[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81963.1

[Show Plain Result]


## Summary of Sequence Search
    1::361
    2::344     8e-97  52%  344 aa  PILT_PSEAE RecName: Full=Twitching mobility protein;
   53::366     6e-83  50%  374 aa  PILT_NEIGO RecName: Full=Twitching motility protein;
    5::312     7e-67  44%  326 aa  YGGR_ECOLI RecName: Full=Uncharacterized protein yggR;
   81::460     7e-26  37%  461 aa  HOFB_ECOLI RecName: Full=Protein transport protein hofB;
  129::392     2e-25  36%  502 aa  GSPE_PSEAE RecName: Full=General secretion pathway protein
  302::456     1e-24  41%  567 aa  GSPE_XANCP RecName: Full=General secretion pathway protein
  236::384     1e-24  44%  497 aa  GSPE_KLEPN RecName: Full=General secretion pathway protein
  247::371     4e-24  47%  501 aa  GSPE_AERHY RecName: Full=General secretion pathway protein
  235::395     7e-24  43%  464 aa  HOFB_HAEIN RecName: Full=Protein transport protein hofB homolog;
  232::432     7e-24  36%  493 aa  GSPE_ECOLI RecName: Full=Probable general secretion pathway protein
  180::502     1e-23  31%  558 aa  PILF_NEIGO RecName: Full=Type IV pilus assembly protein pilF;
  253::390     2e-23  45%  498 aa  GSPE_PECCC RecName: Full=General secretion pathway protein
  248::393     2e-23  43%  503 aa  GSPE_VIBCH RecName: Full=General secretion pathway protein
  196::436     4e-23  34%  568 aa  TAPB_AERHY RecName: Full=Type IV pilus assembly protein tapB;
  191::435     1e-22  36%  566 aa  PILB_PSEAE RecName: Full=Type 4 fimbrial assembly protein pilB;
  253::390     2e-22  44%  498 aa  GSPE1_ERWCH RecName: Full=General secretion pathway protein
  104::277     4e-19  35%  356 aa  COMGA_BACSU RecName: Full=ComG operon protein 1;
  138::277     3e-18  37%  348 aa  COMGA_BACHD RecName: Full=ComG operon protein 1 homolog;
  165::247     5e-09  40%  343 aa  VIRBB_RHIRD RecName: Full=Protein virB11;
  165::247     5e-09  40%  343 aa  VIRBB_AGRT9 RecName: Full=Protein virB11;
  261::377     1e-08  28%  503 aa  TCPT_VIBCH RecName: Full=Toxin coregulated pilus biosynthesis
  165::247     2e-08  38%  344 aa  VIRBB_AGRT5 RecName: Full=Protein virB11;
  140::302     3e-08  32%  323 aa  TRBB_RHIRD RecName: Full=Conjugal transfer protein trbB;
  140::290     7e-08  24%  325 aa  TRBB_RHISN RecName: Full=Probable conjugal transfer protein trbB;
   29::160     1e-07  30%  270 aa  Y1287_METJA RecName: Full=Uncharacterized protein MJ1287;
  301::415     1e-06  29%  551 aa  Y900_METJA RecName: Full=Uncharacterized protein MJ0900;
  305::387     2e-05  46%  721 aa  Y781_METJA RecName: Full=Uncharacterized protein MJ0781;Contains:
  183::265     3e-05  36%  356 aa  VIRBB_BARQU RecName: Full=Type IV secretion system protein virB11;
  183::265     5e-05  36%  356 aa  VIRBB_BARHE RecName: Full=Type IV secretion system protein virB11;
  157::305     9e-05  26%  361 aa  VIRBB_BRUSU RecName: Full=Type IV secretion system protein virB11;
  157::305     9e-05  26%  362 aa  VIRBB_BRUME RecName: Full=Type IV secretion system protein virB11;
  157::305     9e-05  26%  362 aa  VIRBB_BRUAB RecName: Full=Type IV secretion system protein virB11;
  157::305     9e-05  26%  362 aa  VIRBB_BRUA2 RecName: Full=Type IV secretion system protein virB11;
  158::249     2e-04  37%  339 aa  PTLH_BORPE RecName: Full=Type IV secretion system protein
  158::249     2e-04  37%  339 aa  PTLH_BORPA RecName: Full=Type IV secretion system protein ptlH
  158::249     2e-04  37%  339 aa  PTLH_BORBR RecName: Full=Type IV secretion system protein ptlH
