[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81982.1

[Show Plain Result]


## Summary of Sequence Search
    1::414
    7::430     7e-49  36%  430 aa  FOLC_BACSU RecName: Full=Folylpolyglutamate synthase;       
   24::425     1e-39  32%  428 aa  FOLC_LACCA RecName: Full=Folylpolyglutamate synthase;       
   31::348     3e-38  37%  422 aa  FOLC_ECOLI RecName: Full=Bifunctional protein folC;Includes:
    6::414     7e-36  34%  417 aa  FOLD_SCHPO RecName: Full=Probable folylpolyglutamate synthase;     
    6::419     2e-34  32%  427 aa  FOLD_YEAST RecName: Full=Folylpolyglutamate synthase;       
   48::408     5e-32  33%  418 aa  FOLC_BUCAP RecName: Full=Bifunctional protein folC;Includes:
   15::361     7e-31  35%  437 aa  FOLC_HAEIN RecName: Full=Folylpolyglutamate synthase;       
   29::200     1e-28  38%  426 aa  FOLC_BUCBP RecName: Full=Bifunctional protein folC;Includes:
   76::387     1e-28  36%  587 aa  FOLC_MOUSE RecName: Full=Folylpolyglutamate synthase,
   76::429     2e-28  33%  587 aa  FOLC_CRIGR RecName: Full=Folylpolyglutamate synthase,
   76::429     6e-27  32%  587 aa  FOLC_HUMAN RecName: Full=Folylpolyglutamate synthase,
  117::316     8e-27  35%  626 aa  FOLC_DICDI RecName: Full=Putative folylpolyglutamate synthase;     
   73::277     1e-26  39%  585 aa  FOLC_BOVIN RecName: Full=Folylpolyglutamate synthase,
   60::267     8e-26  37%  510 aa  FOLC_CAEEL RecName: Full=Putative folylpolyglutamate synthase;     
  125::406     4e-25  34%  548 aa  FOLE_YEAST RecName: Full=Folylpolyglutamate synthase;       
   48::187     1e-23  39%  411 aa  FOLC_BUCAI RecName: Full=Bifunctional protein folC;Includes:
   84::270     2e-23  40%  505 aa  FOLE_SCHPO RecName: Full=Probable folylpolyglutamate synthase;     
   71::304     3e-23  34%  528 aa  FOLE_NEUCR RecName: Full=Folylpolyglutamate synthase;       
   77::246     9e-20  36%  514 aa  FOLE_CANAL RecName: Full=Folylpolyglutamate synthase;       
  199::464     6e-11  31%  486 aa  MURE_CAUCR RecName:
   10::159     1e-10  28%  430 aa  FOLC_YEAST RecName: Full=Probable folylpolyglutamate synthase;     
  100::455     2e-08  25%  485 aa  MURE_CLOTE RecName:
  203::416     4e-08  36%  483 aa  MURE_LACLS RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
  203::416     4e-08  36%  483 aa  MURE_LACLM RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   80::451     5e-08  24%  482 aa  MURE_THETN RecName:
  167::485     8e-08  30%  517 aa  MURE_CORGL RecName:
  181::457     1e-06  32%  526 aa  MURE_COREF RecName:
  163::416     1e-06  29%  485 aa  MURE_BRAJA RecName:
  167::467     1e-06  28%  485 aa  MURE_ZYMMO RecName:
  165::456     1e-06  35%  489 aa  MURE_GLOVI RecName:
  203::416     3e-06  35%  483 aa  MURE_LACLA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
  162::331     4e-06  28%  454 aa  MURF_SYNY3 RecName:
   84::417     6e-06  27%  490 aa  MURE_ALCBS RecName:
   95::413     1e-05  28%  487 aa  MURE_PSEMY RecName:
  552::756     1e-05  32%  874 aa  CPHA_SYNY8 RecName: Full=Cyanophycin synthetase;       
  328::451     3e-05  30%  482 aa  MURE_LAWIP RecName:
  189::418     4e-05  27%  496 aa  MURE_PSEPK RecName:
