIFA RecName: Full=Trypanothione reductase;         Short=TR;
  148::322     1e-12  31%  474 aa  DLDH_RALEH RecName: Full=Dihydrolipoyl dehydrogenase;       
  182::416     2e-12  31%  524 aa  TRXR2_MOUSE RecName: Full=Thioredoxin reductase 2, mitochondrial;  
  182::376     3e-12  32%  524 aa  TRXR2_HUMAN RecName: Full=Thioredoxin reductase 2, mitochondrial;  
  140::312     3e-12  30%  466 aa  STHA_VIBCM RecName: Full=Soluble pyridine nucleotide
  140::312     3e-12  30%  466 aa  STHA_VIBCH RecName: Full=Soluble pyridine nucleotide
  140::312     3e-12  30%  466 aa  STHA_VIBC3 RecName: Full=Soluble pyridine nucleotide
  120::312     4e-12  29%  466 aa  STHA_KLEP7 RecName: Full=Soluble pyridine nucleotide
  120::312     4e-12  29%  466 aa  STHA_KLEP3 RecName: Full=Soluble pyridine nucleotide
  110::287     4e-12  31%  388 aa  NORW_AERHH RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  167::356     4e-12  33%  509 aa  DLDH_MOUSE RecName: Full=Dihydrolipoyl dehydrogenase,
  187::428     4e-12  25%  532 aa  AIFM1_DICDI RecName: Full=Apoptosis-inducing factor 1,
  138::354     6e-12  28%  523 aa  XECC_XANP2 RecName: Full=2-oxopropyl-CoM reductase, carboxylating; 
  150::322     6e-12  30%  470 aa  GSHR_YARLI RecName: Full=Glutathione reductase;       
  125::417     6e-12  24%  457 aa  DLDH_MYCPN RecName: Full=Dihydrolipoyl dehydrogenase;       
  155::336     7e-12  32%  492 aa  TYTR_TRYCR RecName: Full=Trypanothione reductase;         Short=TR;
  139::337     7e-12  30%  465 aa  STHA_SODGM RecName: Full=Soluble pyridine nucleotide
  120::312     7e-12  28%  466 aa  STHA_ERWT9 RecName: Full=Soluble pyridine nucleotide
  184::333     7e-12  39%  458 aa  DLDH3_BACSU RecName: Full=Dihydrolipoyl dehydrogenase;       
  120::312     1e-11  29%  466 aa  STHA_SALPC RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALCH RecName: Full=Soluble pyridine nucleotide
  120::349     1e-11  28%  464 aa  STHA_MARMS RecName: Full=Soluble pyridine nucleotide
  100::288     1e-11  29%  379 aa  NORW_SERP5 RecName: Full=Nitric oxide reductase FlRd-NAD(+)
  167::356     1e-11  33%  509 aa  DLDH_PIG RecName: Full=Dihydrolipoyl dehydrogenase, mitochondrial; 
  178::356     1e-11  34%  509 aa  DLDH_CRIGR RecName: Full=Dihydrolipoyl dehydrogenase,
  120::312     1e-11  29%  466 aa  STHA_SALTY RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALTI RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALPK RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALPB RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALPA RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALG2 RecName: Full=Soluble pyridine nucleotide
  120::312     1e-11  29%  466 aa  STHA_SALEP RecName: Full=Soluble pyridine nucleotide
  120::312     2e-11  32%  466 aa  STHA_ENT38 RecName: Full=Soluble pyridine nucleotide
  167::356     2e-11  32%  509 aa  DLDH_HUMAN RecName: Full=Dihydrolipoyl dehydrogenase,
  167::356     2e-11  32%  509 aa  DLDH_CANFA RecName: Full=Dihydrolipoyl dehydrogenase,
  120::312     3e-11  29%  466 aa  STHA_CITK8 RecName: Full=Soluble pyridine nucleotide
   55::284     3e-11  26%  385 aa  RURE_PSEOL RecName: Full=Rubredoxin-NAD(+) reductase;       
  167::356     3e-11  32%  509 aa  DLDH_RAT RecName: Full=Dihydrolipoyl dehydrogenase, mitochondrial; 
  178::356     4e-11  32%  509 aa  DLDH_MACFA RecName: Full=Dihydrolipoyl dehydrogenase,
  182::282     5e-11  37%  301 aa  TRXB_METJA RecName: Full=Putative thioredoxin reductase;       
  138::430     5e-11  25%  476 aa  DLDH_BUCAP RecName: Full=Dihydrolipoyl dehydrogenase;       
   98::334     6e-11  29%  484 aa  GSHR_KLULA RecName: Full=Glutathione reductase;       
  167::356     6e-11  30%  509 aa  DLDH_PONAB RecName: Full=Dihydrolipoyl dehydrogenase,
  124::414     6e-11  28%  478 aa  DLDH_HAEIN RecName: Full=Dihydrolipoyl dehydrogenase;       
  275::488     6e-11  35%  521 aa  AHPF_PSEAE RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  140::312     8e-11  29%  466 aa  STHA_SHIB3 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ESCF3 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOUT RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOSM RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOSE RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOLU RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOLI RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOL6 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOL5 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOK1 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECODH RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECOBW RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO8A RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO7I RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO5E RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO57 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO55 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO45 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO27 RecName: Full=Soluble pyridine nucleotide
  140::312     8e-11  29%  466 aa  STHA_ECO24 RecName: Full=Soluble pyridine nucleotide
  140::312     1e-10  29%  466 aa  STHA_ECOLC RecName: Full=Soluble pyridine nucleotide
  140::312     1e-10  29%  466 aa  STHA_ECOHS RecName: Full=Soluble pyridine nucleotide
   87::289     1e-10  33%  319 aa  TRXB_LISMO RecName: Full=Thioredoxin reductase;         Short=TRXR;
  140::312     1e-10  29%  466 aa  STHA_ECO81 RecName: Full=Soluble pyridine nucleotide
  233::327     2e-10  37%  460 aa  MERA_SERMA RecName: Full=Mercuric reductase;       
  144::316     2e-10  31%  464 aa  GSHR_SCHPO RecName: Full=Glutathione reductase;       
  133::407     2e-10  23%  457 aa  DLDH_MYCGE RecName: Full=Dihydrolipoyl dehydrogenase;       
  146::332     2e-10  29% 1104 aa  NIR_EMENI RecName: Full=Nitrite reductase [NAD(P)H];       
  317::487     2e-10  33%  530 aa  AHPF_XANCH RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  128::414     3e-10  28%  475 aa  DLDH_VIBCH RecName: Full=Dihydrolipoyl dehydrogenase;       
  140::312     4e-10  29%  466 aa  STHA_SHIFL RecName: Full=Soluble pyridine nucleotide
   80::300     4e-10  26%  435 aa  MDAR4_ARATH RecName: Full=Probable monodehydroascorbate reductase,
  102::288     4e-10  32%  373 aa  AIFM2_HUMAN RecName: Full=Apoptosis-inducing factor 2;       
  171::293     5e-10  30%  441 aa  YKGC_ECOLI RecName: Full=Probable pyridine nucleotide-disulfide
  210::470     5e-10  28%  612 aa  AIFM1_RAT RecName: Full=Apoptosis-inducing factor 1, mitochondrial;
  155::329     7e-10  33%  476 aa  GSHR_CANGA RecName: Full=Glutathione reductase;       
  155::422     9e-10  32%  499 aa  TRXR1_PONAB RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
  162::335     1e-09  29%  483 aa  GSHR_YEAST RecName: Full=Glutathione reductase;       
  144::312     1e-09  26%  500 aa  GSHR_PLAFK RecName: Full=Glutathione reductase;       
  154::335     2e-09  33%  491 aa  TYTR_LEIDO RecName: Full=Trypanothione reductase;         Short=TR;
   63::283     2e-09  29%  315 aa  TRXB_CLOLI RecName: Full=Thioredoxin reductase;         Short=TRXR;
  144::312     2e-09  27%  500 aa  GSHR_PLAF7 RecName: Full=Glutathione reductase;       
  145::396     2e-09  27%  503 aa  GSHR_CAEEL RecName: Full=Probable glutathione reductase 2;       
  102::289     2e-09  31%  373 aa  AIFM2_MOUSE RecName: Full=Apoptosis-inducing factor 2;       
  210::470     2e-09  28%  612 aa  AIFM1_MOUSE RecName: Full=Apoptosis-inducing factor 1,
  316::487     2e-09  37%  520 aa  AHPF_PSEPU RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  316::487     2e-09  37%  520 aa  AHPF_PSEPK RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  305::572     2e-09  31%  649 aa  TRXR1_HUMAN RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
  101::287     2e-09  30%  410 aa  HCAD_SHIF8 RecName: Full=3-phenylpropionate/cinnamic acid
  130::414     2e-09  26%  475 aa  DLDH_VIBPA RecName: Full=Dihydrolipoyl dehydrogenase;       
  458::602     2e-09  34%  639 aa  BAICD_EUBSP RecName: Full=Bile acid-inducible operon protein
  155::422     3e-09  31%  499 aa  TRXR1_PIG RecName: Full=Thioredoxin reductase 1, cytoplasmic;      
  269::451     3e-09  33%  613 aa  TRXR1_MOUSE RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
   87::289     3e-09  32%  319 aa  TRXB_LISIN RecName: Full=Thioredoxin reductase;         Short=TRXR;
  147::418     6e-09  30%  474 aa  DLDH2_BACSU RecName: Full=Dihydrolipoyl dehydrogenase;       
  155::422     8e-09  32%  499 aa  TRXR1_BOVIN RecName: Full=Thioredoxin reductase 1, cytoplasmic;    
  211::471     1e-08  28%  613 aa  AIFM1_HUMAN RecName: Full=Apoptosis-inducing factor 1,
  349::597     1e-08  29%  739 aa  AIFM1_DROME RecName: Full=Putative apoptosis-inducing factor 1,
  155::337     1e-08  31%  498 aa  TRXR1_RAT RecName: Full=Thioredoxin reductase 1, cytoplasmic;      
  165::344     1e-08  29%  497 aa  DLDH_MANSE RecName: Full=Dihydrolipoyl dehydrogenase;       
  260::432     2e-08  31%  596 aa  TRXR1_DROME RecName: Full=Thioredoxin reductase 1, mitochondrial;  
  107::285     2e-08  33%  307 aa  TRXB_TREPA RecName: Full=Thioredoxin reductase;         Short=TRXR;
   63::283     2e-08  28%  315 aa  TRXB_EUBAC RecName: Full=Thioredoxin reductase;         Short=TRXR;
  130::396     2e-08  30%  519 aa  DHNA_ARATH RecName: Full=Probable NADH dehydrogenase,
  109::287     2e-08  31%  308 aa  R34K_CLOPA RecName: Full=34.2 kDa protein in rubredoxin operon;    
  163::357     3e-08  26%  511 aa  DLDH_SCHPO RecName: Full=Dihydrolipoyl dehydrogenase,
  150::427     4e-08  27%  479 aa  DLDH_TRYBB RecName: Full=Dihydrolipoyl dehydrogenase;       
  113::295     5e-08  32%  319 aa  TRXB_CANGA RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  150::432     5e-08  29%  477 aa  DLDH_TRYCR RecName: Full=Dihydrolipoyl dehydrogenase;       
  187::361     1e-07  27%  541 aa  TRXR_PLAF7 RecName: Full=Thioredoxin reductase;         Short=TrxR;
  187::361     1e-07  27%  541 aa  TRXR_PLAF5 RecName: Full=Thioredoxin reductase;         Short=TrxR;
  413::592     1e-07  35%  754 aa  TRXR3_HUMAN RecName: Full=Thioredoxin reductase 3;       
  184::327     1e-07  33%  444 aa  DHNA_HAEIN RecName: Full=NADH dehydrogenase;         EC=1.6.99.3;
   88::277     2e-07  29%  355 aa  YUTJ_BACSU RecName: Full=NADH dehydrogenase-like protein yutJ;     
  113::295     2e-07  31%  319 aa  TRXB_ASHGO RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  356::535     2e-07  35%  697 aa  TRXR3_MOUSE RecName: Full=Thioredoxin reductase 3;       
  148::277     4e-07  35%  321 aa  FENR_FRAAA RecName: Full=Ferredoxin--NADP reductase;       
  143::325     5e-07  31%  349 aa  TRXB_KLULA RecName: Full=Thioredoxin reductase, mitochondrial;     
  165::283     5e-07  34%  305 aa  FENR_IGNH4 RecName: Full=Ferredoxin--NADP reductase;       
  316::503     7e-07  30%  667 aa  TRXR1_CAEEL RecName: Full=Thioredoxin reductase 1;       
   84::290     7e-07  27%  312 aa  TRXB_CHLMU RecName: Full=Thioredoxin reductase;         Short=TRXR;
  303::370     9e-07  36%  500 aa  PYRD1_PONAB RecName: Full=Pyridine nucleotide-disulfide
   84::290     1e-06  25%  311 aa  TRXB_CHLPN RecName: Full=Thioredoxin reductase;         Short=TRXR;
   97::299     1e-06  27%  378 aa  AIF1_YEAST RecName: Full=Apoptosis-inducing factor 1;       
  318::488     1e-06  30%  521 aa  AHPF_ECOLI RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  303::370     2e-06  34%  500 aa  PYRD1_HUMAN RecName: Full=Pyridine nucleotide-disulfide
  169::445     2e-06  28%  472 aa  GLTD_ECOLI RecName: Full=Glutamate synthase [NADPH] small chain;   
  177::409     2e-06  27%  516 aa  TRXR2_DROME RecName: Full=Thioredoxin reductase 2, mitochondrial;  
   84::290     3e-06  29%  312 aa  TRXB_CHLTR RecName: Full=Thioredoxin reductase;         Short=TRXR;
  298::357     3e-06  40%  498 aa  PYRD1_MOUSE RecName: Full=Pyridine nucleotide-disulfide
  305::361     3e-06  38%  502 aa  PYRD1_BOVIN RecName: Full=Pyridine nucleotide-disulfide
  129::292     3e-06  33%  503 aa  OOXA_AGRT4 RecName: Full=Opine oxidase subunit A;       
  162::289     3e-06  32%  330 aa  FENR_NOCSJ RecName: Full=Ferredoxin--NADP reductase;       
  301::357     4e-06  38%  498 aa  PYRD1_RAT RecName: Full=Pyridine nucleotide-disulfide
  308::480     4e-06  30%  507 aa  AHPF_STAAR RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  136::318     5e-06  30%  342 aa  TRXB2_YEAST RecName: Full=Thioredoxin reductase 2, mitochondrial;  
  127::321     5e-06  31%  526 aa  OOXA2_RHIME RecName: Full=Opine oxidase subunit A;       
  134::284     5e-06  31%  332 aa  FENR_SULSO RecName: Full=Ferredoxin--NADP reductase;       
  308::480     5e-06  30%  507 aa  AHPF_STAAW RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  308::480     5e-06  30%  507 aa  AHPF_STAAN RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  308::480     5e-06  30%  507 aa  AHPF_STAAM RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  108::281     6e-06  25%  316 aa  TRXB_BACSU RecName: Full=Thioredoxin reductase;         Short=TRXR;
  190::431     6e-06  26%  475 aa  DLDH_BUCBP RecName: Full=Dihydrolipoyl dehydrogenase;       
  308::480     6e-06  30%  507 aa  AHPF_STAAC RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  308::480     6e-06  30%  507 aa  AHPF_STAA8 RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  150::286     8e-06  31%  322 aa  TRXB_STRCO RecName: Full=Thioredoxin reductase;         Short=TRXR;
  188::304     8e-06  31%  307 aa  TRXB_MYCPU RecName: Full=Thioredoxin reductase;         Short=TRXR;
  219::268     8e-06  42%  309 aa  FENR_LACAC RecName: Full=Ferredoxin--NADP reductase;       
   56::342     1e-05  27%  406 aa  YUMB_BACSU RecName: Full=NADH dehydrogenase-like protein yumB;     
  233::288     1e-05  39%  346 aa  FENR1_BACP2 RecName: Full=Ferredoxin--NADP reductase 1;       
  635::826     1e-05  28% 1032 aa  YGFK_ECO57 RecName: Full=Uncharacterized protein ygfK;
  217::288     1e-05  40%  310 aa  TRXB_RICBR RecName: Full=Thioredoxin reductase;         Short=TRXR;
  113::295     1e-05  29%  319 aa  TRXB1_YEAST RecName: Full=Thioredoxin reductase 1;       
   12::166     1e-05  35%  458 aa  TRMFO_DESDG RecName:
  226::379     1e-05  38%  413 aa  GLTD_RHOSH RecName: Full=Putative glutamate synthase [NADPH] small
 2071::2136    1e-05  39% 2194 aa  GLSN_MEDSA RecName: Full=Glutamate synthase [NADH], amyloplastic;    
  130::279     1e-05  31%  327 aa  FENR_SULTO RecName: Full=Ferredoxin--NADP reductase;       
  248::301     1e-05  41%  348 aa  FENR_PROA2 RecName: Full=Ferredoxin--NADP reductase;       
  210::276     1e-05  37%  310 aa  FENR_LACH4 RecName: Full=Ferredoxin--NADP reductase;       
  308::480     1e-05  30%  507 aa  AHPF_STAAS RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  318::488     1e-05  29%  521 aa  AHPF_SALTY RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  107::280     2e-05  26%  311 aa  TRXB_STAAW RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::280     2e-05  26%  311 aa  TRXB_STAAS RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::280     2e-05  26%  311 aa  TRXB_STAAN RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::280     2e-05  26%  311 aa  TRXB_STAAM RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::280     2e-05  26%  311 aa  TRXB_STAAC RecName: Full=Thioredoxin reductase;         Short=TRXR;
  116::301     2e-05  31%  334 aa  TRXB_PENCH RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  291::444     2e-05  34%  482 aa  GLTD_AZOBR RecName: Full=Glutamate synthase [NADPH] small chain;   
  148::277     2e-05  31%  321 aa  FENR_FRASC RecName: Full=Ferredoxin--NADP reductase;       
  349::480     2e-05  33%  507 aa  AHPF_STAES RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  349::480     2e-05  33%  507 aa  AHPF_STAEQ RecName: Full=Alkyl hydroperoxide reductase subunit F;  
  107::280     3e-05  26%  311 aa  TRXB_STAAR RecName: Full=Thioredoxin reductase;         Short=TRXR;
    4::91      3e-05  32%  436 aa  TRMFO_EXISA RecName:
  155::333     3e-05  27%  499 aa  IRC15_YEAST RecName: Full=Increased recombination centers protein
  130::280     3e-05  31%  328 aa  FENR1_SULAC RecName: Full=Ferredoxin--NADP reductase 1;       
  635::826     4e-05  28% 1032 aa  YGFK_ECOLI RecName: Full=Uncharacterized protein ygfK;
  212::288     5e-05  39%  310 aa  TRXB_RICPR RecName: Full=Thioredoxin reductase;         Short=TRXR;
   97::282     5e-05  30%  311 aa  TRXB_HELPY RecName: Full=Thioredoxin reductase;         Short=TRXR;
  165::304     5e-05  25%  326 aa  TRXB_BORBU RecName: Full=Thioredoxin reductase;         Short=TRXR;
  156::289     5e-05  30%  336 aa  FENR1_BACA2 RecName: Full=Ferredoxin--NADP reductase 1;       
  107::280     7e-05  25%  310 aa  TRXB_STAES RecName: Full=Thioredoxin reductase;         Short=TRXR;
  107::280     7e-05  25%  310 aa  TRXB_STAEQ RecName: Full=Thioredoxin reductase;         Short=TRXR;
   97::282     7e-05  30%  311 aa  TRXB_HELPJ RecName: Full=Thioredoxin reductase;         Short=TRXR;
  135::284     7e-05  31%  332 aa  FENR_METS5 RecName: Full=Ferredoxin--NADP reductase;       
  304::425     7e-05  33%  729 aa  FADB_ECOLU RecName: Full=Fatty acid oxidation complex subunit
  304::425     7e-05  33%  729 aa  FADB_ECO7I RecName: Full=Fatty acid oxidation complex subunit
   24::86      9e-05  40%  516 aa  OXLA_AGKRH RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
 1756::1851    9e-05  42% 2111 aa  GLT1_SCHPO RecName: Full=Putative glutamate synthase [NADPH];        
   63::300     9e-05  33%  360 aa  FENR_CHLTE RecName: Full=Ferredoxin--NADP reductase;       
  471::524     9e-05  41%  661 aa  BAIH_EUBSP RecName: Full=NADH-dependent flavin oxidoreductase;     
  541::622     1e-04  26% 1155 aa  RAX2_SCHPO RecName: Full=Polarized growth protein rax2;AltName:
  101::285     1e-04  26%  330 aa  FENR_LACF3 RecName: Full=Ferredoxin--NADP reductase;       
  164::300     1e-04  26%  353 aa  FENR_CHLCH RecName: Full=Ferredoxin--NADP reductase;       
  310::486     1e-04  31%  519 aa  DHNA_BACYN RecName: Full=NADH dehydrogenase;       
  111::294     1e-04  27%  334 aa  TRXB_NEUCR RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  125::290     1e-04  34%  337 aa  FENR_MAGSA RecName: Full=Ferredoxin--NADP reductase;       
  164::300     1e-04  27%  350 aa  FENR_CHLL2 RecName: Full=Ferredoxin--NADP reductase;       
  304::425     1e-04  32%  729 aa  FADB_ECO5E RecName: Full=Fatty acid oxidation complex subunit
  304::425     1e-04  32%  729 aa  FADB_ECO57 RecName: Full=Fatty acid oxidation complex subunit
  310::483     1e-04  32%  509 aa  DHNA_BACSU RecName: Full=NADH dehydrogenase;       
  232::297     2e-04  32%  315 aa  TRXB_MYCGE RecName: Full=Thioredoxin reductase;         Short=TRXR;
   60::296     2e-04  27%  319 aa  TRXB_DICDI RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
  107::294     2e-04  27%  320 aa  TRXB_COXBU RecName: Full=Thioredoxin reductase;         Short=TRXR;
    8::91      2e-04  36%  434 aa  TRMFO_BACCN RecName:
    4::108     2e-04  33%  600 aa  KMO_USTMA RecName: Full=Kynurenine 3-monooxygenase;       
  152::291     2e-04  27%  336 aa  FENR_SYMTH RecName: Full=Ferredoxin--NADP reductase;       
  162::300     2e-04  27%  353 aa  FENR_PROVI RecName: Full=Ferredoxin--NADP reductase;       
   62::300     2e-04  26%  350 aa  FENR_CHLPD RecName: Full=Ferredoxin--NADP reductase;       
  107::290     2e-04  29%  342 aa  FENR_BRASB RecName: Full=Ferredoxin--NADP reductase;       
  160::295     2e-04  27%  341 aa  FENR2_CHLT3 RecName: Full=Ferredoxin--NADP reductase 2;       
    2::36      2e-04  49%  416 aa  DADA2_PSEAE RecName: Full=D-amino acid dehydrogenase 2 small
    8::91      3e-04  33%  435 aa  TRMFO_BACSU RecName:
  386::518     3e-04  30%  678 aa  STCD_RHIME RecName: Full=Probable N-methylproline demethylase;     
  112::173     3e-04  39%  428 aa  FIXC_SHIFL RecName: Full=Protein fixC;
  114::278     3e-04  29%  325 aa  FENR_ACIC1 RecName: Full=Ferredoxin--NADP reductase;       
  135::284     3e-04  28%  332 aa  FENR2_SULAC RecName: Full=Ferredoxin--NADP reductase 2;       
   74::302     3e-04  28%  333 aa  TRXB1_ARATH RecName: Full=Thioredoxin reductase 1;       
   86::281     3e-04  29%  322 aa  FENR_SALAI RecName: Full=Ferredoxin--NADP reductase;       
  132::289     3e-04  28%  336 aa  FENR1_BACSU RecName: Full=Ferredoxin--NADP reductase 1;       
    2::89      4e-04  32%  434 aa  TRMFO_EXIS2 RecName:
    7::90      4e-04  32%  434 aa  TRMFO_BACP2 RecName:
  241::280     4e-04  51%  648 aa  MNMC_BURS3 RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  112::173     4e-04  38%  428 aa  FIXC_ECOLI RecName: Full=Protein fixC;
  112::173     4e-04  38%  428 aa  FIXC_ECOL6 RecName: Full=Protein fixC;
  112::173     4e-04  38%  428 aa  FIXC_ECO57 RecName: Full=Protein fixC;
  212::309     4e-04  27%  366 aa  FENR_METPP RecName: Full=Ferredoxin--NADP reductase;       
  155::286     4e-04  28%  332 aa  FENR2_BACP2 RecName: Full=Ferredoxin--NADP reductase 2;       
  266::425     4e-04  31%  729 aa  FADB_YERE8 RecName: Full=Fatty acid oxidation complex subunit
  151::286     6e-04  30%  322 aa  TRXB_STRCL RecName: Full=Thioredoxin reductase;         Short=TRXR;
  111::289     6e-04  28%  325 aa  TRXB_PNECA RecName: Full=Thioredoxin reductase;         EC=1.8.1.9;
   87::287     6e-04  27%  311 aa  TRXB_MYCSM RecName: Full=Thioredoxin reductase;         Short=TRXR;
    7::90      6e-04  30%  435 aa  TRMFO_STAAW RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAT RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAS RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAR RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAN RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAM RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAE RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAC RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAAB RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAA9 RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAA8 RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAA3 RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAA2 RecName:
    7::90      6e-04  30%  435 aa  TRMFO_STAA1 RecName:
    8::91      6e-04  33%  437 aa  TRMFO_LYSSC RecName:
  168::353     6e-04  31%  490 aa  GSHR_DEBHA RecName: Full=Glutathione reductase;       
  147::288     6e-04  29%  335 aa  FENR_THET8 RecName: Full=Ferredoxin--NADP reductase;       
  147::288     6e-04  29%  335 aa  FENR_THET2 RecName: Full=Ferredoxin--NADP reductase;       
  247::297     6e-04  39%  350 aa  FENR_PELLD RecName: Full=Ferredoxin--NADP reductase;       
  221::266     6e-04  41%  308 aa  FENR_LACDB RecName: Full=Ferredoxin--NADP reductase;       
  221::266     6e-04  41%  308 aa  FENR_LACDA RecName: Full=Ferredoxin--NADP reductase;       
  198::288     6e-04  32%  351 aa  FENR_FLAPJ RecName: Full=Ferredoxin--NADP reductase;       
  247::300     6e-04  35%  356 aa  FENR_CHLP8 RecName: Full=Ferredoxin--NADP reductase;       
  247::300     6e-04  37%  347 aa  FENR1_CHLT3 RecName: Full=Ferredoxin--NADP reductase 1;       
  304::425     6e-04  32%  729 aa  FADB_SHISS RecName: Full=Fatty acid oxidation complex subunit
  304::425     6e-04  32%  729 aa  FADB_SHIFL RecName: Full=Fatty acid oxidation complex subunit
  304::425     6e-04  32%  729 aa  FADB_SHIF8 RecName: Full=Fatty acid oxidation complex subunit
  304::425     6e-04  32%  729 aa  FADB_ECOLI RecName: Full=Fatty acid oxidation complex subunit
  304::425     6e-04  32%  729 aa  FADB_ECODH RecName: Full=Fatty acid oxidation complex subunit
  304::425     6e-04  32%  729 aa  FADB_ECOBW RecName: Full=Fatty acid oxidation complex subunit
  220::288     7e-04  37%  310 aa  TRXB_RICTY RecName: Full=Thioredoxin reductase;         Short=TRXR;
  220::288     7e-04  34%  310 aa  TRXB_RICCN RecName: Full=Thioredoxin reductase;         Short=TRXR;
  124::352     7e-04  28%  383 aa  TRXB2_ARATH RecName: Full=Thioredoxin reductase 2;       
    3::90      7e-04  28%  435 aa  TRMFO_STAES RecName:
    3::90      7e-04  28%  435 aa  TRMFO_STAEQ RecName:
    7::90      7e-04  32%  434 aa  TRMFO_LISIN RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACWK RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACHK RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACCZ RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACCR RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACCQ RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACC7 RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACC4 RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACC3 RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACC2 RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACC1 RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACC0 RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACAN RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACAH RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACAC RecName:
    8::91      7e-04  35%  434 aa  TRMFO_BACAA RecName:
   38::85      7e-04  42%  516 aa  OXLA_CROAT RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   38::85      7e-04  42%  516 aa  OXLA_CROAD RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  261::315     7e-04  35%  665 aa  MNMC_PSEU2 RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  261::315     7e-04  35%  660 aa  MNMC_PSE14 RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  205::395     7e-04  31%  530 aa  LNT_RHILO RecName: Full=Apolipoprotein N-acyltransferase;       
  194::287     7e-04  31%  333 aa  FENR_NEOSM RecName: Full=Ferredoxin--NADP reductase;       
  105::300     7e-04  30%  348 aa  FENR_CHLPB RecName: Full=Ferredoxin--NADP reductase;       
  155::286     7e-04  26%  332 aa  FENR2_BACLD RecName: Full=Ferredoxin--NADP reductase 2;       
  304::366     7e-04  32%  729 aa  FADB_SERP5 RecName: Full=Fatty acid oxidation complex subunit
  165::266     0.001  34%  402 aa  Y1834_STAS1 RecName: Full=NADH dehydrogenase-like protein SSP1834; 
  249::295     0.001  34%  315 aa  TRXB_MYCPN RecName: Full=Thioredoxin reductase;         Short=TRXR;
    7::90      0.001  32%  434 aa  TRMFO_LISMF RecName:
  198::369     0.001  38%  393 aa  PURT_DESVM RecName: Full=Phosphoribosylglycinamide
   39::86      0.001  40%  517 aa  OXLA_PSEAU RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   33::222     0.001  26%  497 aa  OXLA_BOTJR RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
   45::85      0.001  46%  504 aa  OXLA_AGKHA RecName: Full=L-amino-acid oxidase;         Short=LAAO; 
  253::311     0.001  34%  654 aa  MNMC_PSEE4 RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  265::294     0.001  57%  623 aa  MNMC_ACIBC RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
    1::443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRK
CDR_PYRFU       ----------------------RLRPEWDVKVFEATEWVSHAPCGIPYVVEGIAPK-EKLMHYPPEVFKK
CDR_PYRAB       ----------------------RLKPEWDVKVFEATEWVSHAPCGIPYVVEGISPT-EKLMHYPPEVFKK
CDR_PYRKO       ----------------------RLKPEWDVKVFEATEWVSHAPCGIPYVVEGISPK-EKLMHYPPEVFKK
CDR_PYRHO       ----------------------RLKPEWDVKVFEATEWVSHAPCGIPYVVEG-LSTPDKLMYYPPEVFKK
NAOX_METJA      ------------------------NKDMEIVVITKEKEIAYSPCAIPYVIEGAIKSFDDIIMHTPEDYRE
NAOX_STRP6      ----------------------------EIVVFDQNSNISFLGCGMALWIGEQIAGPEGLFYSDKEELES
CDR_STAES       ----------------------RLDKESEIIVFEKDRDMSFANCALPYYIGNVIEDRRKVLAYTPNQFYK
CDR_STAEQ       ----------------------RLDKESEIIVFEKDRDMSFANCALPYYIGNVIEDRRKVLAYTPNQFYK