  157::328     4e-04  29%  441 aa  Y6523_BACAN RecName: Full=Uncharacterized protein
    1::361

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEE
PILT_PSEAE      -----DITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEF
PILT_NEIGO      -----------------------------PMIRVHGDMRRINLPEMSAEEVGNMVTSVMNDHQRKIYQQN
YGGR_ECOLI      --------EIVALSVKHNVSDLHLCSAWPARWRIRGRM---EAAPFDTPDVEELLREWLDDDQRAILLEN
HOFB_ECOLI      --KAELLTRTLQSALEQRASDIHIEPAYRIRLRIDGVLHPLP--DVSPDAGVALTARLKVLGNLDIAEHR
GSPE_PSEAE      ---------ILGEAIRENASDIHLETRLVVRFRVDGVLR----EVLEPKRELAALLVSRIKVMARLDIAE
GSPE_XANCP      ----------------------------------------------------------------------
GSPE_KLEPN      ----------------------------------------------------------------------
GSPE_AERHY      ----------------------------------------------------------------------
HOFB_HAEIN      ----------------------------------------------------------------------
GSPE_ECOLI      ----------------------------------------------------------------------
PILF_NEIGO      ----------LSDALRSGASDIHFEFNARIRFRVDGQLREVVQPPIAVRASRIKVMSRLDISEKRI-PQD
GSPE_PECCC      ----------------------------------------------------------------------
GSPE_VIBCH      ----------------------------------------------------------------------
TAPB_AERHY      -------------AIKRGASDLHFETKYRIRFRIDGILHEIATPPLANRFSARLKVMARLDIAERRLPQD
PILB_PSEAE      ---------MLLDAIKGGSSDL----HFEPYEKIDGMLHEVAKPPLASRISARLKVMAGLDISERRKPQD
GSPE1_ERWCH     ----------------------------------------------------------------------
COMGA_BACSU     ----------------------------------------------------------------------
COMGA_BACHD     ----------------------------------------------------------------------
VIRBB_RHIRD     ----------------------------------------------------------------------
VIRBB_AGRT9     ----------------------------------------------------------------------
TCPT_VIBCH      ----------------------------------------------------------------------
VIRBB_AGRT5     ----------------------------------------------------------------------
TRBB_RHIRD      ----------------------------------------------------------------------
TRBB_RHISN      ----------------------------------------------------------------------
Y1287_METJA     ----------------------------------------------------------------------
Y900_METJA      ----------------------------------------------------------------------
Y781_METJA      ----------------------------------------------------------------------
VIRBB_BARQU     ----------------------------------------------------------------------
VIRBB_BARHE     ----------------------------------------------------------------------
VIRBB_BRUSU     ----------------------------------------------------------------------
VIRBB_BRUME     ----------------------------------------------------------------------
VIRBB_BRUAB     ----------------------------------------------------------------------
VIRBB_BRUA2     ----------------------------------------------------------------------
PTLH_BORPE      ----------------------------------------------------------------------
PTLH_BORPA      ----------------------------------------------------------------------
PTLH_BORBR      ----------------------------------------------------------------------
Y6523_BACAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
PILT_PSEAE      LETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGK
PILT_NEIGO      LEVDFSFELPNVARFRVNAFNTGRGPAAVFRTIPSTVLSLEELKAPSIFQKIAESPRGMVLVTGPTGSGK
YGGR_ECOLI      GQLDFAVSLAENQRLRGSAFAQRHGISLALRLLPSHCPQLEQLGAPTVLPELLKSENGLILVTGATGSGK