   89::414     4e-05  27%  483 aa  MURE_CHLTR RecName:
   89::414     4e-05  27%  483 aa  MURE_CHLTA RecName:
  203::451     6e-05  28%  481 aa  MURE_STRSV RecName:
  183::288     1e-04  40%  478 aa  MURC_STRM5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  156::353     2e-04  34%  457 aa  MURF_BACSU RecName:
  204::427     2e-04  24%  484 aa  MURE_STRA5 RecName:
  204::427     2e-04  24%  484 aa  MURE_STRA3 RecName:
  204::427     2e-04  24%  484 aa  MURE_STRA1 RecName:
  101::149     2e-04  45%  512 aa  MURE_CHLPD RecName:
  174::251     2e-04  36%  505 aa  MURE_BORAP RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
  183::337     2e-04  30%  468 aa  MURC_SYNS9 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  173::286     2e-04  40%  469 aa  MURC_LEPCP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  264::455     4e-04  27%  489 aa  MURE_SYNWW RecName:
  183::288     4e-04  39%  478 aa  MURC_STRMK RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  292::379     5e-04  28%  481 aa  MURE_STRR6 RecName:
  292::379     5e-04  28%  481 aa  MURE_STRPN RecName:
  292::379     5e-04  28%  481 aa  MURE_STRP2 RecName:
  183::292     5e-04  39%  477 aa  MURC_XANCP RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  183::292     5e-04  39%  477 aa  MURC_XANCB RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  183::292     5e-04  39%  477 aa  MURC_XANC8 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  183::292     5e-04  39%  477 aa  MURC_XANC5 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  203::426     7e-04  27%  481 aa  MURE_STRTD RecName:
  203::426     7e-04  27%  481 aa  MURE_STRT2 RecName:
  203::426     7e-04  27%  481 aa  MURE_STRT1 RecName:
  183::292     7e-04  39%  477 aa  MURC_XANAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
    1::414

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDPLSWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSP
FOLC_BACSU      -DARSWIHGRKFGVKPGLGRMKQLMARLGHPEKKIRAFHVAGTNGKGSTVAFIRSMLQEAGYTVGTFTSP
FOLC_LACCA      -------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSP
FOLC_ECOLI      ----------------GLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSP
FOLD_SCHPO      ----------------GLQRMLQLLKHLGNPQESFCAVQIAGTNGKGSICSYIYTSLLQAAIKTGRYTSP
FOLD_YEAST      ----------------GLSRITKLLEHLGNPQNSLRVLHIAGTNGKGSVCTYLSSVLQQKSYQIGKFTTP
FOLC_BUCAP      ---------------------------------------VGGTNGKGTTCAMLEKLLLDSGYQVGLYTSP
FOLC_HAEIN      -----WLYLEKSHFKPGLDRIKSVAEKLDLLHPVPYVITVGGTNGKGTTCRLLETILLNHGLRVGVYSSP
FOLC_BUCBP      ---------------PTLNRVFYVAKKLGVLKSKAFVFIVGGTNGKGSTCHVLENLLLNSGYRVGLYTSP
FOLC_MOUSE      -----------------LEAMEMYLARSGLQVERLNIIHVTGTKGKGSTCAFTERILRNYGLKTGFFRSP
FOLC_CRIGR      -----------------LEAMEVYLARSGLQVEQLNIIHVTGTKGKGSTCAFTERILRSYGLKTGFFSSP
FOLC_HUMAN      -----------------LEAMELYLARSGLQVEDLDIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSP
FOLC_DICDI      -----------------MEEMRNYCKTLSIDLERESIIHVAGTKGKGSTCAITESIIREQGFSTGLFTSP
FOLC_BOVIN      -----------------LEAMKLYLARSGLQVEDLDIIHITGTKGKGSTCAFTERILRSYGLKTGFFSSP