CDR_STAAN       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
CDR_STAAM       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
CDR_STAA9       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALVYTPEKFRK
CDR_STAA2       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALVYTPEKFRK
CDR_STAA1       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
CDR_STAAW       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
CDR_STAAS       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
CDR_STAAB       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
CDR_STAAR       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFRK
NAPE_ENTFA      ------------------------HPDAEIQWYEKGDFISFLSCGMQLYLEGKVKDVNSVRYMTGEKMES
CDR_STAAC       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEEFRK
NAOX_LACLM      -------------------------PGHEIVMIDRNSNMSYLGCGTAIWVGRQIEKPDELFYAKAEDFEA
CDR_STAA8       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEKFRK
CDR_STAHJ       ----------------------RLDKDSEITIFEKDRDMSFANCGLPYFIGNIVNERKDVLPITPDVFKK
CDR_STAAT       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEKFRK
CDR_STAAE       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEKFRK
CDR_STAA3       ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEKFRK
NAOX_ENTFA      ------------------------HPEAEVTVYERNDNISFLSCGIALYVGGVVKNAADLFYSNPEELAS
CDR_STAS1       ----------------------RLDQESEIVVFEKDRDMSFANCALPYYLGNVVDSRNKVLEATPESFYE
NAOX_MYCPN      -----------------------KSKDFQVNAYDRNTNISFLGCGIALAVSGVVKNTEDLFYSTPEELKA
NAOX_MYCGE      -----------------------KSKDFKVNAYDRNTNISFLGCGIALAVSGVVKNTDDLFYSNPEELKQ
THCD_RHOER      ------------------------------------------------------PDRESLALRPAQYFDD
MERA_STAES      ----------------------------------------------------------------------
MERA_STAAU      ----------------------------------------------------------------------
TODA_PSEP1      ----------------------------------------------------------------------
MERA_ENTAG      ----------------------------------------------------------------------
BEDA_PSEPU      ------------------------------------------------VLDGSFEQPPRLAEA--DWYSE
CAMA_PSEPU      ---------------------------------------------------------ESLYLRTPDAYAA
AIFM3_MOUSE     ---------------------------------------------------------EQLALRPKEFFRA
MERA_THIFE      ----------------------------------------------------------------------
MERA_SHIFL      ----------------------------------------------------------------------
MERA_PSEFL      ----------------------------------------------------------------------
MERA_SHEPU      ----------------------------------------------------------------------
MERA_BACCE      ----------------------------------------------------------------------
DLDH_CHLMU      ----------------------------------------------------------------------
MERA_PSEAE      ----------------------------------------------------------------------
GSHRP_SPIOL     ----------------------------------------------------------------------
BPHG_BURXL      ----------------------------------------------------------------------
TODA_PSEPU      ----------------------------------------------------------------------
BNZD_PSEPU      ----------------------------------------------------------------------
DLDH_HALVO      ----------------------------------------------------------------------
NORW_ECO5E      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECO57      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOLI      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOLC      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECODH      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOBW      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NASD_BACSU      --------------------------EFQITIFGAEPHPNYNRILLSKVLQGDTD-IKDITLNDWDWYEE
DLDH_THESC      ----------------------------------------------------------------------
NORW_SHIB3      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_SHIBS      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOSE      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
GSHRC_ARATH     ----------------------------------------------------------------------
DLDH1_PSEPU     ----------------------------------------------------------------------
NORW_ECOL5      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOHS      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECO8A      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECO55      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
GSHRC_BRARP     ----------------------------------------------------------------------
DLDH_CHLPN      ----------------------------------------------------------------------
RURE_ACIAD      ------------------------NPEHELVMICADDAVNYAKPTLSNALSGN-KAPEQIPLGDAEKMST
NORW_ECO27      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOUT      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOSM      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOK1      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECO45      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECO24      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_SHISS      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAG
NORW_ESCF3      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_SHIDS      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_ECOL6      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
NORW_SHIFL      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAG
NORW_SHIF8      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAG
NORW_KLEP7      ----------------------KQDAQIPLTLIAADSMDEYNKPDLSHVISRG-QKADDLTLQSAGEFAE
NORW_ECOLU      ----------------------------------------YNKPDLSHVIS-QRQRADDLTRQTAGEFAE
NORW_VIBFM      ----------------------RTNSDCPIHVFTNDSGDDYNKPDLSHVFSKQ-QSPEEVVTLSGGDFAE
NORW_SALA4      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_KLEP3      ----------------------KQDTQIPLTLIAADSMDEYNKPDLSHVISRG-QKADDLTLQSAGEFAE
GSHRC_PEA       ----------------------------------------------------------------------
NORW_SALTY      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
DLDH1_PSEAE     ----------------------------------------------------------------------
MERA_STRLI      ----------------------------------------------------------------------
DLDH3_HALMA     ----------------------------------------------------------------------
NORW_CITK8      ----------------------------------------YNKPDLSHVIS-QAQRADDLTRQSAGEFAE
NORW_SALHS      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_SALEP      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_ERWCT      ----------------------------------------------------------------------
GSHRC_ORYSJ     ----------------------------------------------------------------------
DLDH1_BACSU     ----------------------------------------------------------------------
NORW_SALSV      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
MDAR2_ARATH     ---------------------------------------------------------------TPKWYKD
DLDH_CHLTE      ----------------------------------------------------------------------
YDGE_SCHPO      --------------------------------------------------------ISKLALRSKEYYDD
NORW_SALTI      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
STHA_MARAV      ----------------------------------------------------------------------
MERA_ACICA      ----------------------------------------------------------------------
DLDH_STAAW      ----------------------------------------------------------------------
DLDH_STAAU      ----------------------------------------------------------------------
DLDH_STAAS      ----------------------------------------------------------------------
DLDH_STAAR      ----------------------------------------------------------------------
DLDH_STAAN      ----------------------------------------------------------------------
DLDH_STAAM      ----------------------------------------------------------------------
DLDH_STAAC      ----------------------------------------------------------------------
GSHR_BURCE      ----------------------------------------------------------------------
DLDH_RHOCA      ----------------------------------------------------------------------
NORW_SALG2      ----------------------------------------YNKPDLSHVIS-QSQRADDLNRQLAGEFAE
DLDH_MYCTU      ----------------------------------------------------------------------
DLDH_MYCBO      ----------------------------------------------------------------------
STHA_PSEAE      ----------------------------------------------------------------------
STHA_PSEAB      ----------------------------------------------------------------------
STHA_PSEA8      ----------------------------------------------------------------------
DLDH_CHLTR      ----------------------------------------------------------------------
STHA_PSEA7      ----------------------------------------------------------------------
GSHR_ECOLI      ----------------------------------------------------------------------
DLDH2_HALMA     ----------------------------------------------------------------------
GSHR_HAEIN      ----------------------------------------------------------------------
DLDH_CHLP8      ----------------------------------------------------------------------
NORW_SALAR      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
MERA_ALCSP      ----------------------------------------------------------------------
MDAR_PEA        ---------------------------------------------------------ERLL---PEWYSE
NASB_BACSU      ----------------------------EIVIFGSEPHPNYNRILLSSVLQGEAS-LDDITLNSKDWYDK
DLDH2_PSEPU     ----------------------------------------------------------------------
STHA_MYCTU      ----------------------------------------------------------------------
STHA_MYCTA      ----------------------------------------------------------------------
STHA_MYCBT      ----------------------------------------------------------------------
STHA_MYCBP      ----------------------------------------------------------------------
STHA_MYCBO      ----------------------------------------------------------------------
NORW_VIBVU      ----------------------RLDAHIPIQIFTADDGAEYNKPDLSHVFSKRQTAAD-LVVKSGEAFAE
GSHR_ASHGO      ----------------------------------------------------------------------
DLDH2_PSEAE     ----------------------------------------------------------------------
STHA_PSEFS      ----------------------------------------------------------------------
DLDH_PEA        ----------------------------------------------------------------------
STHA_PSEPK      ----------------------------------------------------------------------
STHA_PSEPG      ----------------------------------------------------------------------
STHA_PSEP1      ----------------------------------------------------------------------
GSHRP_TOBAC     ------------------------------------------------LIANKNAELQRLTGIYKNILKN
DLDH_PSEFL      ----------------------------------------------------------------------
STHA_PSEPW      ----------------------------------------------------------------------
DLDH_HALSA      ----------------------------------------------------------------------
STHA_PSEFL      ----------------------------------------------------------------------
STHA_PSEE4      ----------------------------------------------------------------------
NORW_VIBVY      ----------------------RLDAHIPIQIFTADDGAEYNKPDLSHVFSKRQTAAD-LVVKSGEAFAT
NORW_ECO81      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
GSHRP_ARATH     ------------------------------------------------LIANKNAELQRLTGIYKNILSK
DLDH_ACHLA      ----------------------------------------------------------------------
DLDH1_BACST     ----------------------------------------------------------------------
STHA_PSEPF      ----------------------------------------------------------------------
MDARS_CUCSA     ---------------------------------------------------------ERLL---PDWYKE
STHA_PSEU5      ----------------------------------------------------------------------
GSHRP_SOYBN     ----------------------------------------------------------------------
STHA_CHRSD      ----------------------------------------------------------------------
STHA_AZOVI      ----------------------------------------------------------------------
STHA_AZOVD      ----------------------------------------------------------------------
NORW_ENT38      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQTAGEFAE
NORW_ECO7I      ----------------------------------------YNKPDLSHVIS-QGQRADDLTRQTAGEFAE
STHA_PSEF5      ----------------------------------------------------------------------
STHA_PSESM      ----------------------------------------------------------------------
STHA_PSE14      ----------------------------------------------------------------------
GSHR_ANASP      ----------------------------------------------------------------------
STHA_PSEU2      ----------------------------------------------------------------------
NIRB_KLEOX      --------------------------QYRIVVFCEERYAAYDRVHLTEYFAGR--SAESLSLVEGDFFTQ
GSHR_PSEAE      ----------------------------------------------------------------------
GSHR_HUMAN      ----------------------------------------------------------------------
DLDH_AZOVI      ----------------------------------------------------------------------
STHA_PSEMY      ----------------------------------------------------------------------
STHA_HAHCH      ----------------------------------------------------------------------
HCAD_ECOLU      -------------------------------------------------------------------WQE
GSHR_MOUSE      ----------------------------------------------------------------------
GSHR_CALJA      ----------------------------------------------------------------------
TYTR_TRYBB      ----------------------------------------------------------------------
NORW_SALPB      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
DLDH_BUCAI      --------------------------------------------------------------------KK
DLDH3_PSEAE     ----------------------------------------------------------------------
MDAR3_ARATH     ----------------------------------------------------------------PESYKQ
NORW_SALPK      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_SALPA      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_VIBF1      ----------------------RTNNDCPIHVFTNDSGDDYNKPDLSHVFSKQ-QSPEEVVTLSGGDFAE
STHA_PROMH      ----------------------------------------------------------------------
NORW_SALNS      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_SALDC      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
MDAR1_ARATH     ----------------------------------------------------------------PNWYKE
NIRB_ECOLI      -------------------------------------------------------------------YEK
GSHR_STRTR      ----------------------------------------------------------------------
GSHR_DICDI      ----------------------------------------------------------------------
NORW_SALPC      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
NORW_SALCH      ----------------------------------------YNKPDLSHVIS-QSQRADDLTRQLAGEFAE
STHA_YERE8      ----------------------------------------------------------------------
STHA_VIBVY      ----------------------------------------------------------------------
STHA_VIBVU      ----------------------------------------------------------------------
DLDH_SHIFL      ----------------------------------------------------------------------
DLDH_ECOLI      ----------------------------------------------------------------------
DLDH_ECOL6      ----------------------------------------------------------------------
DLDH_ECO57      ----------------------------------------------------------------------
AIFM3_HUMAN     ---------------------------------------------------------EQLALRPKEFFRA
STHA_SERP5      ----------------------------------------------------------------------
NORW_AERS4      ----------------------------------------------------------------------
HCAD_ECO5E      -------------------------------------------------------------------WQE
HCAD_ECO57      -------------------------------------------------------------------WQE
DLDH_SYNY3      ----------------------------------------------------------------------
HCAD_ECOSM      -------------------------------------------------------------------WQE
STHA_YERPY      ----------------------------------------------------------------------
STHA_YERPS      ----------------------------------------------------------------------
STHA_YERPP      ----------------------------------------------------------------------
STHA_YERPN      ----------------------------------------------------------------------
STHA_YERPG      ----------------------------------------------------------------------
STHA_YERPE      ----------------------------------------------------------------------
STHA_YERPB      ----------------------------------------------------------------------
STHA_YERPA      ----------------------------------------------------------------------
STHA_YERP3      ----------------------------------------------------------------------
STHA_PHOPR      ----------------------------------------------------------------------
MDAR_SOLLC      ----------------------------------------------------------------PEWYAE
GSHR_RAT        ----------------------------------------------------------------------
STHA_VIBSL      ----------------------------------------------------------------------
HCAD_ECOLI      ----------------------------------------------------------------------
HCAD_ECOLC      ----------------------------------------------------------------------
HCAD_ECOHS      ----------------------------------------------------------------------
HCAD_ECODH      ----------------------------------------------------------------------
HCAD_ECOBW      ----------------------------------------------------------------------
HCAD_ECO7I      ----------------------------------------------------------------------
HCAD_ECO24      ----------------------------------------------------------------------
GSHRP_PEA       ------------------------------------------------LIANKNAELQRLTGIYKNTLKN
STHA_VIBF1      ----------------------------------------------------------------------
HCAD_ECOSE      ----------------------------------------------------------------------
HCAD_ECO55      ----------------------------------------------------------------------
DLDH_MYCLE      ----------------------------------------------------------------------
TERPA_PSESP     ----------------------------------------------------------------------
MDARP_ARATH     --------------------------------------------------------------QTPDWYKE
DLDH2_ARATH     ----------------------------------------------------------------------
TYTR_TRYCO      ----------------------------------------------------------------------
STHA_PHOLL      ----------------------------------------------------------------------
DLDH_ZYMMO      --------------------------------------------------------LDKIIARSREVATR
DLDH1_ARATH     ----------------------------------------------------------------------
DLDH_RHIET      ----------------------------------------------------------------------
STHA_VIBPA      ----------------------------------------------------------------------
HCAD_SHISS      ----------------------------------------------------------------------
GSHR_NEUCR      ----------------------------------------------------------------------
DLDH3_PSEPU     ----------------------------------------------------------------------
TRXR2_BOVIN     ----------------------------------------------------------------------
STHA_HAMD5      ----------------------------------------------------------------------
STHA_ERWCT      ----------------------------------------------------------------------
STHA_COLP3      ----------------------------------------------------------------------
TRXR2_RAT       ----------------------------------------------------------------------
HCAD_PHOLL      ----------------------------------------------------------------------
TYTR_CRIFA      ----------------------------------------------------------------------
DLDH_RALEH      ----------------------------------------------------------------------
TRXR2_MOUSE     ----------------------------------------------------------------------
TRXR2_HUMAN     ----------------------------------------------------------------------
STHA_VIBCM      ----------------------------------------------------------------------
STHA_VIBCH      ----------------------------------------------------------------------
STHA_VIBC3      ----------------------------------------------------------------------
STHA_KLEP7      ----------------------------------------------------------------------
STHA_KLEP3      ----------------------------------------------------------------------
NORW_AERHH      ----------------------------------------------------------------------
DLDH_MOUSE      ----------------------------------------------------------------------
AIFM1_DICDI     ----------------------------------------------------------------------
XECC_XANP2      ----------------------------------------------------------------------
GSHR_YARLI      ----------------------------------------------------------------------
DLDH_MYCPN      ----------------------------------------------------------------------
TYTR_TRYCR      ----------------------------------------------------------------------
STHA_SODGM      ----------------------------------------------------------------------
STHA_ERWT9      ----------------------------------------------------------------------
DLDH3_BACSU     ----------------------------------------------------------------------
STHA_SALPC      ----------------------------------------------------------------------
STHA_SALCH      ----------------------------------------------------------------------
STHA_MARMS      ----------------------------------------------------------------------
NORW_SERP5      ----------------------------------------------------------------------
DLDH_PIG        ----------------------------------------------------------------------
DLDH_CRIGR      ----------------------------------------------------------------------
STHA_SALTY      ----------------------------------------------------------------------
STHA_SALTI      ----------------------------------------------------------------------
STHA_SALPK      ----------------------------------------------------------------------
STHA_SALPB      ----------------------------------------------------------------------
STHA_SALPA      ----------------------------------------------------------------------
STHA_SALG2      ----------------------------------------------------------------------
STHA_SALEP      ----------------------------------------------------------------------
STHA_ENT38      ----------------------------------------------------------------------
DLDH_HUMAN      ----------------------------------------------------------------------
DLDH_CANFA      ----------------------------------------------------------------------
STHA_CITK8      ----------------------------------------------------------------------
RURE_PSEOL      ---------------------------------------------------------ESAVPLKPEGFTN
DLDH_RAT        ----------------------------------------------------------------------
DLDH_MACFA      ----------------------------------------------------------------------
TRXB_METJA      ----------------------------------------------------------------------
DLDH_BUCAP      ----------------------------------------------------------------------
GSHR_KLULA      ---------------------------------------------------------ENLTFNWPEFKKK
DLDH_PONAB      ----------------------------------------------------------------------
DLDH_HAEIN      ----------------------------------------------------------------------
AHPF_PSEAE      ----------------------------------------------------------------------
STHA_SHIB3      ----------------------------------------------------------------------
STHA_ESCF3      ----------------------------------------------------------------------
STHA_ECOUT      ----------------------------------------------------------------------
STHA_ECOSM      ----------------------------------------------------------------------
STHA_ECOSE      ----------------------------------------------------------------------
STHA_ECOLU      ----------------------------------------------------------------------
STHA_ECOLI      ----------------------------------------------------------------------
STHA_ECOL6      ----------------------------------------------------------------------
STHA_ECOL5      ----------------------------------------------------------------------
STHA_ECOK1      ----------------------------------------------------------------------
STHA_ECODH      ----------------------------------------------------------------------
STHA_ECOBW      ----------------------------------------------------------------------
STHA_ECO8A      ----------------------------------------------------------------------
STHA_ECO7I      ----------------------------------------------------------------------
STHA_ECO5E      ----------------------------------------------------------------------
STHA_ECO57      ----------------------------------------------------------------------
STHA_ECO55      ----------------------------------------------------------------------
STHA_ECO45      ----------------------------------------------------------------------
STHA_ECO27      ----------------------------------------------------------------------
STHA_ECO24      ----------------------------------------------------------------------
STHA_ECOLC      ----------------------------------------------------------------------
STHA_ECOHS      ----------------------------------------------------------------------
TRXB_LISMO      ----------------------------------------------------------------------
STHA_ECO81      ----------------------------------------------------------------------
MERA_SERMA      ----------------------------------------------------------------------
GSHR_SCHPO      ----------------------------------------------------------------------
DLDH_MYCGE      ----------------------------------------------------------------------
NIR_EMENI       ----------------------------------------------------------------------
AHPF_XANCH      ----------------------------------------------------------------------
DLDH_VIBCH      ----------------------------------------------------------------------
STHA_SHIFL      ----------------------------------------------------------------------
MDAR4_ARATH     ----------------------------------------------------------------PQWYKE
AIFM2_HUMAN     ----------------------------------------------------------------------
YKGC_ECOLI      ----------------------------------------------------------------------
AIFM1_RAT       -----------------------------------------------YVSAQDLPHIEN-----------
GSHR_CANGA      ----------------------------------------------------------------------
TRXR1_PONAB     ----------------------------------------------------------------------
GSHR_YEAST      ----------------------------------------------------------------------
GSHR_PLAFK      ----------------------------------------------------------------------
TYTR_LEIDO      ----------------------------------------------------------------------
TRXB_CLOLI      -----------------------------------------------------------LIGRMEEQVEE
GSHR_PLAF7      ----------------------------------------------------------------------