HOFB_ECOLI      LPQDGQFTVELAGNFRIATLPCRGGEKVVLRLLQQVGQALDTLGMPLQLADFAQQPQGLVLVTGPTGSGK
GSPE_PSEAE      KRIDGRISLRVGGRIRVSTLPSANGERVVLRLLDKQAGNLQHLGMSKLMDETVRKPHGILLVTGPTGSGK
GSPE_XANCP      ---------------------------------------FTEDFLPQ-FRKVLEQPHGIMLVTGPTGSGK
GSPE_KLEPN      --------------------------------------------LLRQVDGLIARPHGIVLVTGPTGSGK
GSPE_AERHY      ------------------------------------------------ISELIRKPHGIILVTGPTGSGK
HOFB_HAEIN      --------------------------------------SFSELGMTENFQRVLSQPQGLILVTGPTGSGK
GSPE_ECOLI      ----------------------------------------------QDLENLIQLPHGIILVTGPTGSGK
PILF_NEIGO      GRMQLTFQKGGKPDFRVSTLPTLFGEKVVMRILNSDAASLDQLGFEKLLLEAIHRPYGMVLVTGPTGSGK
GSPE_PECCC      -------------------------------------------------------PHGIILVTGPTGSGK
GSPE_VIBCH      -----------------------------------------------NFRRLIKRPHGIILVTGPTGSGK
TAPB_AERHY      GRIKLKLSRNKSMDMRVNTLPTMWGEKIVIRLLDSSAANIEQLGFDDRYLRALSKPQGMILVTGPTGSGK
PILB_PSEAE      GRIKMRVSKTKSIDFRVNTLPTLWGEKIVMRILDSAQMGIDALGYEEDQKELYLAPQGMILVTGPTGSGK
GSPE1_ERWCH     -------------------------------------------------------PHGIILVTGPTASGK
COMGA_BACSU     ----------------------------VIRVMPQYIPSIDKLSLPKTGATLLSHSHGMLIFTGPTGSGK
COMGA_BACHD     --------------------------------------------------------QGLILLTGATGSGK
VIRBB_RHIRD     -----------------------------------------------------------MLLCGPTGSGK
VIRBB_AGRT9     -----------------------------------------------------------MLLCGPTGSGK
TCPT_VIBCH      ----------------------------------------------------------------------
VIRBB_AGRT5     -----------------------------------------------------------MLLCGPTGSGK
TRBB_RHIRD      ----------------------------------------------------AIDSRMNIVISGGTGSGK
TRBB_RHISN      ----------------------------------------------------AIDSRLNIIISGGTASGK
Y1287_METJA     -----------------------------------------------------------IMVAGEVATGK
Y900_METJA      -----------------------------------------------------------IFICGETASGK
Y781_METJA      ------------------------------------------------------------LIAGGTGSGK
VIRBB_BARQU     -----------------------------------------------------------ILIAGKTGSGK
VIRBB_BARHE     -----------------------------------------------------------ILIAGKTGSGK
VIRBB_BRUSU     --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK
VIRBB_BRUME     --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK
VIRBB_BRUAB     --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK
VIRBB_BRUA2     --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK
PTLH_BORPE      ---------------------------------------------------LAVQAGKAILVAGQTGSGK
PTLH_BORPA      ---------------------------------------------------LAVQAGKAILVAGQTGSGK
PTLH_BORBR      ---------------------------------------------------LAVQAGKAILVAGQTGSGK
Y6523_BACAN     ------------GSIRINAVHSQNTNGNSLRIVPNLVKNFETFA-PQFIYDVVMESRNNILISGETGTGK


                         +         .         .         .         .         *         .:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
PILT_PSEAE      STTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMR
PILT_NEIGO      STTLAAMINYINETQPAHILTIEDPIEFVHQSKKSLINQRELHQHTLSFANALSSALREDPDVILVGEMR
YGGR_ECOLI      STTLAAMVGYLNQHADAHILTLEDPVEYLYASQRCLIQQREIGLHCMTFASGLRAALREDPDVILLGELR
HOFB_ECOLI      TVTLYSALQKLNTADI-NICSVEDPVEI----PIAGLNQTQIHPRAGTFQGVLRALLRQDPDVIMIGEIR
GSPE_PSEAE      TTTLYASLTTLNDRTR-NILTVEDPIEY---HLEGIGQTQVNAKVDMTFARGLRAILRQDPDVVMVGEIR