FOLC_CAEEL      ---------RENLQAINLPQCRKYLESLNISAEALNIIHVSGTKGKGSACAFVESILRSQGLRTGFYSSP
FOLE_YEAST      ---------------------------------------ITGTKGKGSTAAFTSSILKEQLPRIGLYTSP
FOLC_BUCAI      ---------------------------------------VAGTNGKGTTCAVLERLLLDSGYQVGLYTSP
FOLE_SCHPO      ---------------------------------------VAGTKGKGSTCAFTSSILQQSGERIGMYTSP
FOLE_NEUCR      --------------AHSVKEMRAYLARIGYSSQDLDIVHVAGTKGKGGTCAFVDSILTRIPRRIGLFTSP
FOLE_CANAL      ---------------------------------------ITGTKGKGSTCAFTESILKQYTIKIGLYTSP
MURE_CAUCR      ----------------------------------------------------------------------
FOLC_YEAST      -----------------LPRINRLLEHVGNPQDSLSILHIAGTNGKETVSKFLTSILQHPGQQIGRYTTS
MURE_CLOTE      ----------------------------GNPKDKLKLIGVTGTNGKTTSTFMIKSILEEAGFKVGL----
MURE_LACLS      ----------------------------------------------------------------------
MURE_LACLM      ----------------------------------------------------------------------
MURE_THETN      -----------------VEDARAAMAKIANPTSKLTLIGITGTNGKTSVTYMLKAILEQQNNKVGLVTIQ
MURE_CORGL      ----------------------------------------------------------------------
MURE_COREF      ----------------------------------------------------------------------
MURE_BRAJA      ----------------------------------------------------------------------
MURE_ZYMMO      ----------------------------------------------------------------------
MURE_GLOVI      ----------------------------------------------------------------------
MURE_LACLA      ----------------------------------------------------------------------
MURF_SYNY3      ----------------------------------------------------------------------
MURE_ALCBS      ---------------PGLSRVGELAARYGEPGSAMNVVGVTGTNGKTSITWFLRDALNALGHRCALVGTL
MURE_PSEMY      ----------------------------GEPSRALHLIGVTGTNGKTSVSQLLAQALDLLGERCGIVGTL
CPHA_SYNY8      ----------------------------------------------------------------------
MURE_LAWIP      ----------------------------------------------------------------------
MURE_PSEPK      ----------------------------------------------------------------------
MURE_CHLTR      ----------------------SLAARFNNPSRHLDVIGITGTNGKTTVSCLVRELMERSGRRTGL----
MURE_CHLTA      ----------------------SLAARFNNPSRHLDVIGITGTNGKTTVSCLVRELMERSGRRTGL----
MURE_STRSV      ----------------------------------------------------------------------
MURC_STRM5      ----------------------------------------------------------------------
MURF_BACSU      ----------------------------------------------------------------------
MURE_STRA5      ----------------------------------------------------------------------
MURE_STRA3      ----------------------------------------------------------------------
MURE_STRA1      ----------------------------------------------------------------------
MURE_CHLPD      ----------------------------GFASDALHVIGVTGTNGKTTTARLITAMLNACGIRTG-YIGT
MURE_BORAP      ----------------------------------------------------------------------
MURC_SYNS9      ----------------------------------------------------------------------
MURC_LEPCP      ----------------------------------------------------------------------