GSHR_CAEEL      ----------------------------------------------------------------------
AIFM2_MOUSE     ----------------------------------------------------------------------
AIFM1_MOUSE     -----------------------------------------------YVSAQDLPNIEN-----------
AHPF_PSEPU      ----------------------------------------------------------------------
AHPF_PSEPK      ----------------------------------------------------------------------
TRXR1_HUMAN     ----------------------------------------------------------------------
HCAD_SHIF8      ----------------------------------------------------------------------
DLDH_VIBPA      ----------------------------------------------------------------------
BAICD_EUBSP     ----------------------------------------------------------------------
TRXR1_PIG       ----------------------------------------------------------------------
TRXR1_MOUSE     ----------------------------------------------------------------------
TRXB_LISIN      ----------------------------------------------------------------------
DLDH2_BACSU     ----------------------------------------------------------------------
TRXR1_BOVIN     ----------------------------------------------------------------------
AIFM1_HUMAN     -----------------------------------------------YVSAQDLPHIEN-----------
AIFM1_DROME     ----------------------------------------------------------------------
TRXR1_RAT       ----------------------------------------------------------------------
DLDH_MANSE      ----------------------------------------------------------------------
TRXR1_DROME     ----------------------------------------------------------------------
TRXB_TREPA      ----------------------------------------------------------------------
TRXB_EUBAC      -----------------------------------------------------------LIERMEEQANE
DHNA_ARATH      ------------------------------------------------LLSGEVPRFSDLLTNTGIQFLR
R34K_CLOPA      ----------------------------------------------------------------------
DLDH_SCHPO      ----------------------------------------------------------------------
DLDH_TRYBB      ----------------------------------------------------------------------
TRXB_CANGA      ----------------------------------------------------------------------
DLDH_TRYCR      ----------------------------------------------------------------------
TRXR_PLAF7      ----------------------------------------------------------------------
TRXR_PLAF5      ----------------------------------------------------------------------
TRXR3_HUMAN     ----------------------------------------------------------------------
DHNA_HAEIN      ----------------------------------------------------------------------
YUTJ_BACSU      ----------------------------------------------------------------------
TRXB_ASHGO      ----------------------------------------------------------------------
TRXR3_MOUSE     ----------------------------------------------------------------------
FENR_FRAAA      ----------------------------------------------------------------------
TRXB_KLULA      ----------------------------------------------------------------------
FENR_IGNH4      ----------------------------------------------------------------------
TRXR1_CAEEL     ----------------------------------------------------------------------
TRXB_CHLMU      ----------------------------------------------------------------------
PYRD1_PONAB     ----------------------------------------------------------------------
TRXB_CHLPN      ----------------------------------------------------------------------
AIF1_YEAST      ----------------------------------------------------------------------
AHPF_ECOLI      ----------------------------------------------------------------------
PYRD1_HUMAN     ----------------------------------------------------------------------
GLTD_ECOLI      --------------------------------------------GVKAVVFDRHPEIGGLLTFGIPAFKL
TRXR2_DROME     ----------------------------------------------------------------------
TRXB_CHLTR      ----------------------------------------------------------------------
PYRD1_MOUSE     ----------------------------------------------------------------------
PYRD1_BOVIN     ----------------------------------------------------------------------
OOXA_AGRT4      ----------------------------------------------------------------------
FENR_NOCSJ      ----------------------------------------------------------------------
PYRD1_RAT       ----------------------------------------------------------------------
AHPF_STAAR      ----------------------------------------------------------------------
TRXB2_YEAST     ----------------------------------------------------------------------
OOXA2_RHIME     ----------------------------------------------------------------------
FENR_SULSO      ----------------------------------------------------------------------
AHPF_STAAW      ----------------------------------------------------------------------
AHPF_STAAN      ----------------------------------------------------------------------
AHPF_STAAM      ----------------------------------------------------------------------
TRXB_BACSU      ----------------------------------------------------------------------
DLDH_BUCBP      ----------------------------------------------------------------------
AHPF_STAAC      ----------------------------------------------------------------------
AHPF_STAA8      ----------------------------------------------------------------------
TRXB_STRCO      ----------------------------------------------------------------------
TRXB_MYCPU      ----------------------------------------------------------------------
FENR_LACAC      ----------------------------------------------------------------------
YUMB_BACSU      ----------------------------------------------------------------------
FENR1_BACP2     ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
TRXB_RICBR      ----------------------------------------------------------------------
TRXB1_YEAST     ----------------------------------------------------------------------
TRMFO_DESDG     ----------------------------------------------------------------------
GLTD_RHOSH      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
FENR_SULTO      ----------------------------------------------------------------------
FENR_PROA2      ----------------------------------------------------------------------
FENR_LACH4      ----------------------------------------------------------------------
AHPF_STAAS      ----------------------------------------------------------------------
AHPF_SALTY      ----------------------------------------------------------------------
TRXB_STAAW      ----------------------------------------------------------------------
TRXB_STAAS      ----------------------------------------------------------------------
TRXB_STAAN      ----------------------------------------------------------------------
TRXB_STAAM      ----------------------------------------------------------------------
TRXB_STAAC      ----------------------------------------------------------------------
TRXB_PENCH      ----------------------------------------------------------------------
GLTD_AZOBR      ----------------------------------------------------------------------
FENR_FRASC      ----------------------------------------------------------------------
AHPF_STAES      ----------------------------------------------------------------------
AHPF_STAEQ      ----------------------------------------------------------------------
TRXB_STAAR      ----------------------------------------------------------------------
TRMFO_EXISA     ----------------------------------------------------------------------
IRC15_YEAST     ----------------------------------------------------------------------
FENR1_SULAC     ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
TRXB_RICPR      ----------------------------------------------------------------------
TRXB_HELPY      ----------------------------------------------------------------------
TRXB_BORBU      ----------------------------------------------------------------------
FENR1_BACA2     ----------------------------------------------------------------------
TRXB_STAES      ----------------------------------------------------------------------
TRXB_STAEQ      ----------------------------------------------------------------------
TRXB_HELPJ      ----------------------------------------------------------------------
FENR_METS5      ----------------------------------------------------------------------
FADB_ECOLU      ----------------------------------------------------------------------
FADB_ECO7I      ----------------------------------------------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
FENR_CHLTE      ----------------------------------------YDVAGFPEVPA--IDLVESLWAQA-ERYNP
BAIH_EUBSP      ----------------------------------------------------------------------
RAX2_SCHPO      ----------------------------------------------------------------------
FENR_LACF3      ----------------------------------------------------------------------
FENR_CHLCH      ----------------------------------------------------------------------
DHNA_BACYN      ----------------------------------------------------------------------
TRXB_NEUCR      ----------------------------------------------------------------------
FENR_MAGSA      ----------------------------------------------------------------------
FENR_CHLL2      ----------------------------------------------------------------------
FADB_ECO5E      ----------------------------------------------------------------------
FADB_ECO57      ----------------------------------------------------------------------
DHNA_BACSU      ----------------------------------------------------------------------
TRXB_MYCGE      ----------------------------------------------------------------------
TRXB_DICDI      --------------------------------------------GFPIDISGS-----ELMDKMREQNIK
TRXB_COXBU      ----------------------------------------------------------------------
TRMFO_BACCN     ----------------------------------------------------------------------
KMO_USTMA       ----------------------------------------------------------------------
FENR_SYMTH      ----------------------------------------------------------------------
FENR_PROVI      ----------------------------------------------------------------------
FENR_CHLPD      -------------------------------IYDVAGFPEVPAAGLVESLWKQAERYN------PDVVLG
FENR_BRASB      ----------------------------------------------------------------------
FENR2_CHLT3     ----------------------------------------------------------------------
DADA2_PSEAE     ----------------------------------------------------------------------
TRMFO_BACSU     ----------------------------------------------------------------------
STCD_RHIME      ----------------------------------------------------------------------
FIXC_SHIFL      ----------------------------------------------------------------------
FENR_ACIC1      ----------------------------------------------------------------------
FENR2_SULAC     ----------------------------------------------------------------------
TRXB1_ARATH     -----------------------------------------------------------------DKFRK
FENR_SALAI      ----------------------------------------------------------------------
FENR1_BACSU     ----------------------------------------------------------------------
TRMFO_EXIS2     ----------------------------------------------------------------------
TRMFO_BACP2     ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
FIXC_ECOLI      ----------------------------------------------------------------------
FIXC_ECOL6      ----------------------------------------------------------------------
FIXC_ECO57      ----------------------------------------------------------------------
FENR_METPP      ----------------------------------------------------------------------
FENR2_BACP2     ----------------------------------------------------------------------
FADB_YERE8      ----------------------------------------------------------------------
TRXB_STRCL      ----------------------------------------------------------------------
TRXB_PNECA      ----------------------------------------------------------------------
TRXB_MYCSM      ----------------------------------------------------------------------
TRMFO_STAAW     ----------------------------------------------------------------------
TRMFO_STAAT     ----------------------------------------------------------------------
TRMFO_STAAS     ----------------------------------------------------------------------
TRMFO_STAAR     ----------------------------------------------------------------------
TRMFO_STAAN     ----------------------------------------------------------------------
TRMFO_STAAM     ----------------------------------------------------------------------
TRMFO_STAAE     ----------------------------------------------------------------------
TRMFO_STAAC     ----------------------------------------------------------------------
TRMFO_STAAB     ----------------------------------------------------------------------
TRMFO_STAA9     ----------------------------------------------------------------------
TRMFO_STAA8     ----------------------------------------------------------------------
TRMFO_STAA3     ----------------------------------------------------------------------
TRMFO_STAA2     ----------------------------------------------------------------------
TRMFO_STAA1     ----------------------------------------------------------------------
TRMFO_LYSSC     ----------------------------------------------------------------------
GSHR_DEBHA      ----------------------------------------------------------------------
FENR_THET8      ----------------------------------------------------------------------
FENR_THET2      ----------------------------------------------------------------------
FENR_PELLD      ----------------------------------------------------------------------
FENR_LACDB      ----------------------------------------------------------------------
FENR_LACDA      ----------------------------------------------------------------------
FENR_FLAPJ      ----------------------------------------------------------------------
FENR_CHLP8      ----------------------------------------------------------------------
FENR1_CHLT3     ----------------------------------------------------------------------
FADB_SHISS      ----------------------------------------------------------------------
FADB_SHIFL      ----------------------------------------------------------------------
FADB_SHIF8      ----------------------------------------------------------------------
FADB_ECOLI      ----------------------------------------------------------------------
FADB_ECODH      ----------------------------------------------------------------------
FADB_ECOBW      ----------------------------------------------------------------------
TRXB_RICTY      ----------------------------------------------------------------------
TRXB_RICCN      ----------------------------------------------------------------------
TRXB2_ARATH     -----------------------------------------------------------------EKFRK
TRMFO_STAES     ----------------------------------------------------------------------
TRMFO_STAEQ     ----------------------------------------------------------------------
TRMFO_LISIN     ----------------------------------------------------------------------
TRMFO_BACWK     ----------------------------------------------------------------------
TRMFO_BACHK     ----------------------------------------------------------------------
TRMFO_BACCZ     ----------------------------------------------------------------------
TRMFO_BACCR     ----------------------------------------------------------------------
TRMFO_BACCQ     ----------------------------------------------------------------------
TRMFO_BACC7     ----------------------------------------------------------------------
TRMFO_BACC4     ----------------------------------------------------------------------
TRMFO_BACC3     ----------------------------------------------------------------------
TRMFO_BACC2     ----------------------------------------------------------------------
TRMFO_BACC1     ----------------------------------------------------------------------
TRMFO_BACC0     ----------------------------------------------------------------------
TRMFO_BACAN     ----------------------------------------------------------------------
TRMFO_BACAH     ----------------------------------------------------------------------
TRMFO_BACAC     ----------------------------------------------------------------------
TRMFO_BACAA     ----------------------------------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
MNMC_PSEU2      ----------------------------------------------------------------------
MNMC_PSE14      ----------------------------------------------------------------------
LNT_RHILO       ----------------------------------------------------------------------
FENR_NEOSM      ----------------------------------------------------------------------
FENR_CHLPB      ----------------------------------------------------------------------
FENR2_BACLD     ----------------------------------------------------------------------
FADB_SERP5      ----------------------------------------------------------------------
Y1834_STAS1     ----------------------------------------------------------------------
TRXB_MYCPN      ----------------------------------------------------------------------
TRMFO_LISMF     ----------------------------------------------------------------------
PURT_DESVM      ----------------------------------------------------------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      ----------------------------------------------------------------------
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_PSEE4      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
CDR_PYRFU       RGIDLHLKAEVIEV--ETGYVRVRENGEEKSYE--WDYLVFANGASPQIPEIEGVDLPGVFTADLPPDAV
CDR_PYRAB       RGIDLHLNAEVIEVDTGY--VRVREKDGEKSYE--WDYLVFANGASPQVPAIEGVDLKGVFTADLPPDAV
CDR_PYRKO       RGIDLHLK--AXXXXXXXXXXXXXXXXXXKTYE--WDYLVFANGASPQVPAIEGIDLPGVFTADLPPDAV
CDR_PYRHO       RGIDLHLNAEVIEVD----TGYVRVRENGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDAL
NAOX_METJA      RNIDILTETTVIDVDSKNNKIKCVDK-DGNEFEMNYDYLVLATGAEPFIPPIEGKDLDGVFKVRTIEDGR
NAOX_STRP6      LGAKVYMESPVQSIDYDAKTVTAL--VDGKNHVETYDKLIFATGSQPILPPIKGAEKEGSLEFEATLENL
CDR_STAES       KQITVKTYHEVIQINDERQTVTVLNHQTNQTFEESYDTLILSPGASANRL---NTHSDISFTVRNLEDTE
CDR_STAEQ       KQITVKTYHEVIQINDERQTVTVLNHQTNQTFEESYDTLILSPGASANRL---NTHSDISFTVRNLEDTE
CDR_STAAN       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAAM       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAA9       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAA2       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAA1       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAAW       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAAS       Q-ITVKTYHEVIAINDERQTVTVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAAB       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTE
CDR_STAAR       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
NAPE_ENTFA      RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
CDR_STAAC       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
NAOX_LACLM      KGVKILTETEVSEIDFANKKVYAKTKSDDEIIE-AYDKLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQ
CDR_STAA8       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAHJ       KDITVKTYHEVIAINDKDQTVTVVNRQTNEKFEASYDKLILSPGAGANSL---GFDSDYIFTLRNMEDTD
CDR_STAAT       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAAE       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
CDR_STAA3       Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
NAOX_ENTFA      LGATVKMEHNVEEINVDDKTVTAKNLQTGATETVSYDKLVMTTGSWXXXXXXXXXDAENILLCKNYSQAN
CDR_STAS1       KNIVVKPCHKVTSINDTENTITVYDRIQDTYFETHYDTLILSPGCSANSLNL---DSPIAFTLRNMEDTD
NAOX_MYCPN      MGANVFMAHDVVGLDLDKKQVIVKDLATGKETVDHYDQLVVASGAWPICMNVENTQLQFNHTDKTLIDSF
NAOX_MYCGE      MGANIFMSHDVTNIDLIKKQVTVRDLTSNKEFTDQFDQLVIASGAWPICMNVENKVTHNVKNLISCKLYQ
THCD_RHOER      HRITLTCGKPVVRIDRDAQRVELIDATA-----IEYDHLILATGARNRLLPVPGANLPGVHYLRTAGEAE
MERA_STAES      ---------------------------------------LIATGASPAVPEIPGMNEVDYLTSTSALE--
MERA_STAAU      ---------------------------------------LIATGASPAVPEIPGMNEVDYLTSTSALE--
TODA_PSEP1      ------TGPEVTALDVQTRTISLDD---GTTLSA--DAIVIATGSRARTMALPGSQLPGVVTLRTYGDVQ
MERA_ENTAG      -----------------------------------FDRCLVATGASPAVPPIPGLKESPYWT------ST
BEDA_PSEPU      ASIEMLTGSEVTDLDTQKKMISLND---GSTISA--DAIVIATGSRARMLSLPGSQLPGVVTLRTYGDVQ
CAMA_PSEPU      QNIQLLGGTQVTAINRDRQQVILSD---GRALD--YDRLVLATGGRPRLPVASGAKANNFRYLRTLEDAE
AIFM3_MOUSE     YGIEMLTEAQXXXXXXXXXXXXFKDG-----FKLEYSKLLLAPGSSPKTLTCKGKDVENVFTIRTPEDAN
MERA_THIFE      ------------------RSVVVHLNDGGERVV-MFDRCLVATGASPAVPPIPGLKDTPYWT-----STE
MERA_SHIFL      -----------------------------------FDRCLIATGASPAVPPIPGLKDTPYWTSTEALVSE
MERA_PSEFL      ---------------------------EGGEREVTFDRCLVATGASPAVPPIPGLKESPYWT-----STE
MERA_SHEPU      ------------------------------------DKILIATGSTPTIPPIDGLTETPYWT------ST
MERA_BACCE      ---------------------------------------LIATGASSTAPNIPGLDEVDYLTSTSLLE--
DLDH_CHLMU      --------------------------------------IILATGSEPAFPGVPFSQQSPRILCST---GV
MERA_PSEAE      -----------------------------------FDRCLVATGASPAVPPIPGLKESPYWT------ST
GSHRP_SPIOL     -------------------------------------HILIATGSRAQRPNIPGQE------LAITSDEA
BPHG_BURXL      ----------------------------------------------------------GIHTLRDLADSQ
TODA_PSEPU      ------TGPEVTALDVQTRTISLDD---GTTLSA--DAIVIATGSRARTMALPGSQLPGVVTLRTYGDVQ
BNZD_PSEPU      ------TGPEVTALDVQTRTISLDD---GTTLSA--DAIVIATGSRARTMALPGSQLPGVVTLRTYGDVQ
DLDH_HALVO      -----------------------------------FEHCIIATGSR--VIQIPGFDDEPVWSSRDA----
NORW_ECO5E      QNLLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECO57      QNLLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOLI      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOLC      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECODH      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOBW      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NASD_BACSU      NNIQLYTNETVIKVDTENKTVI--------TDADRYDELILATGSVPFILPIPGADKKGVTAFRDIKDTD
DLDH_THESC      ---------------------------------------IIATGSEPM--PLKGFPGEDVW------DST
NORW_SHIB3      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_SHIBS      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOSE      QFNLRLFPHTVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
GSHRC_ARATH     -------------------------------------HILIATGSRAQKPNIPGHE------LAITSDEA
DLDH1_PSEPU     ------------------------------------EHLLLATGSSSELPMLP----LGGPVISSTE--A
NORW_ECOL5      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--ILTLNSQQEYR
NORW_ECOHS      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECO8A      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECO55      QFNLLFPQTWVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
GSHRC_BRARP     -------------------------------------HILIATGSRAQKPNIPGHE------LAITSDEA
DLDH_CHLPN      ------------------------------------NHIILATGSEPR--PFPGVP----FSSRILSSGI
RURE_ACIAD      QLKLILSETWVKAINPETHELKLEKNGQ-ETIQP-YSKLVLAVGANPTRLAIAGDGSDDIHVVNSLIDYR
NORW_ECO27      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOUT      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOSM      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECOK1      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECO45      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ECO24      QFNLRLFPHTVTDIDAEARVVKSQNN------QWQYGKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_SHISS      QFNLHLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_ESCF3      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGANAFVPPVPGREL--MLTLNSQQEYR
NORW_SHIDS      QFNLHLFPHTVTDIDAEARVVKSQNN------QWQYDKLVLATGASAFVPSVPGREL--MLTLNSQQEYR
NORW_ECOL6      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_SHIFL      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_SHIF8      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_KLEP7      QYTLRLFPHTVSDIDAENRLVKSHDN------QWRYDKLVLATGATPFIPSVPG--RELMLTLNSQREYG
NORW_ECOLU      QFNLHLFPHTIMDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPGREL--MLTLNSQQEYR
NORW_VIBFM      QYNVILHRHTLVEINPEQQTITANGE------QYTYDKLVLATGSHTFVPPFHGDGCEDILTLNSLKEFS
NORW_SALA4      QFNLRLFPHRVADIDADAHVVKSQDK------QWQYDKLVLATGATAFVPPIAGREL--MLTLNSQQEYR
NORW_KLEP3      QYNLRLFPHTVSDIDAENRLVKSQDN------QWRYDKLVLATGATPFIPPVPG--RELMLTLNSQREYG
GSHRC_PEA       -------------------------------------HILIATGSRAQRPNIPGQE------LGITSDEA
NORW_SALTY      QFNLRRFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGATAFVPPIAGREL--MLTLNSQQEYR
DLDH1_PSEAE     ------------------------------------EHLLLAAGSQSVELPILPLGGKVISSTEALAPG-
MERA_STRLI      ---------------------------DGGTATVEAAHYLIATGSAPTAPHIDGLDQVDYLTSTTAME--
DLDH3_HALMA     ----------------------------------KFENCIIATGSRPIEIPGFGFEDERIVS----SDGA
NORW_CITK8      QFNLRLFPHTITDIDADAHVVKSQDK------QWQFDKLVLATGASAFVPPVAGREL--MLTLNSQQEYR
NORW_SALHS      QFNLRLFPHTVTDIDADAHVVKSQDK------QWQYDKLVLATGAAAFVPPIAGREL--MLTLNSQQEYR
NORW_SALEP      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGAAAFVPPIAGREL--MLTLNSQQEYR
NORW_ERWCT      ---------------------------------DRYDYLVFATGASAIVPPIPGREH--MLTLNSQQEYR
GSHRC_ORYSJ     -------------------------------------HILIATGSRAQRVNIPGKE------LAITSDEA
DLDH1_BACSU     -------------------SVRVMDENSAQTYT--FKNAIIATGSRPELPNFK-------YSERVLNSGA
NORW_SALSV      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGATAFVPPITGREL--MLTLNSQQEYR
MDAR2_ARATH     HGIELVLGTRVKSVDVRRKTLL---SSTGETISYKF--LIIATGARALKLEVEGSDAENVCYLRDLADAN
DLDH_CHLTE      -------------------------------------NIIVATGSTPRV--IPGLEPDGKKIITSRE--A
YDGE_SCHPO      LDISFHFNTDVTKIDLAEKKIYCGSDEKPT---ESYTKLILATGGEPNKLPIPGLDSKNVYLLRSIADAS
NORW_SALTI      QFNLRLFPHTVTDIDADAHVVKSQDK------QWQYDKLVLTTGATAFVPPIAGREL--MLTLNSQQEYR
STHA_MARAV      -----------------------------------FKQAIIATGSRPYLPPDVDFRHHRIY------NSD
MERA_ACICA      -----------------------------------FDRCLVATGASPAVPPIPGLKESPYWT-----STE
DLDH_STAAW      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
DLDH_STAAU      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
DLDH_STAAS      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
DLDH_STAAR      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
DLDH_STAAN      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
DLDH_STAAM      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
DLDH_STAAC      -------------------SLRVMDEKSAQTYN--FKNAIIATGSRPI--EIPNFK----FGKRVIDSGA
GSHR_BURCE      --------------------------------------ILIATGARPVMPPVAGAN-----LMITSDDVF
DLDH_RHOCA      -------------------------------------NIVIATGSESSLPGIEIDEQTVVTST-----GA
NORW_SALG2      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGAAAFVPPIAGREL--MLTLNSQQEYR
DLDH_MYCTU      ----------------DANTLLV-DLNDGGTESVTFDNAIIATGSSTRL--VPGTSLSA--NVVTYEE-Q
DLDH_MYCBO      ----------------DANTLLV-DLNDGGTESVTFDNAIIATGSSTRL--VPGTSLSA--NVVTYEE-Q
STHA_PSEAE      ------------------------------------DQFVIATGSRPYRPSDINFNHPRVY------DSD
STHA_PSEAB      ------------------------------------DQFVIATGSRPYRPSDINFNHPRVY------DSD