GSPE_XANCP      TTTLYTALSQLNTSDV-KIITVEDPVEYQIEGINQIQAKPQIGLD---FANALRSIVRQDPDIIMIGEMR
GSPE_KLEPN      STTLYAALSRLDARER-NIMTIEDPIEY----ELEGIGQTQVNAKVDTFARGLRAILRQDPDVVLVGEIR
GSPE_AERHY      STTLYAALSEINSRDR-NILTVEDPIEYDLEG----VGQTQVNTKVDTFARGLRAILRQDPDVVMVGEIR
HOFB_HAEIN      SISLYTALQWLNTPDK-HIMTAEDPIEI---ELDGIIQSQQIGLD---FNRLLRTFLRQDPDIIMLGEIR
GSPE_ECOLI      STTLYAILSALNT-PGRNILTVEDPVEY----ELEGIGQTQVNTRVDSFARGLRAILRQDPDVVMVGEIR
PILF_NEIGO      TVSLYTCLNILNT-ESVNIATAEDPAEI----NLPGINQVNVNDKQGTFAAALKSFLRQDPDIIMVGEIR
GSPE_PECCC      STTLYAALSRLNASER-NIMTVEDPIEY----ELEGIGQTQVNTKVDTFARGLRAILRQDPDVVLVGEIR
GSPE_VIBCH      STTLYAGLQELNSSER-NILTVEDPIEFIDGIGQTQVNPRV----DMTFARGLRAILRQDPDVVMVGEIR
TAPB_AERHY      TVSLYTGLNILNTTEV-NISTAEDPVEI----NLPGVNQVQVNPKAGTFASALRSFLRQDPDVVMVGEIR
PILB_PSEAE      TVSLYTGLNILNTTDI-NISTAEDPVEILEGINQVNVNPRQ-GMD---FSQALRAFLRQDPDVIMVGEIR
GSPE1_ERWCH     STTLYAALSPLNSAER-NIMTVEDPIEY----ELEGIGQTQVNPKVDTFARGLRAILRQDPDVVLVGEIR
COMGA_BACSU     TTTLYSLVQYAKKHFNRNIVTLEDPVETRDEDVLQVQVNEKAG---VTYSAGLKAILRHDPDMIILGEIR
COMGA_BACHD     TTTLYAMLQKALHMQNLHIVTIEDPIE----QLNPAFTQFEMNEKAQTYEVGLKAALRHDPDVIMIGEIR
VIRBB_RHIRD     TTMSKTLISAIPPQE--RLITIEDTLELVDNHVRLLYSKNGAGLGAVSAEHLLQASLRMRPDRILLGEMR
VIRBB_AGRT9     TTMSKTLISAIPPQE--RLITIEDTLELVDNHVRLLYSKNGAGLGAVSAEHLLQASLRMRPDRILLGEMR
TCPT_VIBCH      --------------KGC-FVTVEDPVEYLISGAQQSSIVADNDDKTKNFADAVRSAMRRDPDVIMIGEIR
VIRBB_AGRT5     TTMSKTLINAIPPQE--RLITIEDTLELVENHVRLLYSKNGAGLGAVTAEHLLQASLRMRPDRILLGEIR
TRBB_RHIRD      -TTLANAIEIVTAAPDDRLVILEDTAEIQCAAENAVSLHT---SDTVDMARLLKSTMRLRPDRIIVGEVR
TRBB_RHISN      TTLANAVIEIVRSAPEDRLVILEDTAEIQCAADNAVLLRT---SDTVDMARLLKSTMRLRPDRIVVGEVR
Y1287_METJA     TTLLNAFSLFIPPQMK--IVSIEDTPEIRLYHENWIAGTTRSGFGGEEYEDLLKAALRQRPDYLIVGEVR
Y900_METJA      TTTLNAILPFIKPNS--KIFSCEDTPEVKPPHQQLVTRERGPEESRVTLFDLLRAALRSRPNYIIVGEIR
Y781_METJA      TTLLLSLFSMYNER----IITIEDTPELQIPHKHVIMPEYEVTMDD-----LIKNALRMRPDRIFVGEVR
VIRBB_BARQU     TTLSKALIAKIPDNE--RIITIEDTPELVPNYVSMIYSKDGQGLASVGPKELLESALRMRPDRILLQELR
VIRBB_BARHE     TTLSKALIAKIPDDE--RIITIEDTPELVPNYVSMIYSKDGQGLASVGPKELLESALRMRPDRILLQELR
VIRBB_BRUSU     TTLMKALMQEIPFDQ--RLITIEDVPELFHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELR
VIRBB_BRUME     TTLMKALMQEIPFDQ--RLITIEDVPELFHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELR
VIRBB_BRUAB     TTLMKALMQEIPFDQ--RLITIEDVPELFHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELR
VIRBB_BRUA2     TTLMKALMQEIPFDQ--RLITIEDVPELFHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELR
PTLH_BORPE      TTLMNALSGEIPPRE--RIVTIEDVRELATNHVHLLYGTPTEGTAAVSATELLRAALRMAPTRILLAELR
PTLH_BORPA      TTLMNALSGEIPPRE--RIVTIEDVRELATNHVHLLYGTPTEGTAAVSATELLRAALRMAPTRILLAELR
PTLH_BORBR      TTLMNALSGEIPPRE--RIVTIEDVRELATNHVHLLYGTPTEGTAAVSATELLRAALRMAPTRILLAELR
Y6523_BACAN     TEVLKLLFSFVRDHKA---IMIEDVPE---THVKSLFPDKDVFSNGVTVTDEIVAALRNNPRWIMISELR


                         .         .         .         +         .         .         .:280
query           DYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG
PILT_PSEAE      DLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLI-KKIGGG
PILT_NEIGO      DPETIGLALTAAETGHLVFGTLHTTGAAKTVDRIVDVFPAGEKEMVRSMLSESLTAVISQNLLKTHDGNG
YGGR_ECOLI      DSETIRLALTAAETGHLVLATLHTRGAAQAVERLVDSFPAQEKDPVRNQLAGSLRAVLSQKLEVDK-QEG
HOFB_ECOLI      DGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRL------QQMGVARWMLSSALTLVIAQRLVRKCYHGG
GSPE_PSEAE      DRETAEIAVQASLTGHLVLSTLHTNSAIGAITRLVDMGIE------PFLLSSSMLGVLAQRLV-------
GSPE_XANCP      DLETARIAIQSALTGHLVLSTLHTNNAAGGITRLLDMGVED------YLLTSTINGILAQRLVRK-----