MURE_SYNWW      ----------------------------------------------------------------------
MURC_STRMK      ----------------------------------------------------------------------
MURE_STRR6      ----------------------------------------------------------------------
MURE_STRPN      ----------------------------------------------------------------------
MURE_STRP2      ----------------------------------------------------------------------
MURC_XANCP      ----------------------------------------------------------------------
MURC_XANCB      ----------------------------------------------------------------------
MURC_XANC8      ----------------------------------------------------------------------
MURC_XANC5      ----------------------------------------------------------------------
MURE_STRTD      ----------------------------------------------------------------------
MURE_STRT2      ----------------------------------------------------------------------
MURE_STRT1      ----------------------------------------------------------------------
MURC_XANAC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HLVDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSFFEAATALALLHFAREGVEFAVLEVGLGGRLD
FOLC_BACSU      YIITFNERISVNGIPIALVNQMKPHVEALDQTEYGQPTEFEIMTACAFLYFAEHKVDFVIFETGLGGRFD
FOLC_LACCA      FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALGYWYFRQRQVDVAVIEVGIGGDTD
FOLC_ECOLI      HLVRYTERVRVQGQELPESAHTASFAEIESARGDISLTYFEYGTLSALWLFKQAQLDVVILEVGLGGRLD
FOLD_SCHPO      HFLEPRDTISINGQSEEIFNTCWKQVIEVDRRFRTKATEFELLTATAFQCFHHSGVRVAVIETGMGGRLD
FOLD_YEAST      HLVHVTDSITINNKPIERYQNIRLQLEALNKSHSLKCTEFELLTCTAFKYFYDVQCQWCVIEVGLGGRLD
FOLC_BUCAP      HLINYSERIKVNGLYLSEKDHIFSFLIIDAEKGNVSLTYFEFITLSALFLFSQYSLDIIILEVGLGGRLD
FOLC_HAEIN      HLLRYNERVRIQNQDLPDEAHTASFAFIDENKTESL-TYFEFSTLSALHLFKQAKLDVVILEVGLGGRLD
FOLC_BUCBP      HLMRYTERVRINGFELEHLYHISAFNDVKYFQNDVLLTRFEFITLSALILFKSYNLDIIILEVGLGGRLD
FOLC_MOUSE      HMVQVRDRIRINGKPISPELFTKHFWCLYNQLEEFKDSYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAFD
FOLC_CRIGR      HLVQVRERIRINGKPIHFWRLYHQLEEFKDDSHVAMPAYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYD
FOLC_HUMAN      HLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYD
FOLC_DICDI      HLISPRERIRINGKEMFSQYFWNCWDLLIKDYQTQLPNFFRYLTLMALKIFQDEAIQCTILEVGIGGRMD
FOLC_BOVIN      HLVQVRERIRINGQPISSELFTKHFWRLYHRLEETKDDYFRFLTLMAFHVFLQEKVDLAVLEVGIGGAYD
FOLC_CAEEL      HLVHVRERIQVDGQPVFAEEFFHVYDIIKREHSDNMPAYFKFLTLLAFRIFVKLNVQVMILEVGIGGEYD
FOLE_YEAST      HLKSVRERIRINGEPISEEKFAKYFFEVWDRLDSTTSSYFKFLTLLSFHTFIQEDCKSCVYEVGVGGELD
FOLC_BUCAI      HLINFVERVRINGFVLHEEEHIDSFQNVELVRNGVLLTYFEFITLAALILFKRYSLDCIILKVGLGGRLD
FOLE_SCHPO      HLRSVCERIQLNGKPISQELFTKYFFDVWERLENAVGSYFRFLTLMAWHVFISENVDAAIIEVGIGGEYD
FOLE_NEUCR      HLIAVRERIRIDSKPISEELFARYFFEVWDRLETSQLAKDEVETLMSYHVYLSEGVDVAIYETGIGGEYD
FOLE_CANAL      HLKSVRERIRINGQPINQEKFAKYFFEVWDKFTTTKSDYFKYLTILSFHVFLQEGVDTAIYEVGVGGTYD
MURE_CAUCR      ----------------------------------------------------------------------
FOLC_YEAST      SLLNAKEEINNEAISLIEYSRIEKELIEADSSLKLQCNNLELLTSVALVYFAKKNCQWCIIETGLAGKQD
MURE_CLOTE      -----------MGTILNYIGDRKIYAQRTTPESLEIHKLFK--------DMVDSGVDYCVMEVSSHSYLD