STHA_PSEA8      ------------------------------------DQFVIATGSRPYRPSDINFNHPRVY------DSD
DLDH_CHLTR      --------------------------------------IILATGSEPAFPGIPFSAESPRILCST---GV
STHA_PSEA7      ------------------------------------DQFVIATGSRPYRPSDINFNHPRVY------DSD
GSHR_ECOLI      ------------------------------------DHILIATGGRPSHPDIPGVEY-GIDS-----DGF
DLDH2_HALMA     -------------------TVRVAHGGEGQGSESSFEHAIVATGSRPMA--VPGFEFDGEHILSSKD--A
GSHR_HAEIN      --------------------------ADGTKEQVTADHILIATGGRPYRPNIKGQEY-GIDS-----DGF
DLDH_CHLP8      -------------------------------------NIIVATGAQPRV--IPGLEPDGKKIITSRE--A
NORW_SALAR      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGAAAFVPPVAGREL--MLTLNSQQEYR
MERA_ALCSP      -----------------------------------FDRCLVATGASPAVPPIPGLKESPYWT-----STE
MDAR_PEA        KGIQLYLSTEIVSADLAAKFLK---SANGEHFD--YQTLVIATGSRLTDFGVIGANAKNIFYLREVDDAD
NASB_BACSU      HGITLYTGEXXXXXXXXXXXXXXX---RKRTLS--YDKLIVATGSSPHILPIPGADKKGVYGFRTIEDCQ
DLDH2_PSEPU     --------------------------ADGTTEVIEAENVILASGSRPDIPPAPVDQNVIVDSTGALE---
STHA_MYCTU      -------------------TILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEERVLD----SDGI
STHA_MYCTA      -------------------TILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEERVLD----SDGI
STHA_MYCBT      -------------------TILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEERVLD----SDGI
STHA_MYCBP      -------------------TILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEERVLD----SDGI
STHA_MYCBO      -------------------TILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEERVLD----SDGI
NORW_VIBVU      ENVQLHAHTQVERVLTQQQQVV----ANGRCYP--YSKLVFATGAQAFVPPMRGDGLAKVMTLNSLQEYQ
GSHR_ASHGO      ------------------------------------DHILIATGGEPVLPEIPGAEY-GV-------DSD
DLDH2_PSEAE     ---------------------------DGKTQVLEAENVIIASGSRPEIPPAPLTDDIIVDSTGALE---
STHA_PSEFS      -------------------------------------HIIIATGSRPYRPADIDFHHPRIY------DSD
DLDH_PEA        ------------------------DTIEGENTVVKGKHIIIATGSDKSLPGVTIDEKKIVSST-----GA
STHA_PSEPK      -------------------------------------HIIIATGSRPYRPADIDFHHPRVY------DSD
STHA_PSEPG      -------------------------------------HIIIATGSRPYRPADIDFHHPRVY------DSD
STHA_PSEP1      -------------------------------------HIIIATGSRPYRPADIDFHHPRVY------DSD
GSHRP_TOBAC     AGVLIEGRGKVVDP----HTVDV----DGKLYSAK--NILISVGGRPFIPDIPGSE----YAI----DSD
DLDH_PSEFL      ---------------------------DGKTQVLEAENVIIASGSRPEIPPAPLSDDIIVDSTGALE---
STHA_PSEPW      -------------------------------------HIIIATGSRPYRPADIDFHHPRVY------DSD
DLDH_HALSA      ---LIEGRAEFAGSD-KLRVVHGGDGQGSETIE--YEHAIVSTGSRPI--EVPGFDFGDDPVL----DSR
STHA_PSEFL      -------------------------------------HIIIATGSRPYRPADIDFHHPRIY------DSD
STHA_PSEE4      -------------------------------------HIIIATGSRPYRPADIDFHHPRVY------DSD
NORW_VIBVY      ENVQLHAHTQVERVLTQQQQVV----ANGRCYP--YSKLVFATGAQAFVPPMRGDGLAKVMTLNSLQEYQ
NORW_ECO81      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPG--RELMLTLNSQQEYR
GSHRP_ARATH     ANVLIEGRGKVIDP----HTVDV----DGKIYTTR--NILIAVGGRPFIPDIPGKE--------FAIDSD
DLDH_ACHLA      -------------------------------------NVIIATGSSAVVPPIPGVKE--AYEKGIVVTSR
DLDH1_BACST     EGLLKGNKVEIVKGEVDANTVRVVNGDSAQTYT--FKNAIIATGSRPELPNFK-------FSNRILDSGA
STHA_PSEPF      -------------------------------------HIIIATGSRPYRPADIDFHHPRIY------DSD
MDARS_CUCSA     KGIELILSTEIVEADLPAKRLR---SAHGKIYN--YQTLIIATGSKLSDFGVQGADAKNIFYLREIDDAD
STHA_PSEU5      ------------------------------------NQFVIATGSRPYRPADIDFNHPRIY------DSD
GSHRP_SOYBN     -------------------------------------HILVAVGGRPFIPDIPGKE--------LAIDSD
STHA_CHRSD      -------------------TLTVRDNQDG-VEELCAQQFVIATGSRPYRPADINFRHPRIYCSDT-----
STHA_AZOVI      ---------------------------------------VIATGSRPYRPADVDFTHPRIY------DSD
STHA_AZOVD      ---------------------------------------VIATGSRPYRPADVDFTHPRIY------DSD
NORW_ENT38      QRLFPYTR--VTDIDAAAHCVKAKDK------QWHYDKLVLATGASAFVPLIEGHEL--MLTLNSQQEYK
NORW_ECO7I      QFNLRLFPHTVTDIDAEAHVVKSQNN------QWQYDKLVLATGASAFVPPVPG--RELMLTLNSQQEYR
STHA_PSEF5      -------------------------------------HIIIATGSRPYRPADIDFSHPRIY------DSD
STHA_PSESM      ------------------------------------NQIIIATGSRPYRPADIDFSHKRIY------DSD
STHA_PSE14      ------------------------------------NQIIIATGSRPYRPADIDFSHKRIY------DSD
GSHR_ANASP      ------------------------------------DKILIAVGGRPIKPELPGME----YGITSNE---
STHA_PSEU2      ------------------------------------NQIIIATGSRPYRPADIDFSHKRIY------DSD
NIRB_KLEOX      HGIELRLSESVASIDREARVVR-----DAFGHETHWDKLVLATGSYPFVPPVPGHNLEGCFVYRTLDDLD
GSHR_PSEAE      ------------------RLLDAHSEVDGQRFSAK--HILVATGGWPQVPDIPGKEHA------ITSNEA
GSHR_HUMAN      -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
DLDH_AZOVI      ------------------------------------ENVILASGSKPEIPPAPVDQD-------VIVDST
STHA_PSEMY      --------------------------------------IVIATGSRPYRPADVDFRHPRIY------DSD
STHA_HAHCH      --------------------------------------IVIATGSRPYLP------EDVDFTHRRIYNSD
HCAD_ECOLU      NNVHLHSGVTIKSLGRDTRELVL---TNGESWQ--WDQLFMATGXXXXXXXXXXXXGERCFTLRHADDAA
GSHR_MOUSE      -------------------------------------HILIATGGVPTVPQIPGA------SLGITSDGF
GSHR_CALJA      -------------------------------------HILIATGGMPSSPQIPGA------SLGITSDGF
TYTR_TRYBB      ------------------------------------DHILLATGSWPQMPAIPGVEH-------CISSNE
NORW_SALPB      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGATAFVPPITGREL--MLTLNSQQEYR
DLDH_BUCAI      RKIRIFQGHAIFETDKSLCVTNTEDK-----FTIFFDNAIIATGSKPKIPSIPHDD------IRIWDSTD
DLDH3_PSEAE     --------------------------ADGGHAQLEARDIVIATGSEPA--PLPGVPVDNQRIL----DST
MDAR3_ARATH     KGIELILSTEIVKADLSAKSLV---SATGDVF--KYQTLIIATGSRLTDFGVKGADSKNILYLREIDDAD
NORW_SALPK      QFNLRLFPHTVTDIDADAHVVKSQDK------QWQYDKLVLATGAAAFVPPIAGREL--MLTLNNQQEYR
NORW_SALPA      QFNLRLFPHTVTDIDADAHVVKSQDK------QWQYDKLVLATGAAAFVPPIAGREL--MLTLNNQQEYR
NORW_VIBF1      QNVILHRHTWVESIDTEIQAITANGE------QYAYGKLVLATGSQTFIPPFHGDGCGDILTLNSLKEFA
STHA_PROMH      ------------------------------------DNFIIATGSRPYCPPDVDFSHSRIYNSDTILDLE
NORW_SALNS      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGATAFVPPIAGREL--MLTLNSQQEYR
NORW_SALDC      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGATAFVPPIAGREL--MLTLNSQQEYR
MDAR1_ARATH     KGIDLIVGTEIVKADLASKTLVSDD---GKIY--KYQTLLIATGSRLSEIGVQEADVKNIFYLREIEDSD
NIRB_ECOLI      HGIKVLVGERAITINRQEKV--IHSSAGRTVF---YDKLIMATGSYPWIPPIKGSDTQDCFVYRTIEDLN
GSHR_STRTR      -------------------------------------HILIATGGHPLYPNIPGSEY-GITS-----DGF
GSHR_DICDI      ------------------------------------DHILIAAGGRPTVPDVPGKE------LGITSDGF
NORW_SALPC      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGAAALVPPIAGREL--MLTLNSQQEYR
NORW_SALCH      QFNLRLFPHTVADIDADAHVVKSQDK------QWQYDKLVLATGAAALVPPIAGREL--MLTLNSQQEYR
STHA_YERE8      -------------------------YADGTNDTLRADNIVIATGSRPYRPANVDFTHERIY------DSD
STHA_VIBVY      ------------------------------------DKFVIATGSRPYQPADVDFNHERIY------DSD
STHA_VIBVU      ------------------------------------DKFVIATGSRPYQPADVDFNHERIY------DSD
DLDH_SHIFL      -----------------------------------FDNAIIAAGSRPQLPFIPHEDPRIWDSTDALE---
DLDH_ECOLI      -----------------------------------FDNAIIAAGSRPQLPFIPHEDPRIWDSTDALE---
DLDH_ECOL6      -----------------------------------FDNAIIAAGSRPQLPFIPHEDPRIWDSTDALE---
DLDH_ECO57      -----------------------------------FDNAIIAAGSRPQLPFIPHEDPRIWDSTDALE---
AIFM3_HUMAN     YGIEVLT-----EAQXXXXXXXXXXXXXXXGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDXX
STHA_SERP5      ----------------------------------RADHIVIACGSRPYNPSSVDFNHPRIY------NSD
NORW_AERS4      -----------------------------------YGQLVLATGASAARPDLPGSEQ--LVTLNSQQEYA
HCAD_ECO5E      NNVHLHSGVTIKTLGRDTRELVL---ANGESWH--WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECO57      NNVHLHSGVTIKTLGRDTRELVL---ANGESWH--WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
DLDH_SYNY3      --------------------------------------IMLCPGSVPFVPPGIEIDHKTVFT----SDEA
HCAD_ECOSM      NNVHLHSGVTIKTLGRDTRELVL---ANGESWH--WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
STHA_YERPY      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPS      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPP      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPN      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPG      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPE      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPB      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERPA      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_YERP3      -------------------------YADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIY------DSD
STHA_PHOPR      ------------------------------------DKFVIATGSRPYHPEGVDFDHSRVY------DSD
MDAR_SOLLC      KGISLILSTEIVKADLASKTLV---SAAGESF--KYQTLVIATGTKLSDFGVQGADSKNIFYLREIDDAD
GSHR_RAT        -------------------------------------HILIATGGVPTVPQIPGA------SLGITSDGF
STHA_VIBSL      ------------------------------------DKFVIATGSRPYQPDNVDFMHERVY------DSD
HCAD_ECOLI      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECOLC      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECOHS      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECODH      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECOBW      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECO7I      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECO24      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
GSHRP_PEA       AGVLIEGRGKIVDA----HTVDV----DGKLYSAK--HILVSVGGRPFIPDIPGKE----YAI----DSD
STHA_VIBF1      ------------------------------------DKFIIATGSRPYRPEGINFNHSRVY------DSD
HCAD_ECOSE      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
HCAD_ECO55      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLRHAGDAA
DLDH_MYCLE      -----------------------------------FNNVIIATGSKTRL--VPGT----LLSTNVITYEE
TERPA_PSESP     -----------------------------------YDHLILATGSHPRFMATLGQADNLCY-LSDWDDAG
MDARP_ARATH     KGIEVIYEDPVAGADFEKQTLTTD---AGK--QLKYGSLIIATGCTASFPDKIGGHLPGVHYIREVADAD
DLDH2_ARATH     ------------------------DTIDGENVVVKGKHIIVATGSDKSLPGITIDEKKIVSST-----GA
TYTR_TRYCO      ------------------------------------EHIIIATGSWPQMLKIPGIEH-------CISSNE
STHA_PHOLL      ------------------------------------DKIIIATGSRPYCPPDVDFTHSRIY------NSD
DLDH_ZYMMO      SGVKTLLRKNKVEVISGVGQLTGNQQTEGEEKILEAKDIIIATGARARQLPNVHSDGKHIWTYH------
DLDH1_ARATH     -------------------------------------HIIVATGSDKSLPGITIDEKKIVSST-----GA
DLDH_RHIET      ----------------------------------------------------------------------
STHA_VIBPA      ------------------------------------DKFVIATGSRPYRPSDVDFLHERIY------DSD
HCAD_SHISS      -----------------------------------WDQLFIAIGXXXXXXXXXXXXGERCFTLRHAGDAA
GSHR_NEUCR      --------------------------------------ILIAVGGNPTIPPIPGSEYG------TNSDGF
DLDH3_PSEPU     --------------------------------------IVIATGSEPT--PLPGVT---IDNQRIIDSTG
TRXR2_BOVIN     ------------------------------------EHIVIATGGRPRYP----THIEGALEYGITSDDL
STHA_HAMD5      ------------------------------------DHIVIATGSRPYHPESIDFTHPRIYD----SDSI
STHA_ERWCT      -------------------------------------NIIIATGSRPYHPAEVDFNHPRIY------DSD
STHA_COLP3      -----YNRNRVEHIQGQASFIDAHSHPDGSVEKISAKQIMIATGSRPYRPDDIDFDHPRVY------DSD
TRXR2_RAT       ---------------------TVHGDKAGKVTQLSAKHIVIATGGRPKYP----TQVKGALEHGITSDDI
HCAD_PHOLL      ----------------------------------RYDKLLLTMGARARRFPLLDQLGENIYTLRTLDDAQ
TYTR_CRIFA      ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
DLDH_RALEH      --------------------------------------VIIATGSKAR--HLPGIKVDN----DLVSDNE
TRXR2_MOUSE     ------------------------------------EHIVIATGGRPRYP----TQVKGALEYGITSDDI
TRXR2_HUMAN     ------------------------------------DHIIIATGGRPRYP----THIEGALEYGITSDDI
STHA_VIBCM      ------------------------------------DKFVIATGSRPYHPKDVDFGHPRIY------DSD
STHA_VIBCH      ------------------------------------DKFVIATGSRPYHPKDVDFGHPRIY------DSD
STHA_VIBC3      ------------------------------------DKFVIATGSRPYHPKDVDFGHPRIY------DSD
STHA_KLEP7      -------------VDEHTLALECHDGTVETVTAEKF---VIACGSRPYHPADVDFHHPRIY------DSD
STHA_KLEP3      -------------VDEHTLALECHDGTVETVTAEKF---VIACGSRPYHPADVDFHHPRIY------DSD
NORW_AERHH      -----------------------------------YGQLVLATGASAVRPELPGSEH--LVTLNSQQEYA
DLDH_MOUSE      --------------------------ADGSTQVIDTKNILVATGSE--VTPFPGTIDEDTIVSST---GA
AIFM1_DICDI     ---------KVIDLHIDEKLVLLND---GKLI--RYDKCLIATGGEPRQLKFTSTNDKKISTYRTVEDFR
XECC_XANP2      -GIMNFQSKEQLNLEYILNAKVIDNHAAGKVFKAK--NLILAVGAGPGTLDVPGVNAKGVFDHATLVEE-
GSHR_YARLI      --------------------------------------IMIATGGKPRLPDVPGAESDGFFALET-----
DLDH_MYCPN      ----------------------------GKTYTTK--SIVVATGSRPRYLTLPGARQNGFVI-----DST
TYTR_TRYCR      ------------------------------------ENILLASGSWPHMPNIPGIEH-------CISSNE
STHA_SODGM      ------------------------------------ENIVIACGSRPYQPQDVDFDHPRIY------DSD
STHA_ERWT9      -------------IDANTLEIETHDGSIERLTAEKF---VIACGSRPYHPPDVDFTHPRIY------DSD
DLDH3_BACSU     ----------------------------------------------------------------------
STHA_SALPC      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPSDVDFSHPRIY------DSD
STHA_SALCH      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPSDVDFSHPRIY------DSD
STHA_MARMS      ----------------DANTIEVNTYEKGPELLEA-KKVVIATGSRPYRPANIDFSHPRIYCSDT-----
NORW_SERP5      -----------------------------------YDKLVLAIGAAAMVPQVPG--HELMLTLNSQQEFR
DLDH_PIG        --------------------------ADGSTEVINTKNILIATGSE--VTPFPGTIDEDTVVSST---GA
DLDH_CRIGR      -------------------------------------NILIATGSE--VTPFPGTIDEDTIVSST---GA
STHA_SALTY      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_SALTI      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_SALPK      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_SALPB      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_SALPA      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_SALG2      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_SALEP      -------------IDEHTLALECHDGTVETLTAEKF---VIACGSRPYHPNDVDFSHPRIY------DSD
STHA_ENT38      -------------VDEHTLALKCHDGSVETITAEKF---VIACGSRPYHPDDVDFSHPRVY------DSD
DLDH_HUMAN      --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
DLDH_CANFA      --------------------------ADGSTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
STHA_CITK8      -------------VDENTLALECHDGTVETLTAEKF---VIACGSRPYHPADVDFAHPRIY------DSD
RURE_PSEOL      NNITISLNTPIVSIDVGRKIVSSKDGKEYA-----YEKLILATPASARRLTCEGSELSGVCYLRSMEDAK
DLDH_RAT        --------------------------ADGSTQVIGTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
DLDH_MACFA      -------------------------------------NILIATGSE--VTPFPGTIDEDTIVSST---GA
TRXB_METJA      ----------------------------------------------------------------------
DLDH_BUCAP      -----------------------------------FKHAIIATGSKPKIPSLPNEDN------RIWNSTD
GSHR_KLULA      RDAYIHRLNEGVDYVYGWASFTVDGKADNCTETYTADHILVATGGKPIYPAIPGYDY-GV-------SSD
DLDH_PONAB      --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGIDEDTIVS----STGA
DLDH_HAEIN      -------------------TLVARDR-DGNPTTVKFDNAIIAAGSRPQLPFIPHEDPR-------IWDST
AHPF_PSEAE      -----HVRHYEVDINLQRASKLVPAKNAGELHEVRFESLILATGARWREMGVPG-EQE--YKAKGVCFCP
STHA_SHIB3      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ESCF3      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOUT      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOSM      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOSE      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOLU      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOLI      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOL6      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOL5      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOK1      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECODH      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOBW      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO8A      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO7I      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO5E      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO57      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO55      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO45      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECO27      ------------------------------------EKFVIACGSRPYHPTDVDFPHPRIY------DSD
STHA_ECO24      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOLC      ------------------------------------EKFIIACGSRPYHPTDVDFTHPRIY------DSD
STHA_ECOHS      ------------------------------------EKFIIACGSRPYHPTDVDFTHPRIY------DSD
TRXB_LISMO      ---------EVVD-GKEFKTVT----AGSKTYKARA--IIIATGAEHRKLGAAGEEERGV-SYCAVCDG-
STHA_ECO81      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSN
MERA_SERMA      -----------------------------------FDRCLVATGASPAMPPIPGLKESPYWT-----STE
GSHR_SCHPO      -------------------------------------YILIAVGGHPIWPSIPGAEY-GI-------DSD
DLDH_MYCGE      --------------------------------------IIVATGSRPRYLTLPGFEQQAGFII----DST
NIR_EMENI       -----------------------------------YDILVLATGSDAVLPTTPGHDAKGIFVYRTISDLE
AHPF_XANCH      --------------------------------------VILSTGARWRQMNVPGEDQ---YKNKGVAYCP
DLDH_VIBCH      ------------------------DGEEGKTVVT-FDNAIVAAGSRPKLPFIPHEDPRIWDSTDALE---
STHA_SHIFL      ------------------------------------EKFVIACGSRPYHPTDVDFTHPRIY------DSD
MDAR4_ARATH     KGIELILGTEIVKADLAAKTLV---SGTGQVF--KYQTLLAATGSRLSDFGVPGADAKNIFYLRELEDAD
AIFM2_HUMAN     -----------------------------------FSHLILATG---STGPFPGKFNEVSSQQAAIQAYE
YKGC_ECOLI      ----------------------------------------------------------------------
AIFM1_RAT       GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
GSHR_CANGA      ------------------------------------DRILVATGGKPVYPEVPGFE------LGTDSDGF
TRXR1_PONAB     ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
GSHR_YEAST      ------------------------------------NHILVATGGKAIFPEIPGFE------LGTDSDGF
GSHR_PLAFK      -------------------------------------NILIAVGNKPVFPPVKGIEN-------TISSDE
TYTR_LEIDO      ------------------------------------EYILIATGSWPTRLGVPGTSNEAFY----LEDAP
TRXB_CLOLI      FGA-ERVMDNIVDVDFTDKIKVL----KGAKGEYKAKAVIVATGASPKLAGCPGEKEKGVSYCATCDAD-
GSHR_PLAF7      -------------------------------------NILIAVGNKPVFPPVKGIEN-------TISSDE
GSHR_CAEEL      -------------VDKDKIVITGTDKNKTKNFLSA-PNVVISTGLRPKYPNIPGAE------LGITSDDL
AIFM2_MOUSE     -----------------------------------FSHLILATG---STGPFPGKFNEVSCQQAAIQAYE
AIFM1_MOUSE     GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
AHPF_PSEPU      --------------------------------------VILATGARWREMNVPG-EQE--YRGRGVAYCP
AHPF_PSEPK      --------------------------------------VILATGARWREMNVPG-EQE--YRGRGVAYCP
TRXR1_HUMAN     ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
HCAD_SHIF8      -----------------------------------WDQLFIATGXXXXXXXXXXXXGERCFTLHHAGDAA
DLDH_VIBPA      ---------------------------EGESTVVNFDNAIVAAGSRPKLPFIPHEDPRIWDSTDALE---
BAICD_EUBSP     ------------------------------------DNVIIAVGSTYALPEIPGIDSPSVYSQYQVLKGE
TRXR1_PIG       ------------------------------------EKFLIATGERPRYLGIPGDKE---YCISSDD---
TRXR1_MOUSE     ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
TRXB_LISIN      ---------EVID-GKEFKTVT----AGSKTYKARA--IIIATGAEHRKLGAAGEEERGV-SYCAVCDG-
DLDH2_BACSU     --------------------------------------VIIATGSRPRM--LPGLEVDGKSVLTS--DEA
TRXR1_BOVIN     ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
AIFM1_HUMAN     GGVAVLTGKKVVQLDVRDNMVKLNDGS-----QITYEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
AIFM1_DROME     -GIAVAQGFSVKKVDAQKRIVTLNDG-----YEISYDECLIATGCAPKNLPMPPSVLEKVMVYRTPDDFD
TRXR1_RAT       ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
DLDH_MANSE      -------------------------------------NILIATGSE--VTPFPGVDEKQIIT----STGA
TRXR1_DROME     ---------------------------------------VIAVGGRPRYPDIPGAVEYGI----TSDD--
TRXB_TREPA      --------------------------------------VILATGAEHRKMGIPGESERGVSYCATC-DGP
TRXB_EUBAC      FGA-EKVMDKIVDVDLDGKIKVI----KGEKAEYKAKSVILATGAAPRLAGCPGEQEKGVSYCATCDAD-
DHNA_ARATH      DRVKTLLPCDHLGVNGSEISVTGGTVLLESGFKIEYDWLVLALGAESKLDVVPGA-MELAFPFYTLEDAI
R34K_CLOPA      --------------------------------------LIIATGAKSRRLPIPEEEKLHGKVIHYCEDG-
DLDH_SCHPO      ------------------QTLSVKDGAADQTIKAK--NFIIATGSE--VKPFPGVTIDEKKIVSST--GA
DLDH_TRYBB      ---------------------------------------IIATGSEPTALPFLPFDEKVVLS----STGA
TRXB_CANGA      ------------------------------------DAIVIATGASAKRLHIPGEEQQGISACAVCDGAV
DLDH_TRYCR      ---------------------------------------IIATGSEPTLPFLPFDEKVVLSSTGAL----
TRXR_PLAF7      -------------------------------------YILIATGCRPHIPD----DVEGAKELSITSDDI
TRXR_PLAF5      -------------------------------------YILIATGCRPHIPD----DVEGAKELSITSDDI
TRXR3_HUMAN     ---------------------------------------VIATGERPRYLGIQGDKEYCI----TSDD--
DHNA_HAEIN      ----------------------------------------------------------------------
YUTJ_BACSU      -------------------------------FQDRYDDAIIGLGCEDKYHNVPGAP-EFTYSIQTIDQSR
TRXB_ASHGO      ------------------------------------DAIILATGASAKRLGLPGEEQRGISACAVCDGAV
TRXR3_MOUSE     ---------------------------------------VIATGERPRYLGIQGDKEYCI----TSDD--
FENR_FRAAA      ----------------------------------------------------------------------
TRXB_KLULA      ------------------------------------DAIILSTGASAKRLHLPGEEQQGISACAVCDGAV
FENR_IGNH4      ----------------------------------------------------------------------
TRXR1_CAEEL     ------------------------------------DRFLISTGLRPKYPEIPGVKE---YTI-TSDD--
TRXB_CHLMU      ---------DITSVDFSVRPFVL------KSGEDTFDACIIATGASAKRLSIPGAGQKGVTACAVCDGAS
PYRD1_PONAB     ----------------------------------------------------------------------
TRXB_CHLPN      ---------DIISVDFSVRPFILKSKEETYSC----DACIIATGASAKRLEIPGAGQKGVTACAVCDGAS
AIF1_YEAST      ----------------------------------KFDILVLATGSKWA-DPIGSTYTFGD---NYKEYFE
AHPF_ECOLI      --------------------------------------IIVATGAKWRNMNVPGEDQ---YRTKGVTYCP
PYRD1_HUMAN     ----------------------------------------------------------------------
GLTD_ECOLI      EKEVMTRRREIMGIEFKLNTEVGRDVQLDDLLSD-YDAVFLGVGTYQSMRGLENEDADGVYTKQLMGFGE
TRXR2_DROME     ------------------------------------EYVVVAVGGRPRYPDIPGAVELGI----TSDD--
TRXB_CHLTR      ---------DITAVDFSVRPFVLKSGKETFTC----DACIIATGASAKRLSIPGAGQKGVTACAVCDGAS
PYRD1_MOUSE     ----------------------------------------------------------------------
PYRD1_BOVIN     ----------------------------------------------------------------------
OOXA_AGRT4      --------------------------------------VVLATGAQERPMPVPGWTLPGVMTXXXXXXXX
FENR_NOCSJ      ----------------------------------------------------------------------
PYRD1_RAT       ----------------------------------------------------------------------
AHPF_STAAR      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
TRXB2_YEAST     ------------------------------------DAIILATGASAKRMHLPGEEQQGISACAVCDGAV
OOXA2_RHIME     ------------------------------------DAVVLATGAQERPMPVPGWTLQRVMTXXXXXXXX
FENR_SULSO      -------------------------------------------------------ENRGVYTVRRKKDFE
AHPF_STAAW      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
AHPF_STAAN      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
AHPF_STAAM      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
TRXB_BACSU      --------------------------------------VIIAAGAEYKKIGVPGEKELGGRGVSAVCDG-
DLDH_BUCBP      ----------------------------------------------------------------------
AHPF_STAAC      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
AHPF_STAA8      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
TRXB_STRCO      ----------------------------------------------------------------------
TRXB_MYCPU      ----------------------------------------------------------------------
FENR_LACAC      ----------------------------------------------------------------------
YUMB_BACSU      -GTLHHDRYQIKDVINQSRVNFVQDTVKAIKIDEKYDYLVIGLGAVPETFGIKGLKEANINTSRLLREHI
FENR1_BACP2     ----------------------------------------------------------------------
YGFK_ECO57      -----------------------------------FHYVLIATGTKNSGVKLAGDNQNVLKSLPFLREYN
TRXB_RICBR      ----------------------------------------------------------------------
TRXB1_YEAST     ------------------------------------DAIILATGASAKRMHLPGEEQKGISACAVCDGAV
TRMFO_DESDG     ----------------------------------------------------------------------
GLTD_RHOSH      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
FENR_SULTO      -------------------------------------------------------ENKGVYTVRRKKDFE
FENR_PROA2      ----------------------------------------------------------------------
FENR_LACH4      ----------------------------------------------------------------------
AHPF_STAAS      --------------------------------------VIIATGAGWRKLNIPGEEQKGVAFCPHCDG--
AHPF_SALTY      --------------------------------------IIIATGAKWRNMNVPGEDQ---YRTKGVTYCP
TRXB_STAAW      --------------------------------------VIIATGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_STAAS      --------------------------------------VIIATGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_STAAN      --------------------------------------VIIATGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_STAAM      --------------------------------------VIIATGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_STAAC      --------------------------------------VIIATGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_PENCH      ------------------------------------DAVIIATGANARRLNLPGEEQNGISACAVCDGAV
GLTD_AZOBR      ----------------------------------------------------------------------
FENR_FRASC      ----------------------------------------------------------------------
AHPF_STAES      ----------------------------------------------------------------------
AHPF_STAEQ      ----------------------------------------------------------------------
TRXB_STAAR      --------------------------------------VIIATGAEYKKIGVPGEQELGGRGVSAVCDG-
TRMFO_EXISA     ----------------------------------------------------------------------
IRC15_YEAST     -------------------------------------YIVVATGSAVIQCPGVAIDNDKIIS----SDKA
FENR1_SULAC     -------------------------------------------------------ENKGVYTVRRKRDFE
YGFK_ECOLI      -----------------------------------FHYVLIATGTKNSGVKLAGDNQNVWKSLPFLREYN
TRXB_RICPR      ----------------------------------------------------------------------
TRXB_HELPY      ---------------------------DGKTFEAK--SVIIATGGSPKRTGIKGESEKGVSTCATCDG--
TRXB_BORBU      ----------------------------------------------------------------------
FENR1_BACA2     ----------------------------------------------------------------------
TRXB_STAES      --------------------------------------VIISTGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_STAEQ      --------------------------------------VIISTGAEYKKIGVPGEQELGGRGVSAVCDG-
TRXB_HELPJ      ---------------------------DGKTFEAK--SVIIATGGSPKRTGIKGESEKGVSTCATCDG--
FENR_METS5      -------------------------------------------------------ENKGVYTVRR-----
FADB_ECOLU      ---------------------------------------------------------------------K
FADB_ECO7I      ---------------------------------------------------------------------K
OXLA_AGKRH      --------------------------------------------------PLAECFQENDYE-EFLEIAR
GLT1_SCHPO      ----------------------------------------------------------------------
FENR_CHLTE      DVVLNETVTKYTKLDFETRTNT------GNVYRSRAVLIAAGLGAEPRKLPQLGTGSSVYYAVKSVEDFK
BAIH_EUBSP      --------------------------------------VIVATGAKPLVPPIKGTQD---YPVLTAHDFL
RAX2_SCHPO      ----------------------------------------------------------------------
