[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81847.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
   20::316     1e-50  49%  319 aa  YUFQ_BACSU RecName: Full=Uncharacterized ABC transporter permease
   17::303     3e-18  26%  306 aa  Y121_MYCGE RecName: Full=Uncharacterized protein MG121;
   28::198     3e-11  26%  311 aa  Y260_MYCPN RecName: Full=Uncharacterized protein MG121 homolog;
   60::283     3e-06  28%  348 aa  YUFP_BACSU RecName: Full=Uncharacterized ABC transporter permease
  181::227     2e-05  43%  336 aa  MGLC_SALTY RecName: Full=Galactoside transport system permease
  181::227     2e-05  43%  336 aa  MGLC_ECOLI RecName: Full=Galactoside transport system permease
  154::207     2e-04  37%  333 aa  LSRC_PHOTE RecName: Full=Autoinducer 2 import system permease
  157::207     3e-04  35%  351 aa  LSRC_YERPP RecName: Full=Autoinducer 2 import system permease
  157::207     3e-04  35%  351 aa  LSRC_YERPN RecName: Full=Autoinducer 2 import system permease
  157::207     3e-04  35%  351 aa  LSRC_YERPG RecName: Full=Autoinducer 2 import system permease
  157::207     3e-04  35%  351 aa  LSRC_YERPE RecName: Full=Autoinducer 2 import system permease
  157::207     3e-04  35%  351 aa  LSRC_YERPA RecName: Full=Autoinducer 2 import system permease
  142::220     4e-04  32%  322 aa  RBSC_BACSU RecName: Full=Ribose transport system permease protein
  153::206     5e-04  41%  343 aa  LSRC_ENT38 RecName: Full=Autoinducer 2 import system permease
  104::200     9e-04  35%  315 aa  LIVH_METJA RecName: Full=Probable branched-chain amino acid
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxPLLLTALGGMFSERSGVVNIALEGILLFGXXXXXXXXXXXXXXXGPGPHP
YUFQ_BACSU      --------------------PLILTALGGVFSERSGVVNIGLEGLMIIGAFTSVLFNLFFGQELGAAA--
Y121_MYCGE      ---------------------LLLAVLSGYLAERVGIINIAINGGMVFGGLFMALLSYGFTNNLNQSAPS
Y260_MYCPN      ----------------------------GYLSERVGIVNIAINGGMVFGGMFLSLMSYAFVPNANDSAPS
YUFP_BACSU      --------------------PYILSGLAVAFAFRTGLFNIGVEGQLLVGWTAAVWVGTAFD---GPA-YI
MGLC_SALTY      ----------------------------------------------------------------------
MGLC_ECOLI      ----------------------------------------------------------------------
LSRC_PHOTE      ----------------------------------------------------------------------
LSRC_YERPP      ----------------------------------------------------------------------
LSRC_YERPN      ----------------------------------------------------------------------
LSRC_YERPG      ----------------------------------------------------------------------
LSRC_YERPE      ----------------------------------------------------------------------
LSRC_YERPA      ----------------------------------------------------------------------
RBSC_BACSU      ----------------------------------------------------------------------
LSRC_ENT38      ----------------------------------------------------------------------
LIVH_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WLPWXXXXXXXXXXXXXXFVHALVSIKYRADQIISATAINLLALGAPSLVLTYFYGNATSSKEVENRLPL
YUFQ_BACSU      --PWXXXXXXXXXXXXXXXIHAAAAISFRADQTVSGVAINMLALGATLFIVKLIYGKAQTDKIPEGDIPV
Y121_MYCGE      WSLFITIPLSVLFSSVIGCLFALAAVKLRADHVIVGTGINLLASG----ITLFISQNAASTLRVRYLFPI
Y260_MYCPN      WSLAISIPLSVIFASAVGFLFGIAAIKLKADHVIVGTGVNLLGTGINFFVAQNARSNDTDLRVRYSFVRT
YUFP_BACSU      HLPXXXXXXXXXXXXXX-FIPGILKARFYVHEVIVTIMMNYIALHMTNYIISVLTDHQDKTGKIHESASL
MGLC_SALTY      ----------------------------------------------------------------------
MGLC_ECOLI      ----------------------------------------------------------------------
LSRC_PHOTE      --------------------------------------------------------------------PL
LSRC_YERPP      ----------------------------------------------------------------------
LSRC_YERPN      ----------------------------------------------------------------------
LSRC_YERPG      ----------------------------------------------------------------------
LSRC_YERPE      ----------------------------------------------------------------------
LSRC_YERPA      ----------------------------------------------------------------------