MURE_LACLS      ----------------------------------------------------------------------
MURE_LACLM      ----------------------------------------------------------------------
MURE_THETN      NMIGDRVIPTTHTTP----------------------ESLDLQELFSLM--VNEGVKYVVMEVSSHSALH
MURE_CORGL      ----------------------------------------EAPTLQALFARMRDGVTHVVMEVSSHASLG
MURE_COREF      ----------------------------------------EAPTLQKLFYRMRQGVTHVVMEVSSHASLG
MURE_BRAJA      ---------------------------------------------------AREGVTHLAFEASSHGRLD
MURE_ZYMMO      ---------------------------------------------------ARADISHVIFEASSHG-LD
MURE_GLOVI      -----------------------------------------------LAQMVEAGCQYGVMEVSAGCRFE
MURE_LACLA      ----------------------------------------------------------------------
MURF_SYNY3      --------------------------------------------------------DFAIVEMAMRGRGQ
MURE_ALCBS      GL-GLKDNEQITGHTTPDPIT------------------LQAGLARVL----EAGADTVAMEVSSHALDQ
MURE_PSEMY      G-TGFHGALE-QGKHTTPDPVGVQ------------------ATLASLKQAGARAVAMEVSSHGLDGRVA
CPHA_SYNY8      -------------------------------------------------------VEVAVLECARGGILR
MURE_LAWIP      ----------------------------------------------------------------------
MURE_PSEPK      ----------------------------------------------------------------------
MURE_CHLTR      --IGTIEHILGENRIID--------------------SFTTPDAILLQKYFAKQNLSAAVMEVSIGMALG
MURE_CHLTA      --IGTIEHILGENRIID--------------------SFTTPDAILLQKYFAKQNLSAAVMEVSIGMALG
MURE_STRSV      ----------------------------------------------------------------------
MURC_STRM5      ----------------------------------------------------------------------
MURF_BACSU      -----------------------------------------------------ENTEIAVLEMGMSGEID
MURE_STRA5      ----------------------------------------------------------------------
MURE_STRA3      ----------------------------------------------------------------------
MURE_STRA1      ----------------------------------------------------------------------
MURE_CHLPD      NLCTFGEQ--------------------------------------------------------------
MURE_BORAP      -----------------------------------------------LSNMVKNGVQYAILESTSHG-LD
MURC_SYNS9      ----------------------------------------------------------------------
MURC_LEPCP      ----------------------------------------------------------------------
MURE_SYNWW      ----------------------------------------------------------------------
MURC_STRMK      ----------------------------------------------------------------------
MURE_STRR6      ----------------------------------------------------------------------
MURE_STRPN      ----------------------------------------------------------------------
MURE_STRP2      ----------------------------------------------------------------------
MURC_XANCP      ----------------------------------------------------------------------
MURC_XANCB      ----------------------------------------------------------------------
MURC_XANC8      ----------------------------------------------------------------------
MURC_XANC5      ----------------------------------------------------------------------