FENR_LACF3      -------------------------HSAKRTSTSKSIVIAMGNGASPRKLALPGAEELEGKQVRYFANHK
FENR_CHLCH      ----------------------------------------------------------------------
DHNA_BACYN      --------------------------------------VILSTGARWRNVGVPG-EQE--FKNKGVAYCP
TRXB_NEUCR      ------------------------------------DSIILATGASARRLHLPGEEQNGISACAVCDGAV
FENR_MAGSA      ----------------------------------------------PNRPPLDGLEQEGTYLVRKREDF-
FENR_CHLL2      ----------------------------------------------------------------------
FADB_ECO5E      ---------------------------------------------------------------------K
FADB_ECO57      ---------------------------------------------------------------------K
DHNA_BACSU      --------------------------------------VILSTGARWRNVNVPG-EQE--FKNKGVAYCP
TRXB_MYCGE      ----------------------------------------------------------------------
TRXB_DICDI      CGTTIETK-TISKVDLKQRPFTIYVEDE-EDKPIKAQSIIIATGATAKRMGVPGETEKGVSACAVCDG--
TRXB_COXBU      ------------------------------------DALIIATGASARYLGLPSEKAKGVSACATCDG--
TRMFO_BACCN     ----------------------------------------------------------------------
KMO_USTMA       ----------------------------------------------------------------TRKDTD
FENR_SYMTH      ----------------------------------------------------------------------
FENR_PROVI      ----------------------------------------------------------------------
FENR_CHLPD      EAVTRYSKLD--DGSFEITTTS------GSVYHSRAVLLAAGLGALPQLNAIDHLEGHSVYAVKNMQDFA
FENR_BRASB      ----------------------------GKVFECKV--VVIAAGGQPKRPPVPGIEAEGTYAVRKMEQF-
FENR2_CHLT3     ----------------------------------------------------------------------
DADA2_PSEAE     ----------------------------------------------------------------------
TRMFO_BACSU     ----------------------------------------------------------------------
STCD_RHIME      ----------------------------------------------------------------------
FIXC_SHIFL      ----------------------------------------------------------------------
FENR_ACIC1      ----------------------------------------------------------GVFTPRRLPVGQ
FENR2_SULAC     -------------------------------------------------------ENRGVYTVKRKKDFE
TRXB1_ARATH     QGTTIFTE-TVTKVDFSSKPFKLFTDSKAILA----DAVILATGAVAKRLSFVGSEASGGFWNRGISACA
FENR_SALAI      --------------------------AEKLTYVDGRPVLGLAGGEQLACGAVVITGGLGSFTPRPLPVAE
FENR1_BACSU     ------------------------------------------------------SEDAARYAGKNLHYGV
TRMFO_EXIS2     ----------------------------------------------------------------------
TRMFO_BACP2     ----------------------------------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
FIXC_ECOLI      ----------------------------------------------------------------------
FIXC_ECOL6      ----------------------------------------------------------------------
FIXC_ECO57      ----------------------------------------------------------------------
FENR_METPP      ----------------------------------------------------------------------
FENR2_BACP2     ----------------------------------------------------------------------
FADB_YERE8      ----------------------------------RAEALILETN---SFVPLAGSNEAGIFLNDQYVKGQ
TRXB_STRCL      ----------------------------------------------------------------------
TRXB_PNECA      ------------------------------------DVVILATGAYARRLNIPGEEQRGISACAVCDGAA
TRXB_MYCSM      ---------DAVQLEGPVKTVVVGDE----THQARA--VILAMGAAARHLGVPGEEAMGVSTCATCDG--
TRMFO_STAAW     ----------------------------------------------------------------------
TRMFO_STAAT     ----------------------------------------------------------------------
TRMFO_STAAS     ----------------------------------------------------------------------
TRMFO_STAAR     ----------------------------------------------------------------------
TRMFO_STAAN     ----------------------------------------------------------------------
TRMFO_STAAM     ----------------------------------------------------------------------
TRMFO_STAAE     ----------------------------------------------------------------------
TRMFO_STAAC     ----------------------------------------------------------------------
TRMFO_STAAB     ----------------------------------------------------------------------
TRMFO_STAA9     ----------------------------------------------------------------------
TRMFO_STAA8     ----------------------------------------------------------------------
TRMFO_STAA3     ----------------------------------------------------------------------
TRMFO_STAA2     ----------------------------------------------------------------------
TRMFO_STAA1     ----------------------------------------------------------------------
TRMFO_LYSSC     ----------------------------------------------------------------------
GSHR_DEBHA      ---------------------------------------LIATGGYAINPP----NVEG-HELGTTSDGF
FENR_THET8      ----------------------------------------------------------------------
FENR_THET2      ----------------------------------------------------------------------
FENR_PELLD      ----------------------------------------------------------------------
FENR_LACDB      ----------------------------------------------------------------------
FENR_LACDA      ----------------------------------------------------------------------
FENR_FLAPJ      ----------------------------------------------------------------------
FENR_CHLP8      ----------------------------------------------------------------------
FENR1_CHLT3     ----------------------------------------------------------------------
FADB_SHISS      ---------------------------------------------------------------------K
FADB_SHIFL      ---------------------------------------------------------------------K
FADB_SHIF8      ---------------------------------------------------------------------K
FADB_ECOLI      ---------------------------------------------------------------------K
FADB_ECODH      ---------------------------------------------------------------------K
FADB_ECOBW      ---------------------------------------------------------------------K
TRXB_RICTY      ----------------------------------------------------------------------
TRXB_RICCN      ----------------------------------------------------------------------
TRXB2_ARATH     QGTTIFTE-TVNKVDFSSKPFKLF--TDSRTVLA--DSVIISTGAVAKRLSFTGSEGNGGFWNRGISACA
TRMFO_STAES     ----------------------------------------------------------------------
TRMFO_STAEQ     ----------------------------------------------------------------------
TRMFO_LISIN     ----------------------------------------------------------------------
TRMFO_BACWK     ----------------------------------------------------------------------
TRMFO_BACHK     ----------------------------------------------------------------------
TRMFO_BACCZ     ----------------------------------------------------------------------
TRMFO_BACCR     ----------------------------------------------------------------------
TRMFO_BACCQ     ----------------------------------------------------------------------
TRMFO_BACC7     ----------------------------------------------------------------------
TRMFO_BACC4     ----------------------------------------------------------------------
TRMFO_BACC3     ----------------------------------------------------------------------
TRMFO_BACC2     ----------------------------------------------------------------------
TRMFO_BACC1     ----------------------------------------------------------------------
TRMFO_BACC0     ----------------------------------------------------------------------
TRMFO_BACAN     ----------------------------------------------------------------------
TRMFO_BACAH     ----------------------------------------------------------------------
TRMFO_BACAC     ----------------------------------------------------------------------
TRMFO_BACAA     ----------------------------------------------------------------------
OXLA_CROAT      -----------------------------------------------------------------LEIAK
OXLA_CROAD      -----------------------------------------------------------------LEIAK
MNMC_PSEU2      ----------------------------------------------------------------------
MNMC_PSE14      ----------------------------------------------------------------------
LNT_RHILO       ----------------------------------------------------------------------
FENR_NEOSM      ----------------------------------------------------------------------
FENR_CHLPB      ------------DGSFEVETLS------GRTFASRALLVAAGLGASPRKLPQLGSELEGHTVLYSVQNMK
FENR2_BACLD     ----------------------------------------------------------------------
FADB_SERP5      ---------------------------------------------------------------------K
Y1834_STAS1     ----------------------------------------------------------------------
TRXB_MYCPN      ----------------------------------------------------------------------
TRMFO_LISMF     ----------------------------------------------------------------------
PURT_DESVM      -----------VDFDYEITQLTVR-HAGGTTFCDPIGHLQKDGDYRESWQPHPMSQ--------------
OXLA_PSEAU      -----------------------------------------------------------------LEIAK
OXLA_BOTJR      -----------------------------------------------------------------LEIAK
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_PSEE4      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
CDR_PYRFU       AITEYMEKNKDVVIIGTGYIALEMAEAFVTRGKNVTLIGRSERVLRKFDKEITDIVEEKLRQH-LNLRLH
CDR_PYRAB       AIREYMEKNRDVVIVGGGYIGLEMAEAFVAQGKRVTMIVRGERILRRFDKEVTDIIEEKLKQH-VNLRLQ
CDR_PYRKO       AITEYLEKVENVVVIGTGYIAIEMAEAFVERGKNVTLIGRSERVLRKFDKEITDIVEEKLRNH-----LN
CDR_PYRHO       AIREYMEKYKVENVVXXXXXXXEMAEAFAAQGKNVTMIVRGERVLRRFDKEVTDILEEKLKKH-VNLRLQ
NAOX_METJA      AILKYIEECKKVAVVGAGAIGLEMAYGLKCRGLDVLVVEMAPQVLPRFDPDMAEIVQKYLEKEGIKVMLS
NAOX_STRP6      QFVKLYQNSKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAYYDRDLTDLMAKNMEEHGIQLAFG
CDR_STAES       TIDTFITKAQRALVVGAGYISLEVLENLHHRGLDVTWIHRSTNINKLMDQDMNQPIIDEIEKRNITYRFN
CDR_STAEQ       TIDTFITKAQRALVVGAGYISLEVLENLHHRGLDVTWIHRSTNINKLMDQDMNQPIIDEIEKRNITYRFN
CDR_STAAN       AIDQFIKQVDKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAAM       AIDQFIKQVDKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAA9       AIDQFIKQVDKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAA2       AIDQFIKQVDKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAA1       AIDQFIKQVDKVLVIGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAAW       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAAS       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAAB       QFIKA-NQVDKVLVVGAGYVSLEVLENLYKRGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
CDR_STAAR       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLN
NAPE_ENTFA      KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLVYLDKEFTDVLTEEMEANNITIATG
CDR_STAAC       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY---
NAOX_LACLM      AIDAAKEKVKRIAVIGAGYIGTEIAEAAKRRGKEVLLFDAENTSLAYYDEEFAKGMDENLAQHGIELHFG
CDR_STAA8       AIDQFIKQVDKVLVVGAGYVSLEVLENLNERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY---
CDR_STAHJ       AIDQFIDQAKKALVVGAGYISLEVLENLYARGLDVTLIHRSEKVNKLMDQDMNQVIFDELDSRHIPYRLN
CDR_STAAT       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY---
CDR_STAAE       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY---
CDR_STAA3       AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY---
NAOX_ENTFA      VIIEKAKDAKRXXXXXXXXXXXELVEAFVESGKQVTLVDGLDRILNKYDKPFTDVLEKELVDRGVNLALG
CDR_STAS1       AIETFIKQVKNALVVGTGYIGLEILDNLYERGISPTLIHRSTHINKLMDQDMNQAILDEMDKRDIHYRFN
NAOX_MYCPN      RHDKSI---KSVAIVGSGYIGLELAEAAWQCGKQVTVIDMLDKPANNFDEEFTNELEKAMKKAGINLMMG
NAOX_MYCGE      HALTLIDSFRKVAIVGSGYIGLELAEAAWLCKKQVTVIDLLDKPAGNFDHEFTDELEKVMQKDGLKLMMG
THCD_RHOER      XXXXXXXXXXXLVVIGAGFIGLEVAAAARKKGLDVTVVEAMDRPMARLSSVMSGYFSTAHTEHGVHMRLS
MERA_STAES      --LKEVPQ--RLAVIGSGYIAAELGQMFHNLGTEVTLMQRSERLFKTYDPEISEAIDESLTEQGLNLITG
MERA_STAAU      --LKEVPQ--RLAVIGSGYIAAELGQMFHNLGTEVTLMQRSERLFKTYDPEISEAIDESLTEQGLNLITG
TODA_PSEP1      VLRDSWTSATRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVRLGRRIGAWLRGLLTELGVQVELG
MERA_ENTAG      EALASDTIPERLAVIGSSVVALELAQAFARLGSKVTAL-ARNTLFFREDPAIGEAVTAAFRAEGIEVLEH
BEDA_PSEPU      LLRDSWTPNTRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVRLGRRIGAWLRGLLTEQGVQVELK
CAMA_PSEPU      CIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERTAPPVSAFYEHLHREAGVDIRTG
AIFM3_MOUSE     RVLR-LARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGEVGRALMKMFENNRVKFYMQ
MERA_THIFE      GLVESIPE--RLAVIGSSVVALELAQAFARLGSHVTIL-ARGTLFLREDPAIGEAITAAFRAEGIEVLEH
MERA_SHIFL      TIPK------RLAVIGSSVVALELAQAFARLGAKVTIL-ARSTLFFREDPAIGEAVTAAFRMEGIEVREH
MERA_PSEFL      ALVSDTIPA-RLAVIGSSVVALELAQAFARLGSQVTIL-ARSTLFFREDPAIGEAVTAAFRAEGIEVLEH
MERA_SHEPU      EALFAQELPQHLVVIGSSVVALEIAQAYRRLGSEVTIL-ARHTLLYREDPLLGEKLTGCFEKEGIRVLNS
MERA_BACCE      --LKKVPN--RLTVIGSGYIGMELGQLFHNLGSEVTLIQRSERLLKEYDPEISEAITKALTEQGINLVTG
DLDH_CHLMU      LNLKEIPQ--KMAIIGGGVIGCEFASLFHTLGSEVSVIEASQQILALNNPDISKTMFDKFTRHGIRFMLG
MERA_PSEAE      EALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVL-ARNTLFFREDPAIGEAVTAAFRAEGIEVLEH
GSHRP_SPIOL     LSLEEFP--KRVVILGGGYISVEFASIWRGMGADVNLCFRKELPLRGFDDEMRAAVARNLEGRGVNVHPR
BPHG_BURXL      ALRQALQPGQSLVIVGGGLIGCEVATTARKLSVHVTILEAGDRVLGH---RTGAWCRAELERMGVRVERN
TODA_PSEPU      VLRDSWTSATRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVRLGRRIGAWLRGLLTELGVQVELG
BNZD_PSEPU      VLRDSWTSATRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVRLGRRIGAWLRGLLTELGVQVELG
DLDH_HALVO      --LEADTVPERLVVVGGGYIGMELSTTFAKLGADVTVVEMLDDILPGYESDVARVVRKRAEELGIDMHLG
NORW_ECO5E      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECO57      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOLI      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOLC      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECODH      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOBW      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NASD_BACSU      TMLAASKQYKKXXXXXXXXXXXXXXXXXXXXXMDVSVIHLMERQL---DATAGRLLQNELEKQGMTFLLE
DLDH_THESC      RALRVIP--KRLLVIGGGAVGLELGQIYHRLGSEVTLIEYMPEILPAGDRETAALLRKALEKEGLKVRTG
NORW_SHIB3      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_SHIBS      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVYLLLK
NORW_ECOSE      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
GSHRC_ARATH     LSLEEFP--KRAIVLGGGYIAVEFASIWRGMGATVDLFFRKELPLRGFDDEMRALVARNLEGRGVNLHPQ
DLDH1_PSEPU     LAPKALPQ--HLVVVGGGYIGLELGIAYRKLGAQVSVVEARERILPTYDSELTAPVAESLKKLGIALHLG
NORW_ECOL5      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOHS      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECO8A      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECO55      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
GSHRC_BRARP     LSLEEFP--KRAIVLGGGYIAVEFASIWRGMGATVDLFFRKELPLRGFDDEMRALVARNLEGRGINLHPQ
DLDH_CHLPN      LELEVLP--KKLAIIGGGVIGCEFASLFHTLGVEITVIEALDHILAVNNKEVSQTVTNKFTKQGIRILTK
RURE_ACIAD      AFRENLAQDKRVVILGAGLIGCEFANDLQHTGHQVTVIDLSPRPLGRLLPHIADAFQKNLEESGIHFVLS
NORW_ECO27      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOUT      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOSM      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOK1      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECO45      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECO24      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_SHISS      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ESCF3      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_SHIDS      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKMVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_ECOL6      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASLMPEVSSRLQHRLTEMGVHLLLK
NORW_SHIFL      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_SHIF8      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_KLEP7      AAQSQLHDAKRVLIVGGGLIGCELAMDFCRAGKAVTVVDNSASVLAAMPPEASSRLQHRLTEMGVHLMLK
NORW_ECOLU      ACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
NORW_VIBFM      AIQQKILDAKNILVIGGGLIGTELAMDLANAGKMVTLVEPNSHLLANMMPDFISLLENACKEKGVTVNLS
NORW_SALA4      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
NORW_KLEP3      AAQSQLHDAKRVLIVGGGLIGCELAMDFCRAGKAVTVVDNSASVLAAMPPEASSRLQHRLTEMGVHLMLK
GSHRC_PEA       LSLEEFP--KRAVILGGGYIAVEFASIWRGMGSSVNLVFRKELPLRGFDDEMRAVVARNLEGRGINLHPR
NORW_SALTY      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
DLDH1_PSEAE     ----SLP--KRLVVVGGGYIGLELGTAYRKLGVEVAVVEAQPRILPGYDEELTKPVAQALRRLGVELYLG
MERA_STRLI      --LQQLPE--HLLILGGGYVGLEQAQLFARLGSRVT-LAVRSRLASREEPEISAGIENIFREEGITVHTR
DLDH3_HALMA     LNFDTVPD--ELVIVGAGYIGMELATVYSRLGSDVSVIEMLEQALPSYEEDIASIVRKRAERLGVDFHFG
NORW_CITK8      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASMPPEVSSRLQHRLTDMGVHLLLK
NORW_SALHS      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
NORW_SALEP      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
NORW_ERWCT      THEARLWQAERVLVLGAGLIGTELAMDLSRAGKRVTLVDCASSILPAMPPEVSARLQFTLTQQGVSLLLN
GSHRC_ORYSJ     LSLEELP--KRAVILGGGYIAVEFASIWKGMGAHVDLFYRKELPLRGFDDEMRTVVASNLEGRGIRLHPG
DLDH1_BACSU     LALKEIP--KKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGVEIHTN
NORW_SALSV      ACETQLRDAQRVMIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
MDAR2_ARATH     RLATVIQSSSNAVVIGGGYIGMECAASLVINKINVTMVFPEAHCMARFTPKIASLYEDYYRAKGVKFIKG
DLDH_CHLTE      LILKEVPKSM--IVVGGGAIGVEMAWFYAKAGSKVTIVELMPRMLPAEEAEVSEALKRSFEKAGITVHCG
YDGE_SCHPO      KLAAVTTEAKNIVIIGSSFIGLELAVVLKDHNVSVIGMES----IPFMGKEVGTALKALHEQNGIAFYLE
NORW_SALTI      ACETPLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
STHA_MARAV      SILNLSHTPRTLIIYGAGVIGSEYASIFAGLGVKVDLINPGSRLLSFLDDEISDALSYHLRNNGVLVRHN
MERA_ACICA      ALVSTLPE--RLAVIGSSVVALELAQAFARLGSQVTIL-ARNTLFFRDDPAIGEAVTAAFRAEGIKVLEH
DLDH_STAAW      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
DLDH_STAAU      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
DLDH_STAAS      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
DLDH_STAAR      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
DLDH_STAAN      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
DLDH_STAAM      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
DLDH_STAAC      LNLQEVPG--KLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTE
GSHR_BURCE      DLPVGPP---RIAIIGGGYIACEFAGIFNGLGRHVVQLHRGSQVLRGFDDELREHLGDELKKSGIDLRLG
DLDH_RHOCA      LSLAKVPKSM--VVIGAGVIGLELGSVYARLGAEVTVVEYLDAITPGMDAEVAKGLQRILTRQGLKFVLG
NORW_SALG2      ACETQLRDAQRVLIVGGGLIGSELAMDLCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
DLDH_MYCTU      ILSRELPKSXXXXXXXXXX--MEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTA
DLDH_MYCBO      ILSRELPKSXXXXXXXXXX--MEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTA
STHA_PSEAE      TILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSFLDDEISDALSYHLRNNNVLIRHN
STHA_PSEAB      TILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSFLDDEISDALSYHLRNNNVLIRHN
STHA_PSEA8      TILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSFLDDEISDALSYHLRNNNVLIRHN
DLDH_CHLTR      LNLKEIPQ--KMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLE
STHA_PSEA7      TILSLSHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDTRDQLLSFLDDEISDALSYHLRNNNVLIRHN
GSHR_ECOLI      FALPALPE--RVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTN
DLDH2_HALMA     LALESVPE--KLLVVGAGYIGMELSTVFAKLGAEVTVVEMLDDVLPGYEDDIATVVRDRAEELGIDFNFG
GSHR_HAEIN      FALTELP--KRAAVIGAGYIAVELSGVLNSLGVETHLLVRRHAPMRNQDPLIVETLVEVLAQDGIQLHTN
DLDH_CHLP8      LILKDVPESM--IVVGGGAIGVEMAWFYAKAGAKVTIVELMPRLLPAEEAEVSEALKRSFEKVDITVQCG
NORW_SALAR      ACETQLRAAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHRLTDMGVHXXXX
MERA_ALCSP      ALVSTIPE--RLAVIGSSVVALELAQAFARLGSKVTIL-ARSTLFFREDPAIGEAVTAAFRAEGIKVLEY
MDAR_PEA        KLYEAIKRKKNAVVVGGGYIGLELSAVLKLNDLDVTMVYPEPWCMPRFTSEIAAFYEGYYANKGINIIKG
NASB_BACSU      ALMNMAQHFQKXXXXXXXXXXXXXXXXXQHLGMDVSVIHHSAGIMKQLDQTAARLLQTELEQKGLTFLLE
DLDH2_PSEPU     --FQAVP--KRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMAADTAVSKEAQKTLTKQGLDIKLG
STHA_MYCTU      LDLKSLPSSM--VVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFG
STHA_MYCTA      LDLKSLPSSM--VVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFG
STHA_MYCBT      LDLKSLPSSM--VVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFG
STHA_MYCBP      LDLKSLPSSM--VVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFG
STHA_MYCBO      LDLKSLPSSM--VVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFG
NORW_VIBVU      AAEQPLSRAQHXXXXXXXXXXXXXXXDLATSGKQVTVVEPNARLLANLLPEFIALLEQQLMKHGIQLALN
GSHR_ASHGO      GFFRLEEQPKKVVISGSGYIATEFAGVFNGLGTETHIVIRKDHVLTKFDPSIQEIVTEHYEKEGVNIHSI
DLDH2_PSEAE     --FQAVP--KKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLG
STHA_PSEFS      TILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSFLDSEISQALSYHFSNNNITVRHN
DLDH_PEA        LALSEIP--KKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLK
STHA_PSEPK      TILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
STHA_PSEPG      TILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
STHA_PSEP1      TILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
GSHRP_TOBAC     AALDLPTKPNKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRGFDEEIRDFVGEQMSLRGIEFHTE
DLDH_PSEFL      --FQAVP--KKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLG
STHA_PSEPW      TILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
DLDH_HALSA      QALAMAELPSSMVIVGGGYIGMELSTVFAKLGVDVTVVEMLDGILPQYGDDIARPVRQRAEELGIDFHFG
STHA_PSEFL      TILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSFLDSEISQALSYHFSNNNITVRHN
STHA_PSEE4      TILSLSHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
NORW_VIBVY      AAEQPLSRAQHXXXXXXXXXXXXXXXDLATSGKQVTVVEPNARLLANLLPEFIALLEQQLMKHGIQLALN
NORW_ECO81      ACETQLRDARRVXXXXXXXXXSELAMDFCRAGKMVTLIDNAASILASMPPEVSSRLQHRLTEMGVHLLLK
GSHRP_ARATH     AALDLPSKPKKIAIVGGGYIALEFAGIFNGLNCEVHVFIRQKKVLRGFDEDVRDFVGEQMSLRGIEFHTE
DLDH_ACHLA      ELLNVKNYPKSXXXXXXXXXXXEFATVFNSFGSKVTIIEMMDGILPTMDDDIRVAYAKTLKRDGIEILTK
DLDH1_BACST     LNLGEVPKS--LVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTN
STHA_PSEPF      TILSLGHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
MDARS_CUCSA     QLVEAIKAKENXXXXXXXYIGLELGAALRINNFDVSMVYPEPWCMPRFTPEIAAFYEGYYAQKGITIIKG
STHA_PSEU5      TILTLSHTPRRMIIYGAGVIGCEYASIFSGLGVLVDLIDNREQLLSFLDDEISDALSYHLRNNNVLIRHN
GSHRP_SOYBN     AALDLPTKPVKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRGFDEEIRDFVEEQMSVRGIEFHTE
STHA_CHRSD      -ILGLSHTPRTLIIFGAGVIGSEYASIFSGLGVKVDLIDMRERLLSFLDDEISDALSYHLRQNGVLVRHN
STHA_AZOVI      TILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSFLDDEISDSLSYHLRNNNVLIRHN
STHA_AZOVD      TILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSFLDDEISDSLSYHLRNNNVLIRHN
NORW_ENT38      ACETRLRDAQRVMIVGGGLIGTELAMDFCRAGKSVTLVDHAARILSALMPEVSSRLQHRLTDMGVHXXXX
NORW_ECO7I      ACETQLRDARRXXXXXXXXXXXELAMDFCRAGKAVTLIDNAASILASMLPEVSSRLQHRLTEMGVHLLLK
STHA_PSEF5      TILSLGHTPRKLIVYGAGVIGCEYASIFSGLGVLVELVDNRGQLLSFLDSEISQALSYHFSNNNITVRHN
STHA_PSESM      TILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSFLDSEISQALSYHFSNNNVMVRHN
STHA_PSE14      TILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSFLDSEISQALSYHFSNNNVMVRHN
GSHR_ANASP      -IFHLKTQPKHIAIIGSGYIGTEFAGIMRGLGSQVTQITRGDKILKGFDEDIRTEIQEGMTNHGIRIIPK
STHA_PSEU2      TILSLGHTPRKLIIYGAGVIGCEYASIFSGLGVLVELVDNRDQLLSFLDSEISQALSYHFSNNNVMVRHN
NIRB_KLEOX      QXXXXXXXXXXXXXXXXXXXXXXXXXXXKQLGLETHVVEAPNLMAVQLDNGGAAMLREKISELGVGVHTS
GSHR_PSEAE      FFLERLP--RRVLVVGGGYIAVEFASIFNGLGAETTLLYRRDLFLRGFDRSVREHLRDELGKKGLDLQFN
GSHR_HUMAN      FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
DLDH_AZOVI      GALDFQNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPAVDEQVAKEAQKILTKQGLKILLG
STHA_PSEMY      TILSLGHTPRRLIIYGAGVIGCEYASIFSGLGVLVDLIDNRDQLLSFLDSEISDALSYHLRNNNVLIRHN
STHA_HAHCH      SILKLSHTPRTLIIYGAGVIGCEYASIFVGLGVKVDLINPGERLLSFLDGEISDALSYHLRDNGVLVRHN
HCAD_ECOLU      RLREVLQPERSVVIVGAGTIGLELAASATQRGCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
GSHR_MOUSE      FQLEDLPS--RSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRNFDSLISSNCTEELENAGVEVFTQ
GSHR_CALJA      FELEELPS--RSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
TYTR_TRYBB      AFYLPEPP-RRVLTVGGGFISVEFANAYKPPGGKVTLCYRNNLILRGFDETIREEVTKQLTANGIEIMTN
NORW_SALPB      ACETQLRDAQRVXXXXXXXXXSELAMDFCRAGKTVTLMDNAASLLASMPPEVSSRLQHHLTDMGVHXXXX
DLDH_BUCAI      ALLKKIPN--NFLIIGSGIIGLEMATIYSALGSKVDIIDRFNHFLPVIDEDISSIYKKSIQQFNLMLNTH
DLDH3_PSEAE     GALELVEVPRHLVVIGAGVIGLELGSVWRRLGAQVTVLEYLERICPGLDGETARTLQRALTRQGMRFRLG
MDAR3_ARATH     KLVEAIXXXXXXXXXXXXYIGLELSAVLRINNLDVTMVFPEPWCMPRFTADIAAFYETYYTNKGVKIIKG
NORW_SALPK      ACETPLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
NORW_SALPA      ACETPLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
NORW_VIBF1      GIQQXXXXXXXXXXXXXXXIGTELAMDLANAGKMVTLVEPNTHLLANMVPDFISLLEKACKEKGITVNLS
STHA_PROMH      H------EPRHVIIYGAGVIGCEYASIFRGLRVKVDLINTRDHLLSFLDQEMSDALSYHFWNNGIVIRHN
NORW_SALNS      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
NORW_SALDC      ACETQLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
MDAR1_ARATH     ELALAMEQRGKAVIIGGGFLGLEISSALRANNHEVTMV-FPEPWLVHFTAEIASFYESYYANKGIKIIKG
NIRB_ECOLI      AIESCARRSKRXXXXXXXXXXXXXXXXXKNLGIETHVIEAPMLMAEQLDQMGGEQLRRKIESMGVRVHTS
GSHR_STRTR      FELDEVP--KRTAVIGAGYIAVEVAGVLNALGSDTHLFVRKDRPLRTFDKDIIDVLVDEMAKSGPTLHMH
GSHR_DICDI      FELEDLPKS--TLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRTFDEMLHTTLLKQMTDDGVKFVTE
NORW_SALPC      ACEIPLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
NORW_SALCH      ACEIPLRDAQRVLIVGGGLIGSELAMDFCRAGKTVTLMDAASLLASLMPPEVSSRLQHHLTDMGVHXXXX
STHA_YERE8      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_VIBVY      SILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAFLDNEVSDALSYHFWNSGVVIRND
STHA_VIBVU      SILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAFLDNEVSDALSYHFWNSGVVIRND
DLDH_SHIFL      --LKEVPE--RLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKK-FNLMLE
DLDH_ECOLI      --LKEVPE--RLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKK-FNLMLE
DLDH_ECOL6      --LKEVPE--RLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKK-FNLMLE
DLDH_ECO57      --LKEVPE--RLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKK-FNLMLE
AIFM3_HUMAN     XXXXXXXXXXXXXXXXX-FLGMEVAAYLTEKAHSVSVVELEETPFRRFLGEVGRALMKMFENNRVKFYMQ
STHA_SERP5      SILELNHEPRHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLDQEMSDSLSYHFWNNGVVIRHN
NORW_AERS4      AAEGPIQQARRILVLGAGLIGCELAMDMASDGREVTXXXXXXXXXXXXXXXXXXXXXXXXXRS-----QG
HCAD_ECO5E      RLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECO57      RLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
DLDH_SYNY3      VKLETLPQW--IAIIGSGYIGLEFSDVYTALGCEVTMIEALPDLMPGFDPEIAKIAERVLKSRDIETYTG
HCAD_ECOSM      RLREVLQPERSVVIVGAGTIGLELAASATQRGCKVTVIELAATVMRNAPPPVQHYLLQRHQQAGVRILLN
STHA_YERPY      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPS      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPP      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPN      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPG      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPE      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPB      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERPA      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_YERP3      TILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_PHOPR      SILQLEHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLINTRHRLLEFLDNEISDSLSYHLWNSGAMIRNG
MDAR_SOLLC      QLVEXXXXXXXXXXXXXXYIGLELSAVLRLNNIEVNMVYPEPWCMPRLFTEIAAFYEGYYKNKGVNIIKG
GSHR_RAT        FQLEDLPS--RSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRSFDSLISSNCTEELENAG-----G
STHA_VIBSL      SILSLKHDPQHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLSFLDNETSDALSYHFWNSGVVIRND
HCAD_ECOLI      RLREVLQPERSVVIIGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECOLC      RLREVLQPERSVVIIGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECOHS      RLREVLQPERSVVIIGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECODH      RLREVLQPERSVVIIGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECOBW      RLREVLQPERSVVIIGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECO7I      RLREVLQPERSVVIVGAGTIGLELAASATQRGCKATVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECO24      RLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIEGRNAPLP-----VQRYLLQRHQQAGVRILLN
GSHRP_PEA       AALDLPSKPQKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRGFDEEIRDFVAENMALRGIEFHTE
STHA_VIBF1      SILSLKHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLVNTRDRLLSFLDNEMSDALSYHFWNSGIVTRND
HCAD_ECOSE      RLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
HCAD_ECO55      RLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
DLDH_MYCLE      QILRELPDSXXXXXXXXXXX--EFGYVLKNYGVDVTIVEFLPRAMPNEDAEVSKEIEKQFKKMGIKILTG
TERPA_PSESP     RIRQQLGEASRIVVLGGGFIGLEIASSACKMGKHVTVIERAPRLLSRVVSEAFATFIGDIHGNGIXXXXX
MDARP_ARATH     SLIASLXXXXXXXXXXXXXXXMEVAAAAVAWNLDTTIVFPEDQLLQRFTPSLAQKYEELYRQNGVKFVKG
DLDH2_ARATH     LSLTEIP--KKLIVIGAGYIGLEMGSVWGRLGSEVTVVEFAADIVPAMDGEIRKQFQRSLEKQKMKFMLK
TYTR_TRYCO      AFYLEEPP-RRVLTVGGGFISVEFANAYKPVGGKVTLCYRNNPILRGFDYTLRQELTKQLVANGIDIMTN
STHA_PHOLL      SILKLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRNHLLAFLDQEMSDALSYHFWNSGIVIRHN
DLDH_ZYMMO      HALKPPAMPKKLLVIGSGAIGIEFASFYADFGAEVSIVEHAPQILPMEDAEVSAYVAKAFKKRGIRILTG
DLDH1_ARATH     LSLSEVP--KKLIVIGAGYIGLEMGSVWGRLGSEVTVVEFAGDIVPSMDGEIRKQFQRSLEKQKMKFMLK
DLDH_RHIET      ----------------------EFASFYRSMGVDVTVVEVMPTIMPVEDAEITAIARKQLEKRGLKIFTS
STHA_VIBPA      SILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLEFLDNEVSDALSYHFWNSGVVIRND
HCAD_SHISS      RLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
GSHR_NEUCR      FDIDTLP--KKVALVGAGYIAVEFAGMLNALGVETHLFIRHDTFLRSFDPMIQQVSVKEYERIGVKVLTS
DLDH3_PSEPU     AL--SLPQVKHLVVIGAGVIGLELGSVWRRLGSQVTVIEYLDRICPGTDTETAKTLQKALAKQGMVFKLG
TRXR2_BOVIN     FWLKESPG--KTLVVGASYVALECAXXXXXXXXXXXVM-IRSVPLRAFDQQMASLVTEHMAGHGTRILRG
STHA_HAMD5      LELKEEQQPKHIIIYGAGVIGCEYASIFRGLGVKVDLINTRNHLLAFLDQEISDALSYHFWNNGVVIRHN
STHA_ERWCT      SILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHN
STHA_COLP3      SILSLKHAPQHVIIYGAGVIGSEYASIFRGLGVKVDLINTRERLLSFLDTEMSDSLSYHLWNSGVVIRHG
TRXR2_RAT       FWLKESP--GKTLVVGASYVALECAGFLTGIGLDTTVM-MRSVPLRGFDQQMASLVTEHMESHGTRFLKG
HCAD_PHOLL      RLRQAVKKDKRXXXXXXXXXXXELAATSCELGANVTVIEQADNIMGRCAPPL--LQDYLLNRHGVQFFLD
TYTR_CRIFA      --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
DLDH_RALEH      GALKFPAVPKKLGVIGAGVIGLELGSVWRRLGSDVTVLEALPAFLGAADEGVAKEAQKQLTKQGLKFSLG
TRXR2_MOUSE     FWLKESP--GKTLVVGASYVALECAGFLTGIGLDTTVM-MRSIPLRGFDQQMSSLVTEHMESHGTQFLKG
TRXR2_HUMAN     FWLKESP--GKTLVVGASYVALECAGFLTGIGLDTTIM-MRSIPLRGFDQQMSSMVIEHMASHGTRFLRG
STHA_VIBCM      SILNLEHDPRHIIIYGAGVIGCEYASIFRGLDVKTDLINTRDRLLSFLDNEVSDALSYHFWNSGVVIRND
STHA_VIBCH      SILNLEHDPRHIIIYGAGVIGCEYASIFRGLDVKTDLINTRDRLLSFLDNEVSDALSYHFWNSGVVIRND
STHA_VIBC3      SILNLEHDPRHIIIYGAGVIGCEYASIFRGLDVKTDLINTRDRLLSFLDNEVSDALSYHFWNSGVVIRND
STHA_KLEP7      SILSLQHEPRHVIIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_KLEP3      SILSLQHEPRHVIIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
NORW_AERHH      AVEGAIQQARRILVLGAGLIGCELAMDMASDGREVXXXXXXXXXXXXXXXXXXXXXXXXXXRS-----QG
DLDH_MOUSE      LSLKKVPE--KLVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQRQGFKFKLN
AIFM1_DICDI     KLYEVVKDGKHVTVLGGGFLGSELTCAFQDKNIKIDQIFPESGVLSTLFPDLSKYATEEIIKSGVNVHTG
XECC_XANP2      --LDYEPGSTXXXXXXSK-TAVEYGCFFNATGRRTVMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISG
GSHR_YARLI      -------QPKRVAVVGGGYIGVELAGVFHGLNSETTLFCRGQTVLRAFDIMIQDTITDYYVKEGINVGSG
DLDH_MYCPN      QALSLEGVPRKLXXXXXXXXXXEFAFLYASLGSEVTILQGVDRILEIFDTEVSDLVAKLLQTKNVKIITN
TYTR_TRYCR      AFYLPEPP-RRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTK
STHA_SODGM      SILDLKHDPHHVIIYGAGVIGCEYASIFRGMNVKVDLINTRDRLLAFLDQEMSDALSYHFWENGVVIRHN
STHA_ERWT9      SILNLHHEPGHVIIYGAGVIGCEYASIFRGLAVKVDLINTRDRLLAFLDQEMSDSLSYHFWNNGVVIRHN
DLDH3_BACSU     ----------------------EYAGLFARLGSQVTIIETADRLIPAEDEDIARLFQEKLEEDGVEVHTS
STHA_SALPC      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALCH      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_MARMS      -ILSLSHTPRSLIIYGAGVIGCEYASIFCGLGVRVELINPAKKLLSFLDDEITDALSYHLRDGGVLIRHN
NORW_SERP5      DSQLTLLQAQRVXXXXXXXXXCELAMDMCRAGKQVTLVDRSGSLLSGLMPEASCRLQHALQQMGVELLLN
DLDH_PIG        LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEL----LGHVDMEVSKNFQRILQKQGFKFKLN
DLDH_CRIGR      LSLKKVPE--KLVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
STHA_SALTY      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALTI      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALPK      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALPB      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALPA      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALG2      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_SALEP      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ENT38      SILSLHHEPRHVLIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
DLDH_HUMAN      LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
DLDH_CANFA      LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
STHA_CITK8      SILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
RURE_PSEOL      NLRRKLXXXXXXXXXXXXXXXXXXXSAAVGLGKRVTVIEATPRVMARVTPAAANLVRARLEAEGIEFKLN
DLDH_RAT        LSLKKVPE--KLVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
DLDH_MACFA      LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
TRXB_METJA      ------------------------------------------------------MLDKLKEANNVEIIYN
DLDH_BUCAP      ALLKSIPN--RFLXXXXXXXXLEMATIYSALGSKVDIVDRFNAFLPSVDKDITDIIKSIKKRFKLLLNTH
GSHR_KLULA      EFFELEDQPKKVVVVGAGYIGVEIAGVFNGLGSDSHLVIRGETVLRKFDDCIQETVTDTYIKEGVNIHKS
DLDH_PONAB      LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
DLDH_HAEIN      DALKLKEVPKKXXXXXXXXXXXXXXTVYNALGSEVEVVEMFDQVIPAADKDVVGIYTKQVEKK-FKLMLE
AHPF_PSEAE      HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKL------RADAVLQRKLSLPNVEVITS
STHA_SHIB3      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ESCF3      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOUT      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOSM      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOSE      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOLU      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOLI      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOL6      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOL5      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOK1      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECODH      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOBW      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO8A      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO7I      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO5E      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO57      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO55      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO45      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO27      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECO24      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOLC      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
STHA_ECOHS      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
TRXB_LISMO      ----AFFKNRELIVVGGGDSAVEEGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDF----IWNS
STHA_ECO81      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
MERA_SERMA      ALVSTIPE--RLAVIGSSVVALELAQAFARLGSQVTIL-ARNTLFFRDDPSIGEAVTAAFRAEGIKV---
GSHR_SCHPO      GFFELESQPKRVAIVGAGYIAVELAGVFAALGTETHMFIRQSKFLRKFDPIISDGIMDHFQHIGINVHTN
DLDH_MYCGE      QALALEGVPKKFXXXXXXXXXXEFAFLFASLGSEVTIIQGVDRILEVCDSDVSELISKTLKNKGVQIITN
NIR_EMENI       RLMEANHKGQXXXXXXXXXXXXEAAKAMTEDFGSVKLIDRNKWVLARQDGDAGSLVTKKIRDLGLEVLHE
AHPF_XANCH      HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKL------RADEVLQRKLRSHNVRIITS
DLDH_VIBCH      --LKEVPXXXXXXXXXXXXX--EMATVYHSLGSKIDVVEMFDQLIPAADKDVKVYTKRIKDKFNLMLETK
STHA_SHIFL      SILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHN
MDAR4_ARATH     YLAYAMEEKGKAXXXXXXYIGLELGAALKANNLDVTMVYPEPWCMPRFTAGIASFYEGYYANKGINIVKG
AIFM2_HUMAN     DMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEEKEVTLIHSQDKELL---PSVRQEVKEILLRKGVQLLLS
YKGC_ECOLI      ---------------------VEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILN
AIFM1_RAT       ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPELSNWTMEKVKREGVKVMPN
GSHR_CANGA      FRLEEQP--KKVVVVGAGYIGIELAGVFHGLGSDSHLVIRGKTVLRKFDEIIQNTVTDYYVEEGINVHTN
TRXR1_PONAB     --LFSLPYCPKTLIVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
GSHR_YEAST      FRLEEQP--KKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECIQNTITDHYVKEGINVHKI
GSHR_PLAFK      FF--NIKESKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTF
TYTR_LEIDO      K---------RMLCVGGGYIAVEFAGIFKPCGGYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTN
TRXB_CLOLI      -----FFEDMEVFVIGGGDTAVEEAMFLTKFARKVTIVHRRAELRAAKSIQEKAFKNEKLNF----MWNT
GSHR_PLAF7      FF--NIKESKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTF
GSHR_CAEEL      FTLASVP--GKTLIVGGGYVALECAGFLSAFNQNVEVL-VRSIPLKGFDRDCVHFVMEHLKTTGXXXXXX
AIFM2_MOUSE     DMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEEKEVTLIHSR-VPLADKEPCVRQEVKEILLRKGVQLLLS
AIFM1_MOUSE     ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
AHPF_PSEPU      HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAQVTLIERKLRSLPNVNVITSALTTEVLGN-------G
AHPF_PSEPK      HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAQVTLIERKLRSLPNVNVITSALTTEVLGN-------G
TRXR1_HUMAN     --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
HCAD_SHIF8      RLREVLQPERSVVIVGAGTIGLEXXXXXXXXXCKVTVIELAATVMRNAPPPVQRYLLQRHQQAGVRILLN
DLDH_VIBPA      --LKEVPE--KXXXXXXXXXXXXXXTVYHSLGSKVEVVEMFDQVIPAADKDIVKVYTKRIDKFKLMLETK
BAICD_EUBSP     -----VNPTGRVAVIGCGLVGTEVAELLASRGAQVIAIERKG---------VGTFMNPEFKYYKIAKMSG
TRXR1_PIG       --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
TRXR1_MOUSE     --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
TRXB_LISIN      ----AFFKNRELVVVGGGDSAVEEGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDF----IWNN
DLDH2_BACSU     LQMEELPQSXXXXXXXXXXX--EWASMLHDFGVKVTVIEYADRILPTEDLEISKEMESLLKKKGIQFITG
TRXR1_BOVIN     --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMQEHGIKFFVP
AIFM1_HUMAN     SLEKISREVKSITIIGGGFLGSELACALGRKGTEVIQLFPEKGNMGKILPELSNWTMEKVRREGVKVMPN
AIFM1_DROME     RLRKLAAEKRSITIVGNGFIGSELACSLAHYSRENN--GGKVYQVFQENANMSKVLPNYLSR-----WTT
TRXR1_RAT       --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
DLDH_MANSE      LSLESVP--KKMLVIGAGVIGLELGSVYQRLGADVTAIEGIDMEV---SKDYRILAKQGMKFKLETKVLG
TRXR1_DROME     -LFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVM-VRSIVLRGFDQQMAELVAASMEERGIPFLRK
TRXB_TREPA      FF-----RNKHVVVIGGGDAACDESLVLSRLTDRVTMIHRRDTLRAQ-----KAIAERTLKNPHIAVQWN
TRXB_EUBAC      -----FFEDMEVFVVGGGDTAVEEAMYLAKFARKVTIVHRRDELRAAKSIQEKAFKNPKLDF----MWNS
DHNA_ARATH      RVNEKLSKLERVAVVGCGYAGVELAERLQDRGIVQSINVSKNILTSAPDGNREAAMK-VLTSRKVQLLLG
R34K_CLOPA      ----ALYQGKDLVVVGGGNSAVEAAIFLTKYARNITIVHQFDYL------QAQKYSQDELFKHDSEIRXX
DLDH_SCHPO      LSLSEVP--KKMTVLGGGIIGLEMGSVWSRLGAEVTVVEFLPAVGGPMDADISKALSRIISKQGIKFKTS
DLDH_TRYBB      LALQQVP--KKMXXXXXXXXXLELGSVWARLGSDVTVVEFAPRCAPTLDSDVTDALVGALKRNGEDEVPM
TRXB_CANGA      PIFRNKP----LAVIGGGDSACEEAQFLTKYGSKVYLIVRKDHL------RASTIMQRRAEQNDIEIYNT
DLDH_TRYCR      ----ALPRVPKTMXXXXXXXXLELGSVWARLGAKVTVVEFAPRCAPTLDEDVGALAKNEK----MKFMTS
TRXR_PLAF7      FSLKKDPG--KTLVVGASYVALECSGFLNSLGYDVTVA-VRSIVLRGFDQQCAVKVKLYMEEQGVMFKNG
TRXR_PLAF5      FSLKKDPG--KTLVVGASYVALECSGFLNSLGYDVTVA-VRSIVLRGFDQQCAVKVKLYMEEQGVMFKNG
TRXR3_HUMAN     --LFSLPYCPKTLVVGASYVALECAGFLAGFGLDVTVM-VRSILLRGFDQEMAEKVGSYMEQHGVKFFIP
DHNA_HAEIN      ------------AIVGGGATGVEAAEDLSSYGLQVTLVEAGTRLLPALPENLSAAVLDELK----EMGTN
YUTJ_BACSU      ETLNNLSANATVAIVGAGLSGVELASELRRDDLNIILFDRGNLILSSFPERLSKYVQKWFEEHGVRI---
TRXB_ASHGO      PIFRNKP----LAVVGGGDSACEEASFLTKYGSKVFMLVRKDHM------RASTIMQRRVERNEIEVLYN
TRXR3_MOUSE     --LFSLPYCPGCTVVGASYVGLECAGFLAGLGLDVTVM-VRSVLLRGFDQEMAEKVGSYLEQQGVKFFTP
FENR_FRAAA      -------------VVGGGDSAFDWALALEPIARSVTLVHRRDRFRAH------AATIERVEASRVEILTF
TRXB_KLULA      PIFRNKP----LAVIGGGDSACEEAQFLTKYGSKVYMLVRKDHLRASQIMQRRAEQNEKIEI----LYNH
FENR_IGNH4      -------------------------------GAQVTIVHRRDQ----FRAPMRSI--ERMVRAGVKVLNS
TRXR1_CAEEL     --LFQLPYSGKTLCVGASYVSLECAGFLHGFGFDVTVM-VRSILLRGFDQDMAERIRKHMIAYGMKFEAG
TRXB_CHLMU      PIFRD----RDLFVIGGGDSALEEAMFLTRYGKRVFVVHRRDT----LRASKAMVNKAQANEKIVFLWNS
PYRD1_PONAB     ----------------------------------------------------------------------
TRXB_CHLPN      PIFKN----KDLYVIGGGDSALEEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVK
AIF1_YEAST      REASRISDADHILFLGGGFVNCELAEEIRSGKKRISIIHNSDKLLPDYNDTLRKNVTDYLSKNGITLYLN
AHPF_ECOLI      HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLE--------FAPEMKAVLQDKLRSKNVDIILN
PYRD1_HUMAN     ----------------------------------------------------------------------
GLTD_ECOLI      TRDEPFVEGKRVVVLGGGDTAMDCVRTSVRQGAKVTCAYRRDEEMPGSRREVGVEFKFNVQPLGIEVNGN
TRXR2_DROME     -IFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVM-VRSIVLRGFDRQMSELLAAMMTERGIPFTTI
TRXB_CHLTR      PIFRALEEAMFLTRYGKRVFVVHRRDTLRASKVMVNKAQANEKIFFLWNSEIVKISGDTLVR-SIDIYNN
PYRD1_MOUSE     ----------------------------------------------------------------------
PYRD1_BOVIN     ----------------------------------------------------------------------
OOXA_AGRT4      XXXXXMP-AGPVVLIGCGPLLYLLASQLVDAGVDLTVLDTAQSPFPYVLKGIGLLLK--VRRHAQVVY-G
FENR_NOCSJ      -------------IVGGGDSAFDWALHLEPVARSVTLVHRRDGFRAH------QRTVEAVQASSVQIVTR
PYRD1_RAT       ----------------------------------------------------------------------
AHPF_STAAR      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
TRXB2_YEAST     PIFRNKP----LAVIGGGDSACEEAEFLTKYASKVYILVRKD----HFRASVIMQRRIEKNPNIIVLFNT
OOXA2_RHIME     XXXXXMP-SEPIVLAGCGLLYLLASQLIDAGVSDLTVLDTAQRHMPEFSPYVGIRLLFKVKCQACVV-SG
FENR_SULSO      --------GKRVLIVGGGDSAVDWALTLAPVAKSVTLIHRRDQFRAH-----ERSVKELFRVANVYVWHE
AHPF_STAAW      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
AHPF_STAAN      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
AHPF_STAAM      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
TRXB_BACSU      ----AFFKGKELVVVGGGDSAVEEGVYLTRFASKVTIVHRRDKLRAQSILQARAFDNEKVDF----LWNK
DLDH_BUCBP      ----------------------EMATIYSALGSNVDIIDNSHDILPHLDRDVIDIFKRSVN-HDYNIFFN
AHPF_STAAC      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
AHPF_STAA8      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
TRXB_STRCO      ------------AVIGGGDTAMEEATFLSRFAKSVTIVHRRDQERAFADPKISFVWDSEVEVQGDQKLAG
TRXB_MYCPU      -----------------------------------------------------ALVNDLKSRKNIEVLFN
FENR_LACAC      ----------------------------------------------------------------------
YUMB_BACSU      ELQFATPDRLTIVVGGAGFTGIEFLGELAARVVRIICVEAAPTVLPGFDPELVDYAVHYLEENGVEFKIG
FENR1_BACP2     ----------------------------------------------------------------------
YGFK_ECO57      KGT-ALKLGKHVVVVGAGNTAMDCARALRVPGVETVVYRRSLQEMPAWREEYEEALHDGVERFDADGTLT
TRXB_RICBR      --------------------------------------------------------------------TG
TRXB1_YEAST     PIFRNKP----LAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEI----LYNT
TRMFO_DESDG     ----ALTALTSAAIVGGGLAGCECARKLARAGIAVTLFEMKPHSFAHSSPELGELVSNSLRSDEPEAGVG
GLTD_RHOSH      ---------KRVVVIGGGDTAMDCVRAIRQGATSVKCLYRRDRAMPGSQREVA-----NAEEEGVEVWLG
GLSN_MEDSA      ----------------------------------------------------------------------
FENR_SULTO      --------GKRVLIVGGGDSAVDWALTLAPVAKSVTLIHRRDQFRAH-----ERSVKQLYQVATVYTWHE
FENR_PROA2      ----------------------------------------------------------------------
FENR_LACH4      ----------------------------------------------------------------------
AHPF_STAAS      ----PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFAS------ELKADNVLQDRLRSSNVDIKTN
AHPF_SALTY      HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLE--------FAPEMKAVLQDKVRSKNVDIILN
TRXB_STAAW      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDF----IWSH
TRXB_STAAS      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDF----IWSH
TRXB_STAAN      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDF----IWSH
TRXB_STAAM      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDF----IWSH
TRXB_STAAC      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDF----IWSH
TRXB_PENCH      PIFRNKP----LYVIGGGDSAAEEAMFLAKYGSSVTVLVRKDKL------RASNIMADRLLAHATEVIGE
GLTD_AZOBR      ---------KHVVVLGGGDTAMDCVRAIRQGATSVKCLYRRDRKMPGSQREVAHAEEEGVEFTGDTVVTG
FENR_FRASC      -------------VVGGGDSAFDWALALEPIARSVTLVHRRDRFRAHMSTV------ERVEASSVEILTF
AHPF_STAES      ------------AVIGGGNSGVEAAIDLAGIVKHVTLFEYAS------ELKADSVLQERLRSPNVDIKTS
AHPF_STAEQ      ------------AVIGGGNSGVEAAIDLAGIVKHVTLFEYAS------ELKADSVLQERLRSPNVDIKTS
TRXB_STAAR      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDF----IWSH
TRMFO_EXISA     ---------QRVTVIGAGLAGSEAAWQLAKRGIQVDLYEVRQTPAHHTDQFAELVCSNSLRANGLQNAVG
IRC15_YEAST     LSLDYIPS--RFTIMGGGTIGLEIACIFNNLGSRVTIVESQSEICQNMDNELASATKTLLQCQGIAFLLD
FENR1_SULAC     --------GKRILIVGGGDSAVDWALTLSPVAKSVTLIHRRDQFRAH-----ERSVKQMFQVATVYTWHE
YGFK_ECOLI      KGT-ALKLGKHVVVVGAGNTAMDCARALRVPGVEATIVYRRSQEMPAWREEYEEALHDGVERFDADGTLT
TRXB_RICPR      ----------------------------------------------------------------------
TRXB_HELPY      ----FFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDRCAP-------ITLEHAKNNDKIEFLTP
TRXB_BORBU      -------KGKRVAVIGGGNTALSESIYLSKLVDKVYLIVRKN------NLRAIAMLRDSVAKPNIEILEA
FENR1_BACA2     ---------KHVVISGGGDTAVDWANELEPIAASVTVLHRRE--------EFGGLESSKMKRSSVRVLAP
TRXB_STAES      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQNILQERAFKNDKVDF----IWSH
TRXB_STAEQ      ----AFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELRAQNILQERAFKNDKVDF----IWSH
TRXB_HELPJ      ----FFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDRCAP-------ITLEHAKNNSKIEFLTP
FENR_METS5      ---KSEFQGKRVLIVGGGDSAVDWALTLAPIAKEVTLIHRRDQFRAH-----ERSVKEMFEVAKVYTWHE
FADB_ECOLU      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
FADB_ECO7I      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
OXLA_AGKRH      NGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERP--------------------------
GLT1_SCHPO      ---------RRVAIIGSGPAGLAAADQLNRAGHHVVIYERADRPLQYGIPNM-KLDKKVVEREGIEVLTN
FENR_CHLTE      --------GKRVVIVGGGDSALDWTVGLIKNAASVTLVHRG----------------HEFQGHGK---TA
BAIH_EUBSP      RGKFVIPKG-RVCVLGGGAVACETAE--------------------------------------------
RAX2_SCHPO      ----------------------------------------------------------------------
FENR_LACF3      EDFKD----QRVAVLGGGDAAIDMALMLEDVAEQVYLVHRRDRALEHTVAQLEASTIEKLTPYLPKDLT-
FENR_CHLCH      ---------KHVVIVGGGDSALDWSVGLLKSAASVTLVHRMHEFQGHGKTAHEVMEARDAGRLNVMLDTG
DHNA_BACYN      HCDGPLFEGKDVAVIGGGNSGVEAAIDLAGIVNHVTVLE--------FMPELKAVLQERLNSPNVTVIKN
TRXB_NEUCR      PIFRN----KHLVVIGGGDSAAEEAMYLTKYGSHVTVLVRKDKL------RASSIMAHRLLNHGVEV-KG
FENR_MAGSA      -------RGKKVVIAGGGDSAVDWAISLSEVAAKVMVVHR--RPKFRAAPESEARLKQLAETGAVELVVP
FENR_CHLL2      ---------KKVVIVGGGDSALDWAVGLLDAAEHVTLVHRMHEFQGHG--KTAREVDEARDKGVIDVYMD
FADB_ECO5E      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLALGMTEAAKLLNKQLERGKID---G
FADB_ECO57      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLALGMTEAAKLLNKQLERGKID---G
DHNA_BACSU      HCDGPLFEGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLE--------FAPELKALQKRLYSLPNVTVVKN
TRXB_MYCGE      ----------------------------------------------------------------------
TRXB_DICDI      ----ALPRNKHLVVVGGGDTAAEEATFLTHFASKVTLLVRRNVMRAS-----KAMQQKVFSNPKIEVLWD
TRXB_COXBU      ----FFYRGKKVAVVGGGNTAVEEALYLSHIASHVTLIHRRDKLRA--EKMLSAQLIKKVEEGKVAVWSH
TRMFO_BACCN     -------------VIGAGLAGSEAAYQIAKRGIQVHLYEVKQTPAHHTDKFAELVCSNSLRANTLTNAVG
KMO_USTMA       RASAQLPTKERVAVIGAGPVGCLAALAFAQRGCKVDIFESRPDPRTHEAITRASSINLALSTRGI---TG
FENR_SYMTH      -----LPQGKRVLVIGGGDSAVDYALMVEPIAAEVTLIHRRDGFRAHEE----SLKKLAASRVHVKVF--
FENR_PROVI      -------EGKRVVIVGGGDSALDWTVGLQGVASGITLVHRMHEFQGHG--KTAREVDEARDAGTVDVHLN
FENR_CHLPD      --------GKKVVIIGGGDSALDWAVGLLPVAERVTLVHRMHEFQGHG--KTARDVEEAKERGAIDVYLN
FENR_BRASB      -------RDKNVVIVGGGDSALDWTLNLHPLAKRITLVHRRDRAAPHSVEQMRALVKMDLRIGQVSALEG
FENR2_CHLT3     ---------KKVLIIGGGDSALDWAMALMANA-EVTLIHRRDKFTAHEDSV------EKVRKSPANIKTF
DADA2_PSEAE     --------AQRVCIIGAGVVGLATAYALVREGFDVTLVEARER---------------------------
TRMFO_BACSU     -------------VIGAGLAGSEAAWQLAKRGIQVKLYEVKQTPAHHTDKFAELVCSNSLRSNTLANAVG
STCD_RHIME      ---------RKVVVVGTGPAGLEAARVAGERGHEVIVFEAASDP----GGQVRLTAQSPRRREMISIWRM
FIXC_SHIFL      -----------------------------------------------------AWLMEQAEEAGAQLITG
FENR_ACIC1      RYFVPNPQGKRILVVGGGDSAVDYALMLEKVAASVTLIHRRHEFRAH------EASVEQLRASSVRILTP
FENR2_SULAC     E--------KRILIVGGGDSAVDWAINLAPVAKSITLIHRRDQFRAH-----ESSVKQLYNIASVHTWHE
TRXB1_ARATH     VCDGAAPIFRNKAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASKIMQQRALSNPKID----VIWNS
FENR_SALAI      RFLGTVPQPRDVLIVGGGDSAFDWASTLQPLARSVTLVHRREXXXXXXXXXVRIVVNAEVTRHGGGTVTG
FENR1_BACSU     EKLDAF-KGKRVVISGGGDTAVDWANELEPIAASVTVVHRRE--------EFGGMESSKMKQSSVRVLTP
TRMFO_EXIS2     ---------KRVTVIGAGLAGSEAAWQLAKRGVQVDLYEVKQTPAHHTDQFAELVCSNSLRANQLTNAVG
TRMFO_BACP2     -------------VIGAGLAGSEAAWQIAKRGIKVNLYEVKHTPAHHTDKFAELVCSNSLRANALTNAVG
MNMC_BURS3      ----ALPVARRAIVIGAGLAGCAVVERLAARGWEVTLIERHDR---------------------------
FIXC_ECOLI      -----------------------------------------------------AWLMEQAEEAGAQLITG
FIXC_ECOL6      -----------------------------------------------------AWLMEQAEEAGAQLITG
FIXC_ECO57      -----------------------------------------------------AWLMEQAEEAGAQLITG
FENR_METPP      -------------------------------------------------PASVAKMKELCDAYEMQFIVG
FENR2_BACP2     ---------RRVAVLGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSV------ENLHNSKVNVVTP
FADB_YERE8      KLSKGVSAPKQAAVLGAGIMGGGIAYQSALKGVPVIMKDINDKSLTLGMNEAAKLLNKQLERGKIDGLKM
TRXB_STRCL      -------------VVGGGDTAMEEATFLSRFAKSVTIVHRRDQDRAFADPKISFAWNSEVATHGEQKLTG
TRXB_PNECA      PIFRGKP----LAVVGGGDSAAEESLFLTRYATKVYLLVRRDKL------RASPIMAKRLLHHPIEIWNT
TRXB_MYCSM      ----FFFRDQDIVVVGGGDSAMEEATFLTRFARSVTLIHRRDEFRAS-----KIMLERARANEKITFLTN
TRMFO_STAAW     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAT     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAS     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAR     -------------VIGAGLAGSEAAYQLSERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAN     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAM     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAE     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAC     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAAB     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAA9     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAA8     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAA3     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAA2     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_STAA1     -------------VIGAGLAGSEAAYQLAERGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNGVG
TRMFO_LYSSC     -------------VIGAGLAGSEAAWQIAKRGVKVRLYEVKQTPAHHTDKFAELVCSNSLRANGLTNAVG
GSHR_DEBHA      FELQKQPKS--VAVVGAGYIGVELSGIFKALGSETHLVIRGDTVLRSFD--------ESIQNSITDYYTD
FENR_THET8      ---KAEFQGKRVLIVGGGDSAVDWALNLLDTARRITLIHRRPQFRAH-EASVKELMKAH-EEGRLEVLTP
FENR_THET2      ---KAEFQGKRVLIVGGGDSAVDWALNLLDTARRITLIHRRPQFRAH-EASVKELMKAH-EEGRLEVLTP
FENR_PELLD      ----------------------------------------------------------------------
FENR_LACDB      ----------------------------------------------------------------------
FENR_LACDA      ----------------------------------------------------------------------
FENR_FLAPJ      ---------------------------------------------------------QELKSAGIKLITP
FENR_CHLP8      ----------------------------------------------------------------------
FENR1_CHLT3     ----------------------------------------------------------------------
FADB_SHISS      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
FADB_SHIFL      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
FADB_SHIF8      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
FADB_ECOLI      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
FADB_ECODH      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
FADB_ECOBW      KLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKID---G
TRXB_RICTY      ----------------------------------------------------------------------
TRXB_RICCN      ----------------------------------------------------------------------
TRXB2_ARATH     VCDGAAPIFRNKVVIGGGDSAMEEANFLTKYGSKVYIIHRRDTFRASKIMQQRALSNPKIE----VIWNS
TRMFO_STAES     ---------QKVNVVGAGLAGSEAAYQLAQRGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNAVG
TRMFO_STAEQ     ---------QKVNVVGAGLAGSEAAYQLAQRGIKVNLIEVKQTPAHHTDKFAELVCSNSLRGNALTNAVG
TRMFO_LISIN     -------------VIGAGLAGSEAAWQLVKRGVKVDLYEVKQTPAHHTDKFAELVCTNSLRANGLTNAVG
TRMFO_BACWK     -------------VIGAGLAGSEAAYQIAKRGVQVKLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACHK     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACCZ     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACCR     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACCQ     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACC7     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACC4     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACC3     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACC2     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACC1     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACC0     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACAN     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACAH     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACAC     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
TRMFO_BACAA     -------------VIGAGLAGSEAAYQIAKRGVQVRLYEVRQTPAHHTDKFAELVCSNSLRANTLTNAVG
OXLA_CROAT      NGLTATSNPKRVVIVGAGMAGLSAAYVLAGAGHQVTVLEASER---------------------------
OXLA_CROAD      NGLTATSNPKRVVIVGAGMAGLSAAYVLAGAGHQVTVLEASER---------------------------
MNMC_PSEU2      ---------RKALVIGAGLAGCATAQSLAQRGWQVSLLERHAAPAQEASGNPQGVLYLKLSAHG------
MNMC_PSE14      ---------RKALVIGAGLAGCATAQSLAQRGWQVSLLERHAAPAQEASGNPQGVLYLKLSAHG------
LNT_RHILO       RLGAALFVLLASAHVGFGYIRLAAPEKPAERSLDVRIVQPAVDLSEKWDASVGLSAKAPDPGHGLILWPE
FENR_NEOSM      -------------------------------------------------------LKSLEETKKLKILTP
FENR_CHLPB      EL-----EGKKVLIVGGGDSALDWA--------MMLLPHAEHITVAHRSPDFRAKTKDDLEKGLVDVHLN
FENR2_BACLD     ---------KRVAVLGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSV------ENLRNSKVNVLTP
FADB_SERP5      KLAKGIEAPKQAAVLGAGIMGGGIAYQSALKGVPVVMKDISDKSLTLGMNEAAKLLNKQLER--------
Y1834_STAS1     ---------------GAGFTGVEIPELCNKYGVEITCVEAAPKMLPMFSDELVNHAVNYLENKGVEFKIG
TRXB_MYCPN      ----------------------------------------------------------------------
TRMFO_LISMF     -------------VIGAGLAGSEAAWQLVKRGVKVDLYEVKQTPAHHTDKFAELVCTNSLRANGLTNAVG
PURT_DESVM      ---AALAESRREAVTGAGGWGIFGVELFIK-GDKVYFSEVSPRP---HDTGLVTLISQNLSEFALHARAG
OXLA_PSEAU      NGLQRTSNPKRVVVVGAGMAGLSAAYVLAGAGHQVTLLEASER---------------------------
OXLA_BOTJR      NGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGPMRLPEKHRIVREYIRKFGLQL-NE