GSPE_KLEPN      DGETAQIAVQASLTGHLVLSTLHTNSALGAISRLQDMGVE------PFLLSTSLLAVMSQRLV-------
GSPE_AERHY      DLETAQIAVQASLTGHLVMSTLHTNTAIGAITRMRDM---------------------------------
HOFB_HAEIN      DEESAMIALRAAQTGHLVLSTLHTNDAISAISRL------QQLGIQQYEIKNSLLLVIAQRLVRK-----
GSPE_ECOLI      DTETAQIAVQASLTGHLVLSTLHTNSASGAVTRLRDMGVES------FLLSSSLAGIIAQRLV-------
PILF_NEIGO      DLETADIAIKAAQTGHMVFSTLHTNNAPATLSRMLNVAPFN--------IASSVSLIMAQRLLRRLCS--
GSPE_PECCC      DGETAQIAVQASLTGHLVLSTLHTNSALGALSRLQDMGVE------PFLLSTSLLGVLAQRLV-------
GSPE_VIBCH      DLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIE------PFLISSSLLGVLAQRLV-------
TAPB_AERHY      DLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRMMNM---------------------------------
PILB_PSEAE      DLETAEIAIKAAQTGHMVMSTLHTNSAAETLTRLLNM---------------------------------
GSPE1_ERWCH     DGETAQIAVQASLTGHLVLSTLHTNSALGALSRLQDMGIE------PFLLSTSLLGVLAQRLV-------
COMGA_BACSU     DAETAEIAVRAAMTGHLVLTSLHTRDAKGAIYRLLE-FGINMNE-----IEQTVIAIAAQRLVDLA----
COMGA_BACHD     DQTTAVYAVRAALTGHLVLATIHSANARGTITRLCEM------GVALHDLREVVVAIIAQELISR-----
VIRBB_RHIRD     D---------------------------------------------------------------------
VIRBB_AGRT9     D---------------------------------------------------------------------
TCPT_VIBCH      DKPTVEALSSAVESGHYCLTTIHAGSVVSVLQRLSGL----GMKADKIASPGFLAGITSQKLIPE-----
VIRBB_AGRT5     D---------------------------------------------------------------------
TRBB_RHIRD      DGAALTLLKAWNTGHPGGVTTIHSNTALSALRRL-----------------EQLTAEASQQLMQEVIGE-
TRBB_RHISN      DGAALTLLKAWNTGHPGGVATIHSNTATSALRRLEQLTAEASQQPMHEVIGEVVDLIVSIERTPR-----
Y1287_METJA     G-EEAKILFQAITTGHLALSTIHAKS-PEAVIRRLNAEPMNIPKIMLEQLN-------------------
Y900_METJA      S-VEAAVAFQAMQTGHPVLSTFHAANVRKMIQRL------------------------------------
Y781_METJA      ----------------------------------------------------------------------
VIRBB_BARQU     D---------------------------------------------------------------------
VIRBB_BARHE     D---------------------------------------------------------------------
VIRBB_BRUSU     GGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------
VIRBB_BRUME     GGETYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------
VIRBB_BRUAB     GGETYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------
VIRBB_BRUA2     GGETYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------
PTLH_BORPE      ----------------------------------------------------------------------
PTLH_BORPA      ----------------------------------------------------------------------
PTLH_BORBR      ----------------------------------------------------------------------
Y6523_BACAN     G-KETYEMIQAVLSGHHVVTSLHSVDAETSPKRLVNM---------------------------------


                         .         *         .         .         .         .         +:350
query           RVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFM
PILT_PSEAE      RVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKIPENF-
PILT_NEIGO      RVASHEILIANPAVRNLIRENKITQINSVLQTGQASGMQTMDQSLQSLVRQGLIAPEAARRRA-------
YGGR_ECOLI      RVALFELLINTPAVGNLIREGKTHQLPHVIQTGQQVGMIT------------------------------
HOFB_ECOLI      RTALFEVLPITPVIRQLI--SANTDVESLETHARQAGMRTLNGCLA--VEQGLTTFE----------ELI
GSPE_PSEAE      ----------------------------------------------------------------------
GSPE_XANCP      ----------------------------------------------------------------------
GSPE_KLEPN      ----------------------------------------------------------------------
GSPE_AERHY      ----------------------------------------------------------------------