RBSC_BACSU      ------------------------------------------------LTLVYTDGNPITGLGTNYGFQM
LSRC_ENT38      ----------------------------------------------------------------------
LIVH_METJA      --------------------------------MIATLAIDLILLGAYSEILSQIVGS-TQAKFVFANLDL


                         +         .         .         .         .         *         .:210
query           WGPEGFQLSPLVYAAFLLVPLTWWVLFKTPFGLRLRAVGEHPEAADTLGVNVHRMRYXXXXXXXXXXXXX
YUFQ_BACSU      LGKIFF--SDVYYTSILAIALSWFILFKTPFGLRIRSVGEHPMAADTMGINVYKMRYIGVMISXXXXXXX
Y121_MYCGE      QTTVSIEAIGVFVFSLLLIGFVWYLMSFTKTGLRYRAVGENPNVIDTQGISVYKYQWIGAICSMMVAXXX
Y260_MYCPN      GNSVSIEGXXXXXXXXXXVLLVWYLMNFTKTGLRYRAVGENPNVIDTQGISVYKYQW-------------
YUFP_BACSU      RSPFLEQITDYIIVALLAAVIMWFIINKSTKGFELRAVGFNQHASQYAGMSVRKNIMTSMLISGAFAGLA
MGLC_SALTY      -----FRLSYITFYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNV------------------
MGLC_ECOLI      -----FRLSYITFYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNV------------------
LSRC_PHOTE      W----LNISPIGWLLMILVLAMAWILAKTAFGRGFYATGDNLQGARQLGVRTNSIR--------------
LSRC_YERPP      -----FSISPIGWLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLR--------------
LSRC_YERPN      -----FSISPIGWLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLR--------------
LSRC_YERPG      -----FSISPIGWLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLR--------------
LSRC_YERPE      -----FSISPIGWLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLR--------------
LSRC_YERPA      -----FSISPIGWLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLR--------------
RBSC_BACSU      FGRGYFLGIPVPAITMVLAFVILWVLLKTPFGRRTYAIGGNEKAALISGIKVTRVK--------------
LSRC_ENT38      --PVALGVSPLGMAVLFLVLIGAWTLSRTVSGRDFYAVGDNLAAARQLGVAVNRTR--------------
LIVH_METJA      FGFKGI-LFVSTFVVXXXXXXXXXXXXKTKFGIALRASMENPSLAQTMGIDVEKTR--------------


                         .         .         .         +         .         .         .:280
query           XAYLSIGFLNQFVRGMSAGMGFIALAALIFGKWHPVGILFSTLLFGFASALAIQLQGSEILPAVLVQAFP
YUFQ_BACSU      XXVYASTIALDFTHSTISGQGFIALAALVFGKWHPIXXXXXXXXXXXXQSLSILLPLFKDIPNVYMLMAP
Y121_MYCGE      XXXXXXXXXNPFNSGDVNGLGXXXXXXXXXXXXXXXXXXXXGLIFAYAYVFTNSQIGSN-SNSYLLRTIP
Y260_MYCPN      ----------------------------------------------------------------------
YUFP_BACSU      GAMEGLGFEYAAVKGAFTGVGFDGIAVALLG---------------------------------------
MGLC_SALTY      ----------------------------------------------------------------------
MGLC_ECOLI      ----------------------------------------------------------------------
LSRC_PHOTE      ----------------------------------------------------------------------
LSRC_YERPP      ----------------------------------------------------------------------
LSRC_YERPN      ----------------------------------------------------------------------
LSRC_YERPG      ----------------------------------------------------------------------
LSRC_YERPE      ----------------------------------------------------------------------
LSRC_YERPA      ----------------------------------------------------------------------
RBSC_BACSU      ----------------------------------------------------------------------
LSRC_ENT38      ----------------------------------------------------------------------
LIVH_METJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YVVTVLVLAGFIGKSRPPAAVGKPYEK
YUFQ_BACSU      YILTILALTGFIGRADAPKANGVPYIK
Y121_MYCGE      FIISLLVMLLFGFLNVAPKNIGKHFDK
Y260_MYCPN      ---------------------------
YUFP_BACSU      ---------------------------
MGLC_SALTY      ---------------------------
MGLC_ECOLI      ---------------------------
LSRC_PHOTE      ---------------------------
LSRC_YERPP      ---------------------------
LSRC_YERPN      ---------------------------
LSRC_YERPG      ---------------------------
LSRC_YERPE      ---------------------------
LSRC_YERPA      ---------------------------
RBSC_BACSU      ---------------------------
LSRC_ENT38      ---------------------------
LIVH_METJA      ---------------------------