OXLA_AGKHA      --LKATSNPKHVVIVGAGMSGLSAAYVLSGAGHQVTVLEASER---------------------------
MNMC_PSEE4      -----LPGPREALVIGAGLAGSATARSLAERGWQVSVLERHAGPAQEASGNPQGVLYLKLSAHG------
MNMC_ACIBC      ---------QRIAVIGAGIAGLSTAWAFAQRGHQVTLFE-------------------------------


                         .         .         .         +         .         .         .:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
CDR_PYRFU       EKTLSIEGRERVEKVITDGGEYKADLVIIATGIKPNVELAKQLGVKIGETGAIWTNEKMQTSVENVYAAG
CDR_PYRAB       EIVLRIEGKDRVEKVVTDAGEYRADLVILATGIKPNIELARQLGVRIGETGAIWTNEKMQTSVENVYAAG
CDR_PYRKO       LRLEEIEGKERVERVVTDAGEYPADLVIVATGIKPNTELARGLGVRIGETGAIWTNDRMQTSVENVYAAG
CDR_PYRHO       EITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAG
NAOX_METJA      KPLEKIVGKEKVEAVYVDGKLYDVDMVIMATGVRPNIELAKKAGCKIGKF-AIEVNEKMQTSIPNIYAVG
NAOX_STRP6      ETVKEVAGNGKVEKIITDKNEYDVDMVILAVGFRPNTTLGNGK-IDLFRNGAFLVNKRQETSIPGVYAIG
CDR_STAES       EEISHVNGH---EVTFTSGKVENFDLIIEGVGTHPNSQFIKSSNVILNDKGYIPVNHNFQTNIPNIYALG
CDR_STAEQ       EEISHVNGH---EVTFTSGKVENFDLIIEGVGTHPNSQFIKSSNVILNDKGYIPVNHNFQTNIPNIYALG
CDR_STAAN       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAAM       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAA9       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKLIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAA2       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKLIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAA1       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAAW       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAAS       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAAB       EEIVAINGN---EITFKSGRVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKLETNVPNIYAIG
CDR_STAAR       EEIDAINGN---EITFKSGKVEHYDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYVIG
NAPE_ENTFA      ETVERYEGDGRVQKIVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
CDR_STAAC       -RLXXXXXXXXXXXXTFKSGKVEHDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
NAOX_LACLM      ELAKEFKANGYVSQIVTNKATYDVDLVINCIGFTANSALASDK-LATFKNGAIKVDKHQQSSDPDVYAVG
CDR_STAA8       -RLXXXXXXXXXXXXTFKSGKVEHDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAHJ       EEIVSVKD----HLVTFKSGIQEDDIIIEGVGTHPHSKFIESSNVALDDKGFVKVNDKFETNIPNIYALG
CDR_STAAT       -RLXXXXXXXXXXXXTFKSGKVEHDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAAE       -RLXXXXXXXXXXXXTFKSGKVEHDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
CDR_STAA3       -RLXXXXXXXXXXXXTFKSGKVEHDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
NAOX_ENTFA      ENVQQFVAQGKVAKVITPSQEFEADMVIMCVGFRPNTELLKDK-VDMLPNGAIEVNEYMQTSNPDIFAAG
CDR_STAS1       EEISKVVG----NAVHFESGKVENDLIIEGVGVKPNSEFIKNSNVTLDDKGYIPVNDQFQTNIPNIYALG
NAOX_MYCPN      SAVKGFADKNVVKGVETDKGRVDADLVIQSIGFRPNTQVPKDRQFEFNRNGSIKVNEYLQANHENVYVIG
NAOX_MYCGE      CSVKGFSTNNVVKGVETDKGIVNADLVNQSIGFRPSTKFVKDQNFEFIHNGSIKVNEFLQANHKDVYVIG
THCD_RHOER      TGVKTINAAGRAAGVTTNSGVIHADAVVVGIGVVPNIELAALTGLPV--DNGIVVDEYLRTPDENISAIG
MERA_STAES      VTYQKVEQNGKSTSVNGQEQVIEADQVLVATGRKPNTETLESAGVKTGKKGEVLTNEYLQTSNNRIYAAG
MERA_STAAU      VTYQKVEQNGKSTSVNGQEQVIEADQVLVATGRKPNTETLESAGVKTGKKGEVLTNEYLQTSNNRIYAAG
TODA_PSEP1      TGVVGFSGEGQLEQVMASDGSFVADSALICVGAEPADQLARQAGLAC--DRGVIVDHCGATLAKGVFAVG
MERA_ENTAG      TQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRALEAAGVAVNAQGAIVIDKGMRTSSPNIYAAG
BEDA_PSEPU      TGVSGFSGEGQLEKVMVNDGSFIADNALICVGADPADQLARQAG--LECDRGVVVDHRGATSAKGIFAVG
CAMA_PSEPU      TQVCGFEDQQKVTAVLCEDGTLPADLVIAGIGLIPNCELASAAGLQV--DNGIVINEHMQTSDPLIMAVG
AIFM3_MOUSE     TEVSELRAQGKLEVVLKSSKVLRADVCVLGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAG
MERA_THIFE      TQASQVAYADGEFVLATGHGELRADKLLVATGRAPNTRRLEAAGVAINAQGAIVIDQGMRTNSPNIYAAG
MERA_SHIFL      TQASQVAYINGVRDGETAHGELRADKLLVATGRAPNTRALDATGVTLTPQGAIVIDPGMRTSVEHIYAAG
MERA_PSEFL      TQASQVAHVNGEFVLTTGHGELRADKLLVATGRAPNTRALDAPGVTVNAQGAIVIDQGMRTSNPNIYAAG
MERA_SHEPU      TQATKVTHDGSQFTLETNAGDLRCDRLLVSTGRHANTCQLNAVGVTTNKKGEIVVNERMETNVPGIYAAG
MERA_BACCE      ATYERVEQDGDIKKVHVKKRIIEAEQLLIATGRKPQTSLLHAAGVEVGSRGEIVIDDYLKTTNSRIYSAG
DLDH_CHLMU      ASVSSIEDMGDRVRLTINGNIEEYDYVLVSIGRRLNTENLDKAGVICDERGVIPTDSTMRTNVPNIYAIG
MERA_PSEAE      TQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRALDAAGVTVNAQGAIVIDQGMRTSNPNIYAAG
GSHRP_SPIOL     TTLELVKTDGGVVARTDHGEEIEADVVLFATGRSPNTKRLEALGVELDRTGAVKVDEYSRTSVPSIWAIG
BPHG_BURXL      AQAARFEGQGQVRAVICADGRVPADVVLVSIGAEPADELARAAGIAC--ARGVLVDATGATSCPEVFAAG
TODA_PSEPU      TGVVGFSGEGQLEQVMASDGSFVADSALICVGAEPADQLARQAGLA------------------------
BNZD_PSEPU      TGVVGFSGEGQLEQVMASDGSFVADSALICVGAEPADQLARQAGLA------------------------
DLDH_HALVO      EGATGWREMVTTETEDGEENEYRADKVLVAVGRSPVTDTIENAGLEADDRGFLSVDDRRRTDVEHIYAVG
NORW_ECO5E      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECO57      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECOLI      SQLQGLKTDSGIQATLDRQRNIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNTDIYALG
NORW_ECOLC      SQLQGLKTDSGIQATLDRQRNIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNTDIYALG
NORW_ECODH      SQLQGLKTDSGIQATLDRQRNIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNTDIYALG
NORW_ECOBW      SQLQGLKTDSGIQATLDRQRNIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNTDIYALG
NASD_BACSU      KQTEEIVGDDRVEGLRFKDGTIEADLVVMAVGIRPNTTLGAESGIPV--NRGIIVNDYMQTEIPHIYAVG
DLDH_THESC      TKAVGYKQDGLHVLLEAAQGEIVVDKILVAVGRRPRTEGLEKAGVKVDERGFIQVNARMETSAPGVYAIG
NORW_SHIB3      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNDDIYALG
NORW_SHIBS      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNDDIYALG
NORW_ECOSE      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTRNADIYALG
GSHRC_ARATH     TSLTQLTKTDQGIKVISSHGEFVADVVLFATGRSPNTKRLEAVGVELDQAGAVKVDEYSRTNIPSIWAVG
DLDH1_PSEPU     HSVEGYEN-GCLLANDGKGGQLEADRVLVAVGRRPRTKGFNLECLDLKMNGAIAIDERCQTSMHNVWAIG
NORW_ECOL5      SQLQGLKTDSGILATLDRQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECOHS      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNTDIYALG
NORW_ECO8A      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECO55      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
GSHRC_BRARP     TSLELIKTDDGIKVISSHGEEFVADVVLFATGRIPNTKRLEAVGVELDQAGAVKVDEYSRTNIPSIWAVG
DLDH_CHLPN      ASISAIEESQNQVRITVNDQVEEFDYVLVAIGRQFNTASLDNAGVIRDDRGVIPVDETMRTNVPNIYAIG
RURE_ACIAD      TTVEKVSKIGQDYAVTLANGTLVADIVLSAIGLQPNIDLAKHAGV--HTSRGILTNSLLETNLEDIYAIG
NORW_ECO27      SQLQGLKTNSGILATLDRQRSIEVDTVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECOUT      SQLQGLKTDSGILATLDRQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECOSM      SQLQGLKTDSGILATLECQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECOK1      SQLQGLKTDSGILATLDRQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECO45      SQLQGLKTDSGILATLDRQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECO24      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNDDIYALG
NORW_SHISS      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNDDIYALG
NORW_ESCF3      SQLQGLKTNSGILATLDRQRSTEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_SHIDS      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_ECOL6      SQLQGLKTDSGILATLDRQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_SHIFL      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_SHIF8      SQLQGLKTDSGILATLDHQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_KLEP7      TQLEGLE--------QTADGIITVDAVVAAAGLRPETSLARHAGLQI--NRGIVVNSQLQTSDPAIYALG
NORW_ECOLU      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
NORW_VIBFM      DCVQAVNKQEQGYRVTTSNHSYYVDCVISAAGLKPNTQLATEANLMV--NRGIVVDSNLQTSANNIYALG
NORW_SALA4      XKIEA-----GIRATLASQRSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
NORW_KLEP3      AQLEGLE--------QTADGIITVDAVVAAAGLRPETSLARHAGLQI--NRGVVVNNQLQTSDPAIYALG
GSHRC_PEA       TNLQLIKTEDGIKVITDHGEELIADVVLFATGRSPNSKRLEKVGVEFDKAGAIVVDEYSRTNIPSIWAVG
NORW_SALTY      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
DLDH1_PSEAE     HSLLGPSENGRVRDGAGEEREIAADQVLVAVGRKPRSEGWNLESLGLDMNGAVKVDDQCRTSMRNVWAIG
MERA_STRLI      TQLRAVRGEGILATLTGPDGQVRASHLLIATGRRSVTNGLERVGVKTGERGEVVVDEYLRTDNPRIWAAG
DLDH3_HALMA     YTADSWAASGKAEAAHDSDIELTADRILVAVGRRPVTDTLSIAGVETNAQGFIPTDSTCRTNKEHIFAVG
NORW_CITK8      SQLQGLEKTATIRATLDRDRQVEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSHPDIYALG
NORW_SALHS      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
NORW_SALEP      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
NORW_ERWCT      TTVQQLKTETGVQARFTDGRTVEVDEIISAVGLQANTQLAKAADLAV--QKGIQTNAQLQTPDPQIYALG
GSHRC_ORYSJ     TNLELSKTADGIKVVTDKGEEIIADVVLFATGRTPNSQRLEAAGVEVDNIGAIKVDDYSRTSVPNIWAVG
DLDH1_BACSU     AMAKGVEGVTVTFEVKGEEKTVDADYVLITVGRRPNTDELEQVGIEMTDRGIVKTDKQCRTNVPNIYAIG
NORW_SALSV      XXXXXXKTEAGIRATLVSQRNIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
MDAR2_ARATH     TVLTSFESNKKVTAVNLKDGSLPADLVVVGIGIRPNTSLFE--GQLTIEKGGIKVNSRMQSSDSSVYAIG
DLDH_CHLTE      AK---------LDNVAVSESGVSAELVV--EGSAPQTLNASCLLVAVGVTGAIRTDGQCRTSAPGIYAIG
YDGE_SCHPO      NSIKEVKDSSKAEHIVLKDGSIPADVVILAAGVKPNLRYL-GNAVSLEKDGGVKVDEHCRVGAEDVYAVG
NORW_SALTI      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
STHA_MARAV      EQYESVKGDDHGVVLSLQSGKIRADAFLWCNGRSGNTENLGLENVGLTPNGQLAVDEHYRTEVEHIYAAG
MERA_ACICA      TQASQVAHVDGEFVLTTGYGEIRADQLLVATGRAPNTRXXXXXXXXXXXXXXXXXDKGMRTSTPHIYAAG
DLDH_STAAW      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
DLDH_STAAU      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
DLDH_STAAS      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
DLDH_STAAR      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
DLDH_STAAN      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
DLDH_STAAM      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
DLDH_STAAC      AMAETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELEELGVKFADRGLLEVDKQSRTSISNIYAIG
GSHR_BURCE      VDVVAVRQRGALSVQLTTGDAMEVDAVMAATGRLPNTLGLETVDVGLDQNGAIKVDEYSRTSSPGIYAVG
DLDH_RHOCA      AAVQGVKGKNTVRYTDESAHAIEAEVVLVATGRKPFTKGLEALGVEMLPRGQVKADSHWATNVPGLYAIG
NORW_SALG2      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
DLDH_MYCTU      TKVESIAGGSQVTVTVTKDGVLKAEKVLQAIGFAPNVELDKA-GVALTDRKAIGVDDYMRTNVGHIYAIG
DLDH_MYCBO      TKVESIAGGSQVTVTVTKDGVLKAEKVLQAIGFAPNVELDKA-GVALTDRKAIGVDDYMRTNVGHIYAIG
STHA_PSEAE      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENVGIKVNSRGQIEVDENYRTSVSNIFAAG
STHA_PSEAB      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENVGIKVNSRGQIEVDENYRTSVSNIFAAG
STHA_PSEA8      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENVGIKVNSRGQIEVDENYRTSVSNIFAAG
DLDH_CHLTR      ASVSNIEDIGDRVRLTINGNVEEYDYVLVSIGRRLNTENLDKAGVICDERGVIPTDATMRTNVPNIYAIG
STHA_PSEA7      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENVGIKVNSRGQVEVDENYRTSVSNIFAAG
GSHR_ECOLI      AIPKAVKNTDGSLTLELEDGSETVDCLIWAIGREPANDNLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVG
DLDH2_HALMA     EAADNWE--------ETDEGIYNAEKCLVAVGREPVTDTLALDNIDLDENGVIPTDDQCRTAFESVFAVG
GSHR_HAEIN      STPSEINADGSLTVRCDGQSDVTVDCVIWAAGRVPTTDKLENAGVETNEHGYVKVDKYQNTNVKGIYAVG
DLDH_CHLP8      AK---------LGNVAISEFGVNAD--LLAEGKEPQKIEASCMLVAVGVTGVIRTDELCRTSASGIYAIG
NORW_SALAR      XXXXXXXXXAGIRATLASQRRIEVDAAIAATGLRPETALARRAGLVI--NHGVCVDSYLQTSHPDIYAIG
MERA_ALCSP      TQASQVAHVDGEFVLTTGYGEIRADQLLVATGRAPNTRXXXXXXXXXXXXXXXXXDKGMRTSTPHIYAAG
MDAR_PEA        TVAVGFTANGEVKEVKLKDGVLEADIVIVGVGGRPQISLFK--GQVEEQHGGIKTDSFFKTSVPDVYAVG
NASB_BACSU      KDTVSISGATKADRIHFKDGSLKADLIVMAAGVKPNIELAVSAGIKV--NRGIIVNDFMQTSEPNIYAVG
DLDH2_PSEPU     ARVTGSKVNGEVEVTYTNEQKITFDKLIVAVGRRPVTTLAADSGVTIDERGYIFVDDYCATSVPGVYAIG
STHA_MYCTU      EEVTAV-DVGSAGTVTTSGKQIPAETVMYSAGRQGQTDHLDLAGLEVQGRGRIFVDDRFQTKVDHIYAVG
STHA_MYCTA      EEVTAV-DVGSAGTVTTSGKQIPAETVMYSAGRQGQTDHLDLAGLEVQGRGRIFVDDRFQTKVDHIYAVG
STHA_MYCBT      EEVTAV-DVGSAGTVTTSGKQIPAETVMYSAGRQGQTDHLDLAGLEVQGRGRIFVDDRFQTKVDHIYAVG
STHA_MYCBP      EEVTAV-DVGSAGTVTTSGKQIPAETVMYSAGRQGQTDHLDLAGLEVQGRGRIFVDDRFQTKVDHIYAVG
STHA_MYCBO      EEVTAV-DVGSAGTVTTSGKQIPAETVMYSAGRQGQTDHLDLAGLEVQGRGRIFVDDRFQTKVDHIYAVG
NORW_VIBVU      SRVESVTEQGQTLAIALHDGEFAVDAVLCAAGLKANTAVAREAGLSV--ERGICVDHQLNTSDPHIYALG
GSHR_ASHGO      QRVEKDPNTGKLTVHLSGKIIEDVDQLVWAIGRKSLLGIAENVGVKLGETGHVVVDEYQNTSTKGIYALG
DLDH2_PSEAE     ARVTASEVKKKQVTVANGEQKETFDKLIVAVGRRPVTTLAADSGVTLDERGFIYVDDHCKTSVPGVFAIG
STHA_PSEFS      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGVKVNSRGQIEVDENYRTCVTNIYGAG
DLDH_PEA        TKVVGVSGDGVKLTVEPSAGIIEADVVLVSAGRTPFTSNLDKIGVETDKLGRILVNERFSTNVSGVYAIG
STHA_PSEPK      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGIKVNSRGQIEVDEAYRTTVPNIYGAG
STHA_PSEPG      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGIKVNSRGQIEVDEAYRTTVPNIYGAG
STHA_PSEP1      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGIKVNSRGQIEVDEAYRTTVPNIYGAG
GSHRP_TOBAC     ESPQAIKSADGSLSLKTSRGTVEGSHIMFATGRRPNTKNLETVGVKMTKNGAIEVDEYSRTSVPSIWAVG
DLDH_PSEFL      ARVTASEVKKKQVTVANGEQKETFDKLIVAVGRRPVTTLAADSGVTLDERGFIYVDDHCKTSVPGVFAIG
STHA_PSEPW      EDYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGIKVNSRGQIEVDEAYRTSVPNIYGAG
DLDH_HALSA      LAADSW--------TDTDDGIVXXXKVLVAVGRQPVTDTLNLDAVGLEPNGRLETDHEARTDVENVFAIG
STHA_PSEFL      EEYDRVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGVKVNSRGQIEVDENYRTCVTNIYGAG
STHA_PSEE4      EEYERVEGLDNGVVLHLKSGKIKADALLWCNGRTGNTDRLENIGIKVNSRGQIEVDQAYRTSVPNIYGAG
NORW_VIBVY      SRVESVTVQGQTLAIALHDGEFAVDAVLCAAGLKANTAVAREAGLSV--ERGICVDLQLNTSDPHIYALG
NORW_ECO81      SQLQGLKTDSGILATLDRQRCIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
GSHRP_ARATH     ESPEAIIKAGDGSSLKTSKGTVEGSHVMFATGRKPNTKNLENVGVKMAKNGAIEVDEYSQTSVPSIWAVG
DLDH_ACHLA      AEVKKVDDHKVTYSLDGKETTIEGDLILMSVGTRANSKGLEHLGLEMDRAN-IKTNEYLQTNVPGVYAIG
DLDH1_BACST     ALAEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELEQIGIKMTNRGLIEVDQQCRTSVPNIFAIG
STHA_PSEPF      EEYDRVEGVDNGVILHLKSGKIKADALLWCNGRTGNTDQLENIGVKVNSRGQIEVDENYRTCVQNIYGAG
MDARS_CUCSA     TVAVGFTTNGEVKEVKLKDGVLEADIVVVGVGARPLTSLFK--GQIVEEKGGIKTDEFFKTSVPDVYAVG
STHA_PSEU5      EEYERVEGLENGVILHLKSGKIKADAFLWSNGRTGNTDKLENIGLKANSRGQVQVDEHYRTEIGNIYAAG
GSHRP_SOYBN     ESPQAIKSADGSFSLKTNKGTVDGSHIMFATGRRPNTQNLESVGVKLAKDGAIEVDEYSQTSVYSIWAVG
STHA_CHRSD      EDYESIEGDESGVIVKLKSGKLRADAFLWANGRTGNTDELGLENIGLEPNGRLQVDEHYRTMVPHIYAVG
STHA_AZOVI      EEYERVEGLDNGVILHLKSGKIKADAFLWSNGRTGNTDKLENIGLKANGRGQIQVDEHYRTEVSNIYAAG
STHA_AZOVD      EEYERVEGLDNGVILHLKSGKIKADAFLWSNGRTGNTDKLENIGLKANGRGQIQVDEHYRTEVSNIYAAG
NORW_ENT38      XXXXXXXXXDTIRATLDRNRSVEIDVVVAATGLRPETALARRAGAELG----VKVDSYLQTTQPDIYALG
NORW_ECO7I      SQLQGLKTDSGILATLDRQRSIEVDAVIAATGLRPETALARRAGLTI--NRGVCVDSYLQTSNADIYALG
STHA_PSEF5      EEYDRVEGVDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGVKVNSRGQIEVDENYRTCVPNIYGAG
STHA_PSESM      EEYERVEGLDNGVVLHLKSGKIKADALLWCNGRTGNTDKLENIGLKANGRGQIEVDEAYRTSVSNVYGAG
STHA_PSE14      EEYERVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGLKANGRGQIEVDENYRTSVSNVYGAG
GSHR_ANASP      NVVTAIEGLKISLSGEDQEPII-ADVFLVATGRVPNVDDSSIEGPGYSTMNAIAVNEYSQTSQPNIYAVG
STHA_PSEU2      EEYEKVEGLDNGVILHLKSGKIKADALLWCNGRTGNTDKLENIGLKANGRGQIEVDETYRTSVSNVYGAG
NIRB_KLEOX      ATTEIVRNEQGLQLNFRDGSSLATDMLVFSAGIRPQDALARSGGLSVGERGGICIDNQCRTSDPDVLAIG
GSHR_PSEAE      SDIARIQADGSLAATLKDGRVLEADCVFYATGRRPMLDGLENTAVKLTDKGFIAVDEHYQTSEPSILALG
GSHR_HUMAN      SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
DLDH_AZOVI      ARVTGTEVKNKQVTVKEGEKSQAFDKLIVAVGRRPVTTLAADSGVTLDERGFIYVDDYCATSVPGVYAIG
STHA_PSEMY      EEYERIEGVENGVVLHLKSGKIKADALLWCNGRTGNTDQLENIGIAVNSRGQIQVDEHYRTEVSNIYAAG
STHA_HAHCH      EQYDSVVGDDHGVVLTMKSGKIRADAFLWCNGRTGNTDNLGLENIGLEPNGQLAVDNHYRTKIPHVFAAG
HCAD_ECOLU      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANDQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
GSHR_MOUSE      VKEVKKTSSGELQVVTSVPGRKPVDCLLWAIGRDPNSKNLNKVGIQTDEKGHILVDEFQNTNVKGVYAVG
GSHR_CALJA      SQVKEVKKTSEVSLVTAVPGRLPVDCLLWAIGRDPNSKSLNKLGIKTDDKGHIIVDEFQNTNVKGIYAVG
TYTR_TRYBB      AKV-SLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLVGVKLTPKGGVQVDEFSRTNVPNIYAIG
NORW_SALPB      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPETALARRAGVAV--NRGVCVDSYLQTSHPDIYAIG
DLDH_BUCAI      IKVEVKKDALIVDMIHENKKNILYDAVLVAIGRTPNIDSLDRIGLKINNFGFIQVNNQLKTNIPHIYAIG
DLDH3_PSEAE     TRVVAARGEQGVEAAGGATESLQADYVLVAIGRRPYTE-----GLGLETVG-LASDRRQRSAAPGVWVIG
MDAR3_ARATH     TVASGFTAQGEVKEVQLKDGTLEADIVIVGVGAKPLTSLFK--GQVEEDKGGIKTDAFFKTSVPDVYAVG
NORW_SALPK      XKIEA-----GIRATLASQRSIEVDAVIAATGLRPET--XXXXXXXXXXXXXXXXDSYLQTSHPDIYAIG
NORW_SALPA      XKIEA-----GIRATLASQRSIEVDAVIAATGLRPET--XXXXXXXXXXXXXXXXDSYLQTSHPDIYAIG
NORW_VIBF1      DCVQAVNKQEQGYRVTTSNGSYYVDCVISAAGLKPNTKLATEANLMV--NRGIVVDLNLQTSANNIYALG
STHA_PROMH      EEYDTIEGVDDGVIVHLKSGKVKADCLLYANGRTGNTDTLENVGIKTDSRGQVAVNAHYQTSCEHIYAVG
NORW_SALNS      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPET--XXXXXXXXXXXXXXXXDSYLQTSHPDIYAIG
NORW_SALDC      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPET--XXXXXXXXXXXXXXXXDSYLQTSHPDIYAIG
MDAR1_ARATH     TVATGFNSDGEVTEVKLEDGTLEANIVVAGVGARPATSLFK--GQLEEEKGGIKTDGFFKTSVPDVYALG
NIRB_ECOLI      KNTLEIVQEG-VEARKTMRSELEVDFIVFSTGIRPRDKLATQCGLDVAPRGGIVINDSCQTSDPDIYAIG
GSHR_STRTR      ANTEVVKNADDSLTISDNEETITVDCLIWAVGRAANTSGLEKTGVELTERGNIYSDEFENTSVPGIYALG
GSHR_DICDI      ASIKSLEGKRIIATTNAGVKLPPVECVIWAIGRVPNTDIDKAGIQLTEQSGFIKVDEFQNTNVPGVHAVG
NORW_SALPC      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPET--XXXXXXXXXXXXXXXXDSYLQTSHPDIYAIG
NORW_SALCH      XXXXXXKTEAGIRATLVSQHSIEVDAVIAATGLRPET--XXXXXXXXXXXXXXXXDSYLQTSHPDIYAIG
STHA_YERE8      EEFEQIEGTVDGVIVHLKSGKVKADCLLYANGRTGNTSGLEKIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_VIBVY      ETYERIEGTEDGVIVHLQSGKMKADCLLYANGRTGNTDKLNAVGLQGDSRGQLKVDGNYQTEVEHVYAVG
STHA_VIBVU      ETYERIEGTEDGVIVHLQSGKMKADCLLYANGRTGNTDKLNAVGLQGDSRGQLKVDGNYQTEVEHVYAVG
DLDH_SHIFL      TKVTA------VEAKETMEGKAPADAVLVAIGRVPNGKNLDAAGVEVDDRGFIRVDKQLRTNVPHIFAIG
DLDH_ECOLI      TKVTA------VEAKETMEGKAPADAVLVAIGRVPNGKNLDAAGVEVDDRGFIRVDKQLRTNVPHIFAIG
DLDH_ECOL6      TKVTA------VEAKETMEGKAPADAVLVAIGRVPNGKNLDAAGVEVDDRGFIRVDKQLRTNVPHIFAIG
DLDH_ECO57      TKVTA------VEAKETMEGKAPADAVLVAIGRVPNGKNLDAAGVEVDDRGFIRVDKQLRTNVPHIFAIG
AIFM3_HUMAN     TEVSELRGQXXXXXXXXXXXXXRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAG
STHA_SERP5      EEFEKIEGTDDGVIVHLKSGKVKADCLLYANGRTGNTDSLENVGLESDSRGLLKVNSMYQTALSHIYAVG
NORW_AERS4      VSLQFGLGIARIDAVTLTDGTSEQDLVIAAIGLKPNLVLAQAAGLAV--ERGILVDDSLQTSAPHIFALG
HCAD_ECO5E      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANDQLAREAN--LDTTNGIVIDEACRTCDPAIFAGG
HCAD_ECO57      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANDQLAREAN--LDTTNGIVIDEACRTCDPAIFAGG
DLDH_SYNY3      VFATKIKAGSPVEIAKTKEVILEVDACLVATGRIPATKNLETVGVETDRRGFIEVNDQMQVIKDGLWAVG
HCAD_ECOSM      NAIEHVVDGENVELTLQSGETLRADVVIYGIGISANDQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
STHA_YERPY      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPS      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPP      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPN      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPG      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPE      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPB      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERPA      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_YERP3      EEFEQIEGTTDGVIVHLKSGKVKADCLLYANGRTGNTSGLENIGLEADSRGLLKVNSMYQTALSHVYAVG
STHA_PHOPR      ETFEKIEGTDDSIILHLESGKMRADCLLYANGRTGNTDKLNLNKVGLTPDGQLAVNQNYCTDVDHVYAVG
MDAR_SOLLC      TVAVGFHPNGEVKEVKLKDGVLEADIVVVGVGARPLTTLFK--GQVEEEKGGIKTDAFFKTSVPDVYAVG
GSHR_RAT        VEVLTVKKFSQVKEVKTSSGIPDVDCLLWAIGRDPNSKNLNKLGIQTDDKGHILVDEFQNTNVKGVYAVG
STHA_VIBSL      ETFEKIEGTDDGVIIHLESGKMRADCLLYANGRTGNTDKLNAVGLEADSRGQVSVNSNYQTSVEHVYAVG
HCAD_ECOLI      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECOLC      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECOHS      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECODH      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECOBW      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECO7I      NAIEHVVDGENVELTLQSGETLRADVVIYGIGISANDQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECO24      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEVCRTCDPAIFAGG
GSHRP_PEA       ESVAITKAADGSLSLKTNKGTEEGSHIMFATGRSPNTKGLESVGVKVAKDGSIEVDEYSQTSVPSIWAIG
STHA_VIBF1      ENFEHIEANGVIMHLESGK-KMKADCILFANGRTGNTDKLSAVGLEADSRGQLKVNDNYQTDVEHIYAVG
HCAD_ECOSE      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
HCAD_ECO55      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
DLDH_MYCLE      TKVESISDNGSHVLVAVSKDELKADKVLQAIGFAPNVDGLDKVGVALTADKAVDIDDYMQTNVSHIYAIG
TERPA_PSESP     XXXXXXXXCTRVDAVFLSDGLLECDMLVIGVGSEPRMELATAAGLAC--ASGVLVDEHCHTSDPFISAIG
MDARP_ARATH     ASINNLEAGGRVSAVKLADGTIEADTVVIGIGAKPAIGPFETLAMNKS-IGGIQVDGLFRTSTPGIFAIG
DLDH2_ARATH     TKXXXXXXXXXXXIVEPAEGTLEADVVLVSAGRTPFTSDLEKIGVETDKGGRILVNERFSTNVSGVYAIG
TYTR_TRYCO      EKIE-LNPDGSKHVTFESGKTLDVDVVMMAIGRLPRTGYLQTVGVNLTDKGAIQVDEFSRTNVPNIYAIG
STHA_PHOLL      EEYSKIEGVDDGVIVHLKSGKVKADCLLYANGRTGNTDTLKNVGLEADSRGLLKVNKIYQTSNENIYAVG
DLDH_ZYMMO      VTAEIAGADGKVTKERFSHAIV-------AIGVVANVENLDKLGIKL-DRGFIAVDGFGRTNVDHVWAIG
DLDH1_ARATH     TKXXXXXXXXXXXTVEPAEGILEADVVLVSAGRTPFTSDLEKIGVETDKAGRILVNDRFLSNVPGVYAIG
DLDH_RHIET      AKVKVEKGAGSITAVETSDGKVQADRMISAVGVQGNIENLEALGVLTDRRWLVA-DGYGKTNVAGIYAIG
STHA_VIBPA      ETYEKIEGTEDGVIIHLQSGKMRADCLLYANGRTGNTDSLDVVGLESDSRGQLKVNRNYQTAVEHIYAVG
HCAD_SHISS      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
GSHR_NEUCR      VQKDAAGKLANFKEGEGEQSISDVDHLIWAVGRTPAVELDKA-GVKTNEKGYIEVDEYQNTSTENIYAVG
DLDH3_PSEPU     SKVQATASADGVSLVEPAAGSLQADYVLVAIGRRPYTKNLESVGLETDKRGMLA-QRTPPTSVPGVWVIG
TRXR2_BOVIN     CKVEKLPGQQRVTWVDLTSDRKDADTVLWAIGRVPETASLEKAGVHTNPTGKILVDAQETTSVPHIYAIG
STHA_HAMD5      EEFDLIEGLDQGVVVHLKSGKVKADCLFYANGRTGNTKLLENIGLRTDERRFLQVSNLYQTALSHIYAVG
STHA_ERWCT      EEFDSIEGLSDGVIVNLKSGKMKADCLLYANGRTGNTETLENIGLSTDSRGQLKVNSMYQTALAHIYAIG
STHA_COLP3      EEIERVESSEDAVIVHLKSGKMRADCLLFANGRTGNTNLA-AAGLKADGRGQLKVNDCYQTEVDNIFAVG
TRXR2_RAT       CVPSLIRKLPTNQLQVTKEDVGTFDTVLWAIGRVPETRNLEKAGVNTNPKNKIIVDAQEATSVPHIYAIG
HCAD_PHOLL      TNIVSAQKQGSVLILNTGEKVI-GDIIIYGIGAEFRDQLAADAG--LVTDGGIVIDSRCQTSEPDIFAAG
TYTR_CRIFA      AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
DLDH_RALEH      VNVEVTTGKNGVTVKYTDKDTLEVDRLIVSVGRVPNTDNLDAVGLAADQRGFIEVDDHCATKVPGLWAIG
TRXR2_MOUSE     CVPSHIKKLPTNQLQVTKEDTGTFDTVLWAIGRVPETRTLEKAGISTNPKNKIIVDAQEATSVPHIYAIG
TRXR2_HUMAN     CAPSRVRRLGQLDSTTGKEDTGTFDTVLWAIGRVPDTRSLEKAGVDTSPTQKILVDSREATSVPHIYAIG
STHA_VIBCM      ETYDKVEGTSDGVIVHLKSGKMRADCLLYANGRTGNTDKLESVGLQADSRGQLVVNANYQTQVEHIYAVG
STHA_VIBCH      ETYDKVEGTSDGVIVHLKSGKMRADCLLYANGRTGNTDKLESVGLQADSRGQLVVNANYQTQVEHIYAVG
STHA_VIBC3      ETYDKVEGTSDGVIVHLKSGKMRADCLLYANGRTGNTDKLESVGLQADSRGQLVVNANYQTQVEHIYAVG
STHA_KLEP7      EEYEKIEGVDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLQTDSRGQLKVNSMYQTALPHIYAVG
STHA_KLEP3      EEYEKIEGVDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLQTDSRGQLKVNSMYQTALPHIYAVG
NORW_AERHH      VSLQFGTGLARIDGVTLTDGTSEQDLVIAAIGLRPNLALARGAGLAV--ERGILVGDRLQTSDPHIFALG
DLDH_MOUSE      TKVTGAKSDGKIDSVEAASGVITCDVLLVCIGRRPFTQNLEELGIELDPKGRIPVNNRFQTKIPNIYAIG
AIFM1_DICDI     TLIKDVSENGRLTVTLNNGKTFETDHVVVAAGIIPNTNVVKSTTLEIDPNGGYVVNPELQARTD-LYVAG
XECC_XANP2      SNVTRIEANGRVQAVPNGEMRIETDFVFLGLGEQPRSELAKILGLDLGPKGEVLVNEYLQTSVPNVYAVG
GSHR_YARLI      VKKIVKKDNGELLVTYEQDGAITLDSLIWTIGREPDTLNLGEFGIKTNKRGYIEVDEYQRSSVDNIYSLG
DLDH_MYCPN      AQVTRANNNEVFYSQNGQEGSVVGDRILVSIGRIPNTECLDGLNLQRDERNRIVLNQDLQTSIPNIYIVG
TYTR_TRYCR      AKVE-LNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMKNGGVQVDEYSRTNVSNIYAIG
STHA_SODGM      EEYEEIKGLDGVEVRFRSGKRMKADCLLYANGRTGNTDTLKLDKVELDSRGLIKVNSMYQTAARHIYAVG
STHA_ERWT9      EEFEKVEGVADGVIMHLKSGKLKADCLLYANGRTGNTDSLENVGLEADGRGLLKVNSMYQTAQPNIYAVG
DLDH3_BACSU     SR------LGRVDQTAKTEFKTKADYVLVAIGRKPGLQLEQA-GVDFSPKG-IPVNGHMQTNVPHIYACG
STHA_SALPC      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALCH      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_MARMS      ETYDSVETTERGVVMHMASGKLRADALLFCNGRSGNTDNLESINLEVNSRGQLAVNDTYQTQVENVYAAG
NORW_SERP5      QQLGALTQHDEIQATLSNGRQLWVDAAIASVGLRPNVGLARQAGLQI--NRGIQVNNRLQTSQVDVYALG
DLDH_PIG        TKVATKKSDGNIDSIEAASGVITCDVLLVCIGRRPFTQNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
DLDH_CRIGR      TKVTGARSDGKIDSVEAASGVITCDVLLVCIGRRPFTQNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
STHA_SALTY      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALTI      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALPK      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALPB      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALPA      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALG2      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_SALEP      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALENIGLETDSRGQLKVNSMYQTALPHVYAVG
STHA_ENT38      EEYE------RIEACD--DGVIKADCLLYANGRTGNTDALENIGLTTDSRGQLKVNSMYQTALPHIYAVG
DLDH_HUMAN      TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
DLDH_CANFA      TKVTGAKSDGKIDSIEGASGVITCDVLLVCIGRRPFTQNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
STHA_CITK8      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDSLALIGLETDSRGQLKVNSMYQTALPHIYAVG
RURE_PSEOL      AKLTSIKGRGHVEQCVLESGEIQADLIVVGIGAIPXXXXXXXXXXXV--SNGVVVDDQMCTSDTSIYAIG
DLDH_RAT        TKVTGAKSDGKIDSVEAASGVITCDVLLVCIGRRPFTQNLEELGIELDPKGRIPVNTRFQTKIPNIFAIG
DLDH_MACFA      TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
TRXB_METJA      AKPLEIVGEERAEGVKISEEIIKADGIFISLGHVPNTEFLKDSGIELDKKGFIKTDENCRTNIDGIYAVG
DLDH_BUCAP      VKVEKSKDIVKIAEENSDENVCCYDNILVAIGRSPNVDFLEKIGLKLNESGFIEINQQLKTNISHIYAIG
GSHR_KLULA      TKVEKDESTGKLNQLDTGKNIDNVDSLIWTIGRRSLLGLGENIGVKLDAKEQIVVDEYQNSSVKNVYSLG
DLDH_PONAB      TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
DLDH_HAEIN      TKVTAVEAKGIYVSMEACNDTKRYDAVLVAIGRVPNGKLIDAAGVEVDDRGFIHVDKQMRTNVPHIYAIG
AHPF_PSEAE      ALTSEVKGDGQVYKDRNSEEFKSIELIFVQIGLLPNTEWLKG-SVELSPRGEIIVDARGETSLPGIFAAG
STHA_SHIB3      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ESCF3      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOUT      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOSM      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOSE      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOLU      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOLI      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOL6      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOL5      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOK1      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECODH      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOBW      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO8A      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO7I      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO5E      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO57      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO55      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO45      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO27      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECO24      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOLC      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
STHA_ECOHS      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
TRXB_LISMO      T-VEEIVGDGKVSTVDGSESIMPVDGVFIYVGLVPLTKAFLNLGIT-DDEGYIVTDEEMRTNLPGIFAAG
STHA_ECO81      EEYEKIEGCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
MERA_SERMA      ----------------------------------------------------------------------
GSHR_SCHPO      KKVEKLPS-GELCIHQQDGSTFNVDTLLWAIGRAPKIQRLEKAGVKTLPNGIIIADTYQRTNVPTVLSLG
DLDH_MYCGE      AHVVRAENNQLFYTVNGVEQSVIGDKILVSIGRIANTECLDQLDLKRDHNNKIVLNEKLQTSTTNIYLIG