HOFB_HAEIN      ----------------------------------------------------------------------
GSPE_ECOLI      RRLCPQCRQFTPVSPQQAQMFKYHQL-AVTTIGTPVG---CPHCHQSGYQGRMAIHEM------------
PILF_NEIGO      ---SCKQEVERPSASALKEVGFTDE--DLAKDWKLYGAVGCDRCRGQGYKGRAGVYEV------------
GSPE_PECCC      ----------------------------------------------------------------------
GSPE_VIBCH      ----------------------------------------------------------------------
TAPB_AERHY      ----------------------------------------------------------------------
PILB_PSEAE      ----------------------------------------------------------------------
GSPE1_ERWCH     ----------------------------------------------------------------------
COMGA_BACSU     ----------------------------------------------------------------------
COMGA_BACHD     ----------------------------------------------------------------------
VIRBB_RHIRD     ----------------------------------------------------------------------
VIRBB_AGRT9     ----------------------------------------------------------------------
TCPT_VIBCH      ----------------------------------------------------------------------
VIRBB_AGRT5     ----------------------------------------------------------------------
TRBB_RHIRD      ---------AVDLIVSIERSGKGRRVREVIHIEG------------------------------------
TRBB_RHISN      ----------------------------------------------------------------------
Y1287_METJA     ----------------------------------------------------------------------
Y900_METJA      ----------------------------------------------------------------------
Y781_METJA      ----------------------------------------------------------------------
VIRBB_BARQU     ----------------------------------------------------------------------
VIRBB_BARHE     ----------------------------------------------------------------------
VIRBB_BRUSU     ----------------------------------------------------------------------
VIRBB_BRUME     ----------------------------------------------------------------------
VIRBB_BRUAB     ----------------------------------------------------------------------
VIRBB_BRUA2     ----------------------------------------------------------------------
PTLH_BORPE      ----------------------------------------------------------------------
PTLH_BORPA      ----------------------------------------------------------------------
PTLH_BORBR      ----------------------------------------------------------------------
Y6523_BACAN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLAGAPEGxxx
PILT_PSEAE      -----------
PILT_NEIGO      -----------
YGGR_ECOLI      -----------
HOFB_ECOLI      RVLGMPHG---
GSPE_PSEAE      -----------
GSPE_XANCP      -----------
GSPE_KLEPN      -----------
GSPE_AERHY      -----------
HOFB_HAEIN      -----------
GSPE_ECOLI      -----------
PILF_NEIGO      -----------
GSPE_PECCC      -----------
GSPE_VIBCH      -----------
TAPB_AERHY      -----------
PILB_PSEAE      -----------
GSPE1_ERWCH     -----------
COMGA_BACSU     -----------
COMGA_BACHD     -----------
VIRBB_RHIRD     -----------
VIRBB_AGRT9     -----------
TCPT_VIBCH      -----------
VIRBB_AGRT5     -----------
TRBB_RHIRD      -----------
TRBB_RHISN      -----------
Y1287_METJA     -----------
Y900_METJA      -----------
Y781_METJA      -----------
VIRBB_BARQU     -----------
VIRBB_BARHE     -----------
VIRBB_BRUSU     -----------
VIRBB_BRUME     -----------
VIRBB_BRUAB     -----------
VIRBB_BRUA2     -----------
PTLH_BORPE      -----------
PTLH_BORPA      -----------
PTLH_BORBR      -----------
Y6523_BACAN     -----------