MURE_STRTD      ----------------------------------------------------------------------
MURE_STRT2      ----------------------------------------------------------------------
MURE_STRT1      ----------------------------------------------------------------------
MURC_XANAC      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEGLGVLRAEALARKTPLWVL
FOLC_BACSU      STNVVEPLLTVITSIGHDHMNILGNTXXXXXXXXXXXXXXXXPIVTATQPEALQVIRHEAERHAAPFQSL
FOLC_LACCA      STNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
FOLC_ECOLI      ATNIVDADVAVVTSIALDHTDWLGPDRESIGREKAGIFRSEKPAIVGSTIADVAQEKGALLQRRGVEWVT
FOLD_SCHPO      ATNVEEPVLSIISRICLDHQAFLGNTLEAIAKEKAGIFKKNVPCVVDGLNE-VNVLNQLKLS--------
FOLD_YEAST      ATNGANKACCGITKISLDHESFLGNTLSEISKEKAGIITEGVP-FTVIDGTNINVVKERCKALGSELSVT
FOLC_BUCAP      ATNIIDSDLSVITNIGIDHTSCLGTDRISIGREKSGIFRKGKIAVIGEKNIPISVDEI-AKEKKTILKKI
FOLC_HAEIN      ATNIVDSHLAVITSIDIDHTDFLGDTREAIAFEKAGIFRENCPVVIGEPNVPQTMLQAEKLARRDVDWLF
FOLC_BUCBP      ATNILSADVSVITNIDIDHSKILGVNRSSISVEKSGIFRKNKIAIVA-----------------------
FOLC_MOUSE      CTNIIKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVVQPEGLAVLRDRAQQIGCPLYL-
FOLC_CRIGR      CTNIRKPVVCGVSSLGMDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVLQPEGLAVLRDRAQQTSCPLY-L
FOLC_HUMAN      CTNIIKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGLAVLRDRAQQISCPLYLC
FOLC_DICDI      STNVPKPMVTGISALGYDHQNLLGNTLAEIALEKAGIMKVGIPIFTVSSPEAINVLIDHSNKVKSPLSIV
FOLC_BOVIN      CTNIIKPVVCGITSLGIDHTGLLGDTMEKIAWQKGGIFKSGVPAFTVLQDEPLAVLRDRAQQISCPLYL-
FOLC_CAEEL      CTNVVEPKVCGVTTLDYDHMSILGNKLSEIAWHKAGIFKESVPAFSPTTTEAEEVLIARAISKHVPLF--
FOLE_YEAST      STNIIEPIVCGVTLLGIDHTFMLGDTIEEIAWNKGGIFKSGAPAFTVEKPQGLTILKERAEERKTTLTEV
FOLC_BUCAI      AXXXXXXXXXXXXXXGIDHTSILGRDRISIAREKCGVFR-------------------------------
FOLE_SCHPO      STNLIEPYATAVTSLGLDHTSLLGNTIAEIAWQKAGIYKESAIALTCEQAEAMNVLKNRAAERNTSLKVV
FOLE_NEUCR      ATNVVDPVVSGISTLGIDHVFVLGDTVDKIAWHKAGIMKTGSPAFTIEQPSATQVLKDRAVEKGVDLKIL
FOLE_CANAL      STNIIDPTVTGISALGIDHTFMLGNNIASITENKTGIFKKGVPAFVSRQLE-------------------
MURE_CAUCR      ------------TNFTQDHLDYHG-SMEAYRAAKLRLFDAGAMAVLNADSEAFPDFAAAAVTSGQSVFSV
FOLC_YEAST      PGSGQSRVCCAITNVG------------------------------------------------------
MURE_CLOTE      RVYGIEFNEGIFTNLTQDHLD-FHKTFENYYNSKLMLFK-XXXXXXXXXXXXYGERILKEIEEKTFTYSI
MURE_LACLS      --------VGVFLNISPDHIPVEHPTLEDYFYCKRQLLKNSRYFVANAEMNHFAIIKEELNERKIPHAFY
MURE_LACLM      --------VGVFLNISPDHIPVEHPTLEDYFYCKRQLLKNSRYFVANAEMNHFAIIKEELNERKIPHAFY
MURE_THETN      RVDSCDFDIAVFTNLSQDHLD-FHESMEEYAKTKSKLFKMAKKASVINIDDKYSSMMIESSKGKVLTYGI
MURE_CORGL      RVAGSHFDVAAFTNLSQDHLD-FHPTMDDYFDAKALFFRADSPLVADKQDDSWGQRMASVAADVQTVSTL
MURE_COREF      RVSGSHFNVAAFTNLSQDHLD-FHDTMEEYFDAKALFFRAGSPLAADHQDDEWGTRMAEVAGNAQTVATT
MURE_BRAJA      GVRVSA---GGFTNLSRDHMDY-HPTVAHYLAAKLRLFRELVPPGGAAVISADHDCSAEAIARGLRVMAV
MURE_ZYMMO      QSDGAKVIAGAFTSFSRDHLDYHG-TMERYLAAKLRLFDERIAP------DGTAVIWADDPAATTVILKL
MURE_GLOVI      A--------AVFTNLTQDHLD-FHPDMESYFQAKATLFRSGRAVINADDPWGVRLAAAY-----DQVWTY
MURE_LACLA      --------VGVFLNISPDHIPVEHPTLEDYFYCKRQLLKNSRYFVANSEMNHFAIIKEELKERKIPHAFY
MURF_SYNY3      IADIAKPTIGLITNVGTAHIGLLGSELA-IAEAKCELLAHQPPESTAILNRDNALLMETAQRGKTITYGL