NIR_EMENI       KRVAKIHDDNNVTGILFEDGQLDCCCICFAIGIRPRDELGGSTGIQCAKRGGFVIDESLRTSVNDIYAIG
AHPF_XANCH      AQTTEVLGDGQVYKDRTGGDIQHIELVFVQIGLLPNTEFLRGT-VALSPRGEIIVDDRGQTDVPGVFAAG
DLDH_VIBCH      VTAVEAKEDGIYVSMEGKSAPAQADAVLVAIGRVPNGKLAEKAGLEVDERGFIRVDKQMRTNVPHIFAIG
STHA_SHIFL      EEYEKIESCDDGVIMHLKSGKLKADCLLYANGRTGNTDALQNIGLETDSRGQLKVNSMYQTAQPHVYAVG
MDAR4_ARATH     TVASGFNSNGEVTEVKLKDGTLEADXXXXXXXXXXXXSLFKDQ--VEEEKGGLKTDGFFKTSLPDVYAIG
AIFM2_HUMAN     ERVSNLEELPLNEKVQTDKGTVATNLVILCTGIKINSSYRKAFESRLASSGALRVNEHLQVGHSNVYAIG
YKGC_ECOLI      AHVERISHHENQVQVHSEHAQLAVDALLIASGRQPATASPENAGIAVNERGAIVVDKRLHTTADNIWAMG
AIFM1_RAT       AIVQSVGVSGGKLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
GSHR_CANGA      VKVEKDEKTGKL-SVHLTNGQVLEDVDELIWTMGRRSLLGENVGVKLNDKEQIITDEYQNTNVPNIYSLG
TRXR1_PONAB     IKVEQIEGRLRVVAQSTSEEIIEGEYVLLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
GSHR_YEAST      VKVEKNVETDKLKIMNDSKSIDDVDELIWTIGRKSHLGMSENVGIKLNSHDQIIADEYQNTNVPNIYSLG
GSHR_PLAFK      ADVEIKKVSDKNLSIHLSDGRIHFDHVIYCVGRSPDTEKLEKLNVETN-NNYIVVDENQRTSVNNIYAVG
TYTR_LEIDO      LNTKITKNEDGSNHVHFNDGTEEDDQVMLAIGV-PRSQALQLAGVRTGKNGAVQVDAYSKTSVDNIYAIG
TRXB_CLOLI      V-IEEIKGDGIVESAEVTEFVAPEEDIFVFIGYDPKSALVEGK-LELDETGYIPTDDNMKTNVEGVFAAG
GSHR_PLAF7      ADVEIKKVSDKNLSIHLSDGRIHFDHVIYCVGRSPDTE-----NLNLGKLNVIVVDENQRTSVNNIYAVG
GSHR_CAEEL      XXXXXXXXXGSKKKVTGNGGVEEYDTVIWAAGRVPNLKSLNLDNAGVRTSGKILADEFDRASCNGVYAVG
AIFM2_MOUSE     ERVSNLEELPRNEKVETDKGTVATNMVIVCNGIKINSSYRSAFESRLASNGALKVNEFLQVGYSNIYAIG
AIFM1_MOUSE     AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
AHPF_PSEPU      EKVTGLRYKDRST---DEQHEVALEGIFVQIGLLPNTDWLKGT-VELSPRGEIIVDAKGQTSIPGVFAAG
AHPF_PSEPK      EKVTGLRYKDRST---DEQHEVALEGIFVQIGLLPNTDWLKGT-VELSPRGEIIVDAKGQTSIPGVFAAG
TRXR1_HUMAN     IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
HCAD_SHIF8      NAIEHVVDGEKVELTLQSGETLQADVVIYGIGISANEQLAREAN--LDTANGIVIDEACRTCDPAIFAGG
DLDH_VIBPA      VTAVEAKEDGIYVSMEGKKAPAEADAVLVAIGRVPNGKLGEKAGLEIDERGFINVDKQMRTNVPHIFAIG
BAICD_EUBSP     TNVTALE-QGKVHYIEVTQGVLECDATVICTGIRPSDGL-------------------------------
TRXR1_PIG       IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
TRXR1_MOUSE     TKIEQIEGRLRVTAQSTSEETIEGEFVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
TRXB_LISIN      T-VEEIIGDGXXXXXDGSESIMPVDGVFIYVGLVPLTKAFLSLGIT-DEEGYIVTDEEMRTNLPGIFAAG
DLDH2_BACSU     AKVTKTSDDISIQAEKDGETVTSAEKMLVSIGRQANIE-----GIGLENTGMISVNESCQTKESHIYAIG
TRXR1_BOVIN     IKVEQIEAPGRLRVIQTIEGEY--NTVLLAIGRDACTRKIENVGVKINETGKIPVTEEEQTNVPYIYAIG
AIFM1_HUMAN     AIVQSVGVSSGKLLIKLKDGKVETDHIVAAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
AIFM1_DROME     AKMEAIRSAVRDETLELNNGMLMSDVVVVCVGCTPNTDLAGPSRLEVDRSGGFVVNAELEAR-RNLYVAG
TRXR1_RAT       TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
DLDH_MANSE      VKKEGSTVKVEDVSIEGAKGTMDCDVVLISIGRRPYTKDLDKVGIALDDRGRVPVNNKFQTTVPGIYAIG
TRXR1_DROME     TKQDDGKLLVKYKNVETGEEAEDVDTVLWAKGLVDDLNLPNA-GVTV-QKDKIPVDSQEATNVANIYAVG
TRXB_TREPA      TTLEAVRGETKVSSVETRE--LACDAVFFFIGMVPITGLLP--DAEKDSTGYIVTDDEMRTSVEGIFAAG
TRXB_EUBAC      A-IEEIKGDGIVESAETTEYFANEEDIFVFIGYIPKSDVFKGK-ITLDDAGYIITDDNMKTNVEGVFAAG
DHNA_ARATH      YLVQSIK---RASNLEEDEGIIEADIVLWTVGAKPLLTKLEPSGLPLNARGQAETDETLRVGHPRIFALG
R34K_CLOPA      XXXXXXXXXXXXXXXXXQKTELKADGVFVYIGYEPKTELFKD-SININKWGYIETDENMETNIKGVFAAG
DLDH_SCHPO      TKLLSAKVNGDSVEVENKRETYQTDVLLVAIGRVPYTEGLDKLGISMDKSNRVIMDSEYRTNIPHIRVIG
DLDH_TRYBB      TGIEGVNGTNNVEQAGGQAETLHCDALLVSVGRRPYTAGLEKNNVSLNERGFVKIGSHFETNVAGVYAIG
TRXB_CANGA      VTLEA-QGDGRIKNVKTNEETLPVNGLFYAIGHTPATKIVEGQ-VETDETGYIKTPGSSLTSVPGVFAAG
DLDH_TRYCR      TKVVGGTNNGEVEGKNGKRETVTCEALLVSVGRRPFTGGLDKINVAKNERGFVKIGDHFETSIPDVYAIG
TRXR_PLAF7      ILPKKLTKMDDKILVEFSDKTSELDTVLYAIGRKGDIDGLNLESLNMNSNNKIIADHLSCTNIPSIFAVG
TRXR_PLAF5      ILPKKLTKMDDKILVEFSDKTSELDTVLYAIGRKGDIDGLNLESLNMNSNNKIIADHLSCTNIPSIFAVG
TRXR3_HUMAN     VMVQQLEGKLKVEGTETIEGVY--NTVLLAIGRDSCTRKIEKIGVKINESGKIPVNDVEQTNVPYVYAVG
DHNA_HAEIN      VQLNTMITEAQPNTLITKDGEIKADLIVWAAGVRASTVTQQFDGLEINRINQLVVKDTLQTTVDSIFAIG
YUTJ_BACSU      --------INRANITKVEEGVVSADAIVWTAGIQPN-KVVRDLDVEKDAQGRIVTPHHNLPGDEHLYVVG
TRXB_ASHGO      TAPVEAKGDGRVRDTRTGESDLPVNGLFYAIGHTPATQLVAGQ-VDLDESGYVKTPGSTLTNVPGLFAAG
TRXR3_MOUSE     ILVQQLKGLGKLKVVETVEGIY--NTVLLAIGRDSCTRKLEKIGVKINKNGKIPVNDVEQTNVPHVYAIG
FENR_FRAAA      SEVAAIHGEDRIEKVETRTGVRPAQAVVAALGFTADLGPLTRWGLTMARRH-IAVDSTMFTGVDRVFAAG
TRXB_KLULA      VTLEA-KGDGKVKNVKTNEEYLPVNGLFYAIGHTPATNIVAGQ-VDLDEAGYVKTPGSTLTNVPGVFAAG
FENR_IGNH4      VPKEIIAKDGKATALEGGETVLPLDHLVISIGFEPDLEWVKSLGVNMRGK-EILVDDKMRTNVKGVFAAG
TRXR1_CAEEL     VKTDEKAGKYRVETGEMQEVSEEYNTILMAIGREAVTDDVTTIGVERAKSKKVLGRREQSTTIPWVYAIG
TRXB_CHLMU      EVVKILRSIDIFNNVEKTTVTMEAAGVFFAIGHQPNTAFLGGQ-LSLDENGYIITEKSSRTSVPGVFAAG
PYRD1_PONAB     ----------------TNEKIYGCDFIVSATGVTPNVEFLHGNSFELGEDGGLKVDDHMHTSLPDVYAAG
TRXB_CHLPN      ISGDSIVRSVDIKNVQTQEITTEAAGVFFAIGHKPNTDFLGGQ-LTLDESGYIVTEKTSKTSVPGVFAAG
AIF1_YEAST      VGASLDTSPKRIFLGEGSSKYIDADLIYRGVGISPNVPV-NSISDLCDKKGFIQVEKNFRVEAGNVFAIG
AHPF_ECOLI      AQTTEVKGDGKVVGLEYRDRVIELAGIFVQIGLLPNTNWLEG-AVERNRMGEIIIDAKCETNVKGVFAAG
PYRD1_HUMAN     ----------------TNEKIYGCDFIVSATGVTPNVEFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAG
GLTD_ECOLI      GKVSGVKGRRRAEIVAGSEHIVPADAVIMAFGFRPNMEWLAKHSVELDSQGRIGSDNAFQTSNPKIFAGG
TRXR2_DROME     PKAVERQADGRLNTTTQMDGSDVFDTVLWAIGRKGLIENLDAAGVKT-HDDKIVVDAAEATSVPHIFAVG
TRXB_CHLTR      VD----------ETTTTME----AAGVFFAIGHQPNTAFLGGQ-VALDENGYIITEKSSRTSVPGVFAAG
PYRD1_MOUSE     --------------VELTNGTIGCDFLVSATGVTPNVHFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAG
PYRD1_BOVIN     ----------------TNEKIYGCDFIVSATGVTPNTEFLCGNNFDVGEDGGLKVDDHMHTSLPDIYAAG
OOXA_AGRT4      VRSIAIIGSQHAESVRYAVGQIPAKSVLLHQGVIPSTSLSNAAGCEL-----------------------
FENR_NOCSJ      AEVSAIRGNGVVESIETVDGESPAQAIVAALGFVADLGPLQQWGLDVEKRHLVV-DSSMRTNLARVFAAG
PYRD1_RAT       ----------------TNGSIYGCDFLVSATGVTPNVQFLHGNDFDLGEDGGLRVDEQMRTSLPDIYAAG
AHPF_STAAR      AKTTEVVGENHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLKD-AVELNERGEIVIDRNNNTNVPGIFAAG
TRXB2_YEAST     VALEA-KGDGKLLRIKNTKSNVENDLLFYAIGHSPATDIVKGQ-VDEEETGYIKTPGSSLTSVPGFFAAG
OOXA2_RHIME     VRSIAITGSERAEGVRFTEQAIPASSVLLHQGVIPSTNLTNAAGCELQRAFEPVTDNEGRSSRQGIYVAG
FENR_SULSO      LKEVKGDGNKVTQAITKEEKVLDVDSVIISIGYKGDLGNIPKWGVTMKGRD-IVVNGRMETNLPGVYAGG
AHPF_STAAW      AKTTEVVGEDHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLKD-AVELNERGEIVIDRNNNTNVPGIFAAG
AHPF_STAAN      AKTTEVVGEDHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLKD-AVELNERGEIVIDRNNNTNVPGIFAAG
AHPF_STAAM      AKTTEVVGEDHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLKD-AVELNERGEIVIDRNNNTNVPGIFAAG
TRXB_BACSU      TVKEIHEENGKVDTVTGEESEFKTDGVFIYIGMLPLSKPFENLGIT-NEEGYIETNDRMETKVEGIFAAG
DLDH_BUCBP      SNV--------IKIVQEKNGLLVHDIILVAIGRVPNTDMLDIVGLKTDNNGFIKVNEQFCTNIPNIYAIG
AHPF_STAAC      AKTTEVVGEDHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLND-AVELNERGEIVIDRNNNTNVPGIFAAG
AHPF_STAA8      AKTTEVVGEDHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLND-AVELNERGEIVIDRNNNTNVPGIFAAG
TRXB_STRCO      LKLR------NVKTGELSD--LPVTGLFIAIGHDPRTELFKGQ-LDLDPEGYLKVDASTRTNLTGVFGAG
TRXB_MYCPU      ASVKELHGKDALEYAIVNHNGKEVKLEVASLGFLPSAEYAKNAGV-LEPNGFIKTDEFMETKVPGIYAIG
FENR_LACAC      ---------------------VQLDQIVVAYGFRANNRFAKKWGINLEQSN-IPVDPTMKTNIDGIYAAG
YUMB_BACSU      TAVQECTPEGRVGKKDEEPEQIKSQTVVWAAGVRGHPIVEEAGFENM--RGRVKVNPDLRAGHDNVFILG
FENR1_BACP2     ---------GEIERIET-------DAVIVNHGMKGDLSVLSEWGLKQGEWGLIEVNEKMETNLPGVYAVG
YGFK_ECO57      LRVMSLGEKGRRRPVETNETVLHVDSLITAIGEQQDTEALNAMGVPLDKNGWPDVDHNGETRLTDVFMIG
TRXB_RICBR      VKIQ------NVHTKETS--LVNCSGVFVAIGHKPNTALFAEQVTMDNDNYIITTPGSTKTNIEGVFAAG
TRXB1_YEAST     VALEA-KGDGKLNTKKNEETDLPVSGLFYAIGHTPATKIVAGQ-VDTDEAGYIKTPGSSLTSVPGFFAAG
TRMFO_DESDG     VLKQEMRALGSL-VMEVAEATVPAGKALAV----DRGLFAASMTAAMEAEPGITLIRREITSLDDVIAAG
GLTD_RHOSH      VIVQKMRGRQMPEIIEGADYVEPADLAIMALGFEPE-DLPTLWGVTVTRWGTIKADFRTHTSLPGVYAVG
GLSN_MEDSA      -------GKFQFKEIEGSEEIIEADLVLLAMGLGPEATIAEKLGVERDNRSNFKADGRFSTSVDGVFAAG
FENR_SULTO      LKEVRGDGNRVTQAVTKDEKILDVDAVIISIGFKGDLGNMPKWGVNMKGRDIIV-NAKMETNLPGVYAAG
FENR_PROA2      ------------------EEVIDADCLLLLIGFKSNLGPIAQWGLEL-QDNAIVVDNQMKTSVDGLYAAG
FENR_LACH4      ------KGMGDVQSRHEQ-----FDQIVVAYGFKADNRFIKNWGIELNGTN-IAVDPTMKTNIDGIYAAG
AHPF_STAAS      AKTTEVVGEDHVTGIRYEEHLLNLDGIFVQIGLLPNTSWLKD-AVELNERGEIVIDCNNNTNVPGIFAAG
AHPF_SALTY      AQTTEVKGDGKVVGLEYRDRVVALAGIFVQIGLLPNTHWLEG-ALERNRMGEIIIDAKCETSVKGVFAAG
TRXB_STAAW      TLKSINEKDGKVGSVDGSEETHEADGVFIYIGMKPLTAPFKDLGIT-NDVGYIVTKDDMTTSVPGIFAAG
TRXB_STAAS      TLKSINEKDGKVGSVDGSEETHEADGVFIYIGMKPLTAPFKDLGIT-NDVGYIVTKDDMTTSVPGIFAAG
TRXB_STAAN      TLKSINEKDGKVGSVDGSEETHEADGVFIYIGMKPLTAPFKDLGIT-NDVGYIVTKDDMTTSVPGIFAAG
TRXB_STAAM      TLKSINEKDGKVGSVDGSEETHEADGVFIYIGMKPLTAPFKDLGIT-NDVGYIVTKDDMTTSVPGIFAAG
TRXB_STAAC      TLKSINEKDGKVGSVDGSEETHEADGVFIYIGMKPLTAPFKDLGIT-NDVGYIVTKDDMTTSVPGIFAAG
TRXB_PENCH      NKPNGLMTHLRVKDVSNAEEVVEANGLFYAVGHDPASGLVKGQ-VELDDEGYIITKPGTSTNVEGVFACG
GLTD_AZOBR      VRVADATGRQTPQVIEGSEFTVQADLVIKALGFEPE-DLPNAFDLKVTRWGTLLVDHRTKTNMDGVFAAG
FENR_FRASC      TEVAMVHGIEKVELVQTRTGVRPAQAVVAALGFTADLGPLTRWNLTIDKRH-IVVDPTMATGVERIFAAG
AHPF_STAES      AKTTEVIGDDYVEDMTTGESVVNLDGIFVQIGLVPNTSWLQN-AVELNERGEVMINRDNATNVPGIFAAG
AHPF_STAEQ      AKTTEVIGDDYVEDMTTGESVVNLDGIFVQIGLVPNTSWLQN-AVELNERGEVMINRDNATNVPGIFAAG
TRXB_STAAR      TLKSINEKDGKVGSVDGSEETHEADGVFIYIGMKPLTAPFKDLGIT-NDVGYIVTKDDMTTSAPGIFAAG
TRMFO_EXISA     VLKEEMRTLDSLILKAADTASVPA----------------------------------------------
IRC15_YEAST     TRVQLAENITLLNKVSKKTYVHHCDVLMVSIGRRP---LLKGLDIS-----SIGLDERDFVE--------
FENR1_SULAC     LKEVKGDGSKVTQAVTKEEKTLDVDAVIISIGHKG--DLGNMVKWGLNMKGSITVNGKMETNLAGVYAAG
YGFK_ECOLI      LRVMSLGEKGRRRPVETNETVLLVDSLITAIGEQQDTEALNAMGVPLDKNGWPDVDHNGETRLTDVFMIG
TRXB_RICPR      -KPKAVTGV-KIQNVYTNENLVNCSGVFIAIGHAPNTALFKGQ-IAIDDDNYIVTQSSTRTNVEGVFAAG
TRXB_HELPY      YVVEEIKGIKNTATNEKRELVVPGFFIFVGYDVN-NAVLKQSMLCKCDEYGSIVVDFSMKTNVQGLFAAG
TRXB_BORBU      IEVDGKSSVSSVKIFNKKDNVVEVSAVFMAVGYKPNTEFLKGF-LDLDEEGFIVTKDVVKTSVDGVFSCG
FENR1_BACA2     YRLKHLNGTGRIESVQTESGVIKLDELVINHGFKIDLGPMKDWGLEI-EEGRIKADRHMRTNLPGVFVAG
TRXB_STAES      TLKTINEKDGKVGSVDGAEQTYDADGVFIYIGMKPLTAPFKNLGIT-NDAGYIVTQDDMSTKVRGIFAAG
TRXB_STAEQ      TLKTINEKDGKVGSVDGAEQTYDADGVFIYIGMKPLTAPFKNLGIT-NDAGYIVTQDDMSTKVRGIFAAG
TRXB_HELPJ      YVVEEIKGIKNTATNEKRELVVPGLFIFVGYDVN-NAVLKQSMLCECDEYGSIVVDFSMKTNVQGLFAAG
FENR_METS5      LKEVKGDGNRVTQAITKEEKTLNVDAVIISIGHKG--DLGNMLKWGLNMKGRIVVNGKMETNLPGVYAVG
FADB_ECOLU      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRPDTVLA------------------------------
FADB_ECO7I      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRPDTVLA------------------------------
OXLA_AGKRH      ----------------------------------------------------------------------
GLT1_SCHPO      VEV------GKNGDVSLDELHKVYDAVVLASG--------------------------------------
FENR_CHLTE      HEVERARANGTIDSIEESNGVVEADRLLILIGFKSNLGPLARWDLELYEN-ALVVDSHMKTSVDGLYAAG
BAIH_EUBSP      ----------------------------------------------------------------------
RAX2_SCHPO      ----------------------------------------------------------------------
FENR_LACF3      VNADQSVTLNLKKMRADEERPLEVDKVLVNYGFTSNNAALKDWSLDLASEGQIKVDQTMKTSVPGVYAIG
FENR_CHLCH      IDVENEELKAHVQSKNGKTRTFPADRLLLLIGFKSNIGPLAEWGLEI-VDNALVVDSHMKTSVDGLYAAG
DHNA_BACYN      AQTKEITGDDKVNGISDTEEVHHIELVFVQIGLVPNTDWLDGT-LERNRFGEIVVDSHGATNVPGVFAAG
TRXB_NEUCR      DDKGLMSHLVVKDVTTGKEETLEANGLFYAIGHDPATALVKGQLETDADGYVVTKPGTTLTSVEGVFAAG
FENR_MAGSA      YQLHGLEGEGTLSAVATLEGELPADVLLPFYGL--SSDLGPIAQWNLGDRNLIAVDPATATDAPGIYAAG
FENR_CHLL2      TEVTAIEGMKNVTLLRKNGAVLEADRLLILIGFRSNLGPLAEWDLEL-VDNALVVDSHMKTSVDGLYAAG
FADB_ECO5E      LKLAGYAGFERVEAIVENPKVKKAVLAETEQKVRPDTVLA------------------------------
FADB_ECO57      LKLAGYAGFERVEAIVENPKVKKAVLAETEQKVRPDTVLA------------------------------
DHNA_BACSU      AQTKEITGDQSVNGIETGEEKVELQGVFVQIGLVPNTEWLEGT-VERNRMGEIIVDKHGATSVPGLFAAG
TRXB_MYCGE      --------------VDKSESEIAIDCLFPYIGFESNNKPVLDLKLNLDQNGFILGDENMQTNIKGFYVAG
TRXB_DICDI      TTLVEIKGEKSVTSVGNSETKVSSNLLFYAIGHTPNSAFLNGQ-LNTDETGYIITQPSTKTNVEGVFACG
TRXB_COXBU      VIEEVLTGVHLKHVKEEKTQDLTIDGLFIAIGHDPNTKIFKEQ-LEMDEAGYLRAKSGLQTNIPGVFAAG
TRMFO_BACCN     VIKEEMRRMDSVIIRAADECSVPA----------------------------------------------
KMO_USTMA       LRSVSLAGLG--VGTNAPNGMDLADLVL------------------------------------------
FENR_SYMTH      YELRRVEGDGNWVKKATEETTIDVDCVIIGTGFKASLGSMLEWGLEIENKRQIVVNSKGETNIPGVYAAG
FENR_PROVI      TEVASIRGEGQLRRKNASVCTVEADRLLLLIGFKSNLGPIANWGLEL-VDNAVVVDAHMKTSVDGLYAAG
FENR_CHLPD      TEVTAIDTSGKVHLCKKNGTQVEADRLLVLIGFKSNLGPLADWDLEL-VDNALVVDSHMKTSVDGLYAAG
FENR_BRASB      ANLAAASIKGNDNSVET----VACDMMLPFFGLTMKLGPVADWGIALENNLIPVETSAFETSVPGIFAIG
FENR2_CHLT3     YELKSIVGKDSPQGKENEETTLEVDAILCNLGFSTNLGPIKNWGVEI-LNNAVKVDVNMATNVTGIYAAG
DADA2_PSEAE     ----------------------------------------------------------------------
TRMFO_BACSU     VLKEEMRALDSAIIAAADECSVPA----------------------------------------------
STCD_RHIME      SQCEKFNTWAEAEAIQAES----PDVVIIATGGLPHTELSRGNELVVSAWDIISGDAKPGTNVLIFDDAG
FIXC_SHIFL      IRVDNLQRDGKVVGVEADGDVIEAKTVLLADGV--NSILAEKLGMA------------------------
FENR_ACIC1      YQVSAVYGDDRVTAVDVTDHDLDVDEIVAALGFVAELGPLAEWGMELRQRH-IVVDTTMATSVPRIYAAG
FENR2_SULAC     LKEVKGDGSKVTQAVTKEEKTLDVDAVIISIGHKGDLGNVPRWGLNMKGRD-ILVNAKMETNLPGVYAAG
TRXB1_ARATH     SVVEAY-GDGERDVLGKVKNVVTGDVLFFAIGHEPATKFLDG-GVELDSDGYVVTKPTTQTSVPGVFAAG
FENR_SALAI      AEITVRGGAAEL---------LPVDTVVAALGFTADLGPLTEWGLRLDRRH-IVVDSTMATNLPRVFAAG
FENR1_BACSU     YRLEQLNG--------DEEGIKSVTVCHTESGQRKDIEIDELIKIDLGPMGRVKADRHMRTNLPGVFVAG
TRMFO_EXIS2     VLKEEMRQLDSLIMKAADLASVPA----------------------------------------------
TRMFO_BACP2     VLKEEMRHLDSXXXXXXDESSVPA----------------------------------------------
MNMC_BURS3      ----------------------------------------------------------------------
FIXC_ECOLI      IRVDNLQRDGKVVGVEADGDVIEAKTVILADGV--NSILAEKLGMA------------------------
FIXC_ECOL6      IRVDNLQRDGKVVGVEADGDVIEAKTVILADGV--NSILAEKLGMA------------------------
FIXC_ECO57      IRVDNLQRDGKVVGVEADGDVIEAKTVILADGV--NSILAEKLGMA------------------------
FENR_METPP      -QVTGFEATGQLRSVKVTGGVVPLDMLLVFFGLSPKLGPIAEWGLNIERKQVVVDTEKFETNVPGIFAVG
FENR2_BACP2     FVPTELIGEDRIEQIVLEEQVLDVDDVIVNFGFVSSLGPIKQWGLEI-EKNSIVVKSTMETNIEGFYAAG
FADB_YERE8      ANILAYAGIERVEAVVENPKVKAAVLAEVETLIGEETVLA------------------------------
TRXB_STRCL      LTLRD------TKTGETRE--LAATGLFIAVGHDPRTELFKGQ-LDLDDEGYLVASPSTRTNLTGVFAAG
TRXB_PNECA      VALESLGDNNKIKNVKTQESELQVNGLFYAIGHEPATTLVRGQ-VECDKDGYIITKNGPETNIKGFFAAG
TRXB_MYCSM      TEITQIEGDPKVTGVRLRDTVTGEESKLDVTGVDPRSELVRGQ-VELDDEGYVKVQGRTTTSLDGVFAAG
TRMFO_STAAW     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAT     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAS     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAR     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAN     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAM     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAE     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAC     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAAB     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAA9     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAA8     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAA3     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAA2     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_STAA1     VLKEEMRRLNSIIIEAADKARVPA----------------------------------------------
TRMFO_LYSSC     VIKEEMRILDSVILKAADQCSVPA----------------------------------------------
GSHR_DEBHA      LGVNIIKQSGSVSKVEKIDG--DRKKITLGNGVLEVDELIWTMGIGLDKVGVTLNDKXXXXXXXXXXTA-
FENR_THET8      YELRRVEGDERVRWAQTQEELLEVDAVLILAGYITKLGPLANWGLAL-EKNKIKVDTTMATSIPGVYACG
FENR_THET2      YELRRVEGDERVRWAQTQEELLEVDAVLILAGYITKLGPLANWGLAL-EKNKIKVDTTMATSIPGVYACG
FENR_PELLD      ---------------------VEADRLLLLIGFKSNLGPLADWGLEL-VDNAVEVDGHMKTSVDGLYAAG
FENR_LACDB      ------------------------DQILVAYGFRADNRFVSKWGVDLDQ-GLIAVDRSMQTSVPGIYAIG
FENR_LACDA      ------------------------DQILVAYGFRADNRFVSKWGVDLDQ-GLIAVDRSMQTSVPGIYAIG
FENR_FLAPJ      GEVVGFKGSEKIESVDTTLTTVPCDYFIPLFGLTPKLGAIANWGLEI-EKNAIKVNNALQTNIEGIYAIG
FENR_CHLP8      ------------------EWTVEADRLLILIGFKSNLGPLAGWDLELAEN-ALVVDSHMKTSVDGLYAAG
FENR1_CHLT3     ------------------EITIEATRLLPLIGFRSNLGPIKNWGIEISGNG-ILVDNHMQTTVEGIYAAG
FADB_SHISS      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRQDTVLA------------------------------
FADB_SHIFL      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRQDTVLA------------------------------
FADB_SHIF8      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRQDTVLA------------------------------
FADB_ECOLI      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRQDTVLA------------------------------
FADB_ECODH      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRQDTVLA------------------------------
FADB_ECOBW      LKLAGYAGFDRVEAVVENPKVKKAVLAETEQKVRQDTVLA------------------------------
TRXB_RICTY      ----------KIKNVYTNENLVNCSGVFIAIGHTPNTTLFNGQ-IAIDDDNYIITQTSTRTSVEGVFAAG
TRXB_RICCN      ----------KIQNVHTKESLLNCSGVFIAIGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAG
TRXB2_ARATH     AVVEAYGDEGRVLGGLKVKNVVTGDVLFFAIGHEPATKFLDGQ-LELDEDGYVVTKPTTKTSVVGVFAAG
TRMFO_STAES     VLKEEMRHLDSLIITSADKARVPA----------------------------------------------
TRMFO_STAEQ     VLKEEMRHLDSLIITSADKARVPA----------------------------------------------
TRMFO_LISIN     VIKEEMRLLDSIIIESADKASVPA----------------------------------------------
TRMFO_BACWK     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACHK     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACCZ     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACCR     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACCQ     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACC7     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACC4     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACC3     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACC2     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACC1     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACC0     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACAN     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACAH     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACAC     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
TRMFO_BACAA     VIKEEMRLMDSVIIRAADECSVPA----------------------------------------------
OXLA_CROAT      ----------------------------------------------------------------------
OXLA_CROAD      ----------------------------------------------------------------------
MNMC_PSEU2      ----------------------------------------------------------------------
MNMC_PSE14      ----------------------------------------------------------------------
LNT_RHILO       TSV-PFLFTERPDAL-TALGDMLADGQMLIAGV-----------VREEGGSAASTDSRYYNSVVAINDRG
FENR_NEOSM      YQITGLRGSGQISHIETGESVLEADYLLAFFGLKPSLRHLEEWGIEITHNCINVDPLTCSTNIKGVYAVG
FENR_CHLPB      TEVIAIDHDGPLRSKSGKETSLEAEYMLVLIGFKSDLGPLAEWGLELCEN-AMVVDSQMKTEVDGLYAAG
FENR2_BACLD     FVPTELIGSERIEQIVIEEEIIDVDDVIVNFGFVSSLGPIKNWGLEI-EKNSIVVKSTMETNIEGFYAAG
FADB_SERP5      ----------------------------------------------------------------------
Y1834_STAS1     TPIVAANEKGFVVKVNDEEQQLEANTVVWAAGVR------------------------------------
TRXB_MYCPN      -------------------------------GFESITKPVEHLNLKLDPQGFLITNEQMETSLKGLFAAG
TRMFO_LISMF     VIKEEMRILDSIIIEAADKASVPA----------------------------------------------
PURT_DESVM      LPVPALRQNGAASCVVLAEGGIEAALAEPDTGLKPEVHGKRRMGVAL-----------------------
OXLA_PSEAU      ----------------------------------------------------------------------
OXLA_BOTJR      FSQENENAWYFIKNIRKRVGEVNKDPGVLDYPVKP-SEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKY
OXLA_AGKHA      ----------------------------------------------------------------------
MNMC_PSEE4      ----------------------------------------------------------------------
MNMC_ACIBC      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
CDR_PYRFU       DVAETKHVITGKRVWIPLAPAGNKMGYVAGSNIAGKEIEFPGVLGTSITKFMDLEIGKTGLTENEAVKEG
CDR_PYRAB       DVAETKHVITGRRVWVPLAPPGNKMGYVAGSNIAGKEIHFPGVLGTTVTKFLDVEIGKTGLTETEALKEG
CDR_PYRKO       DVAETKHLITGRRVWMPLAPAGNKMGYVAGSNIAGKEIHFPGVLGTSITKFLDLEIGKTGLTEAEAMKEG
CDR_PYRHO       DVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEG
NAOX_METJA      DCVEVIDFITGEKTLSPFGTAAVRQGKVAGKNIAGVEAKFYPVLNSAVSKIGDLEIGGTGLTAFSANLKR
NAOX_STRP6      DCATIYDNATRDTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLG
CDR_STAES       DVITSHYRHVNLPAQVPLAWGAHRGASIIAEQLSGNSSHFKGYLGNNIVKFFDYTLASVGIK-PNELKNF
CDR_STAEQ       DVITSHYRHVNLPAQVPLAWGAHRGASIIAEQLSGNSSHFKGYLGNNIVKFFDYTLASVGIK-PNELKNF
CDR_STAAN       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAAM       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAA9       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAA2       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAA1       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAAW       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAAS       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAAB       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAAR       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
NAPE_ENTFA      DATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
CDR_STAAC       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
NAOX_LACLM      DVATIYSNALQDFTYIALASNAVRSGIVAGHNIGGKELESVGVQGSNGISIFGYNMTSTGLSVKAAKKLG
CDR_STAA8       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAHJ       DVITSTYRHVNLPAQVPLAWGAHRGASVIAEQLAGKNIIFKGFLGTNIVKFFDYTLASVGIKVEELTH--
CDR_STAAT       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAAE       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
CDR_STAA3       DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
NAOX_ENTFA      DSAVVHYNPSQTKNYIPLATNAVRQGMLVGRNLTEQKLAYRGTQGTSGLYLFGWKIGSTGVTKESAKLNG
CDR_STAS1       DIITSHYRHVDLNAHVPLAWGAHRGASVIAEQLAGHKIHFKGYLGSNIVKFFDYTFASVGVS----PKEL
NAOX_MYCPN      GAAAIYDAASEQYENIDLATNAVKSGLVAAMHMIGSKAKLESIVGTNALHVFGLNLAATGLTEKRAKMNG
NAOX_MYCGE      GCAAIYNAASEQYENIDLATNAVKSGLVAAMIIGSNQVKLQSIVGTNALHIFGLNLAACGLTEQRAKKLG
THCD_RHOER      DCA-------------------------------------------------------------------
MERA_STAES      DVTLGPQFVYVAAY--EGGIVAN---NALGLAKRKIDLRFVGVTFT------NPSIATVGLTEQQAKEKG
MERA_STAAU      DVTLGPQFVYVAAY--EGGIVAN---NALGLAKRKIDLRFVGVTFT------NPSIATVGLTEQQAKEKG
TODA_PSEP1      DVA-------------------------------------------------------------------
MERA_ENTAG      DCTDQPQFVYVXXXXXXXXXI---------NMTGGDAALDLTAMPAVVFT--DPQVATVGYSEAEAHHDG
BEDA_PSEPU      DVA-------------------------------------------------------------------
CAMA_PSEPU      DCARFHSQLYDR--WVRIESVPNEQARKIAAILCGKVPR-------------------------------
AIFM3_MOUSE     DLAWRNNRKVNIPHW----QMAHAQGRVAAQNMLAQEAEINTVLWTAMF---------------------
MERA_THIFE      DCTDQPQFVYVXXXXXXXXXI---------NMMGGSAALDLTAMPAVVFT--DPQVATVGYSGAEAHRDG
MERA_SHIFL      DCTDQPQFVYVXXXXXXXXXI---------NMTGGDAALNLTAMPAVVFT--DPQVATVGYSEAEAHHDG
MERA_PSEFL      DCTDQPQFVYVXXXXXXXXXI---------NMTGGDRALNLTAMPAVVFT--DPQVATVGYSEAEAHHDG
MERA_SHEPU      DCCNMPQFVY----------VAAAAGSRSGINMTGGYAKLLSTMPAVIFT--DPQVATVGLTEEQANAQD
MERA_BACCE      DVTPGPQFVYVAAY---------EGGLAARNAIGGLNQKVLEVVPGVTFTS--PSIATVGLTEQQAKEKG
DLDH_CHLMU      DITGKWQ----------LAHVASHQGIVAARNIAGHKDEIYSAVPSVIFTFPE--VASVGLSPTSAQQQG
MERA_PSEAE      DCTDQPQFVYVXXXXXXXXXI---------NMTGGDAALDLTAMPAVVFT--DPQVATVGYSEAEAHHDG
GSHRP_SPIOL     DVTNRMN----------LTPVALMEGTCAKTVFGGQNSKDYSNIACAVFSIPPLAV--VGLSEEQAIEQA
BPHG_BURXL      DVA-------------------------------------------------------------------
TODA_PSEPU      ----------------------------------------------------------------------
BNZD_PSEPU      ----------------------------------------------------------------------
DLDH_HALVO      DVVEDTPM---------LAHVASKEGIVAAEHVAGEPVAFSQAVPAAVFT--DPEIGTVGMTEADAEEAG
NORW_ECO5E      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECO57      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOLI      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOLC      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECODH      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOBW      DCAEINGQVL--PFLQPI----------------------------------------------------
NASD_BACSU      ECAE--HRGIAYGLVAPLYEQAKKHKPYEGSVLSTQ----LKVSGVEVFSAGD-----------------
DLDH_THESC      DVA--------RPPL--LAHKAMKEGLVAAENAAGKNALFDFQVPSVVYTGPEW--AGVGLTEEEARKAG
NORW_SHIB3      DYAEINGQVL--PFLQPI----------------------------------------------------
NORW_SHIBS      DYAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOSE      DCAEINGQVL--PFLQPI----------------------------------------------------
GSHRC_ARATH     D---------------------------------------------------------------------
DLDH1_PSEPU     DVAGE----------PMLAHRAMAQGEMVAEIIAGKARRFEPAAIAAVCFT-DPEVVVVGKTPEQASQQG
NORW_ECOL5      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOHS      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECO8A      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECO55      DCAEINGQVL--PFLQPI----------------------------------------------------
GSHRC_BRARP     D---------------------------------------------------------------------
DLDH_CHLPN      DITGK---------WL-LAHVASHQGVIAAKNISGHEVMDYSAIPSVIFTHPEIAM--VGLSLQEAEQQN
RURE_ACIAD      DCAEVNGTLL--PYVMPIMQQARALAKT------------------------------------------
NORW_ECO27      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOUT      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOSM      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOK1      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECO45      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECO24      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_SHISS      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ESCF3      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_SHIDS      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ECOL6      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_SHIFL      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_SHIF8      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_KLEP7      DCAE------------------------------------------------------------------
NORW_ECOLU      DCTEINGQVL--PFLQPI----------------------------------------------------
NORW_VIBFM      DCAEIEGKVM--AYLQPILLSANALAKT------------------------------------------
NORW_SALA4      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_KLEP3      DCAEINGTVL--PFLQPI----------------------------------------------------
GSHRC_PEA       DV--------------------------------------------------------------------
NORW_SALTY      DCAEINGQVL--PFLQPI----------------------------------------------------
DLDH1_PSEAE     DLAGE----------PMLAHRAMAQGEMVAELIAGKRRQFAPVAIPAVCFT-DPEVVVAGLSPEQAKDAG
MERA_STRLI      DVTCHPDFVY----------VAAAHGTVADNALDGAE-RTLDYTALPKVTFTSPAIASVGLT-EAQLTEA
DLDH3_HALMA     DVA-------------------------------------------------------------------
NORW_CITK8      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_SALHS      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_SALEP      DCAEINGQVL--PFLQPI----------------------------------------------------
NORW_ERWCT      DCAEIGGKLL--PFLQPI----------------------------------------------------
GSHRC_ORYSJ     DV--------------------------------------------------------------------
DLDH1_BACSU     DIIE------------------------------------------------------------------
NORW_SALSV      DCAEINGQVL--PFLQPI----------------------------------------------------
MDAR2_ARATH     DVATFPVKLFGEMRRLEHVDSARKSARHAVSAI-------------------------------------
DLDH_CHLTE      DV--------RGGMLLXXXXXXXXXXXXXXXXXXXPEPLSEPLIPRCV