MURE_ALCBS      HRLGPTPVVAVFSNLSRDHLDYHGDMEAYLAAKSVLFTRDGVKLAVINCDDPVAYSLVGCLADGVRCVTF
MURE_PSEMY      AL---EFDVAVFTNLSRDHLDYHG-SMEAYGAAKAKLFRCRVINLDDAFGRELAQQAHDSRLIGYSLSDA
CPHA_SYNY8      SGLAFESCVGVVLNVAEDHLKVKGVIAESVNADGYAVLNADDPLVAQMAKNVKGKIAYFSMSKDNPIII-
MURE_LAWIP      ----------------------------------------------------------------------
MURE_PSEPK      ---ALEFDIAVMTNLSRDHLDYHG-SMEAYEAAKAKLFAPSLRCQVVNLDDDFGRRLAADFARRPSVDHI
MURE_CHLTR      RVRETEFLAGVLTNITSDHLDFHGSLEEYIAAKKASLPEKGI-AVVNLDCEYAPSFLNGSQARAVSYAIH
MURE_CHLTA      RVRETEFLAGVLTNITSDHLDFHGSLEEYIAAKKASLPEKGI-AVVNLDCEYAPSFLNGSQARAVSYAIH
MURE_STRSV      --------VGVFLNISPDHIPIEHPTFEDYFYNKRLLMDNSRAVIVNSGMDHFQIVKEQVAS-------L
MURC_STRM5      ------PLMSIITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLAVLEVAALAAKTPRHVM
MURF_BACSU      LSRLANPDAAVITNIGESHMQDLG-SREGIAEAKLEIINGKEDGVLIYIGDEPLLQNAYSCQTKTYGTGT
MURE_STRA5      --------VGVFLNISPDHIPIEHPTFEDYFFHKRLLMENSNAVVVNSQMDHFNIVKEQ-------VEYI
MURE_STRA3      --------VGVFLNISPDHIPIEHPTFEDYFFHKRLLMENSNAVVVNSQMDHFNIVKEQ-------VEYI
MURE_STRA1      --------VGVFLNISPDHIPIEHPTFEDYFFHKRLLMENSNAVVVNSQMDHFNIVKEQ-------VEYI
MURE_CHLPD      ----------------------------------------------------------------------
MURE_BORAP      LKTAVNYFAAVFTNIGHEHLEFHG-TIQNYLNVKLGLFR------SVSDDAGFGVINLD-----------
MURC_SYNS9      ------PSLGVITNLETDHYDGLDDLISTLQR-----FGGGCERLIANYDDPILQEHFEPTA-----WWS
MURC_LEPCP      ------PVLSVITNIDADHMDTYG---HDFARLKQAFFLHKMPFYGAACGDDPGVRSIPMISRPVITYGL
MURE_SYNWW      ----------------------------------------------------------------------
MURC_STRMK      ------PLMSIITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLAVLEVAALAARTPRHVM
MURE_STRR6      ----------------------------------------------------------------------
MURE_STRPN      ----------------------------------------------------------------------
MURE_STRP2      ----------------------------------------------------------------------
MURC_XANCP      ------PLMAVITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLALLEVAALAGKTPRHVM
MURC_XANCB      ------PLMAVITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLALLEVAALAGKTPRHVM
MURC_XANC8      ------PLMAVITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLALLEVAALAGKTPRHVM
MURC_XANC5      ------PLMAVITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLALLEVAALAGKTPRHVM
MURE_STRTD      --------VGVFLNISPDHIPIEHPTFEDYFYHKRLLLKNS-QAVIVNSGMNHFDFVAEEVADKD-----
MURE_STRT2      --------VGVFLNISPDHIPIEHPTFEDYFYHKRLLLKNS-QAVIVNSGMNHFDFVAEEVADKD-----
MURE_STRT1      --------VGVFLNISPDHIPIEHPTFEDYFYHKRLLLKNS-QAVIVNSGMNHFDFVAEEVADKD-----
MURC_XANAC      ------PLMAVITNIDADHLENYG---NDFARVQAAF----AEFLQRLPFYGLALLEVAALAGKTPRHVM


                         .         .         .         +         .         .         .:280
query           GEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQAENXXXXXXXXXXXXXXWEAVKRGVARAEN
FOLC_BACSU      HDACVIFNEEALPAGEQFSFKTEKCYEDIRTS--LIGTHQRQNAAEWLNKENIAHISDEALRSGLVKAAW
FOLC_LACCA      DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
FOLC_ECOLI      DHDWAFSDAHGTLENLPLPLVPQPNXXXXXXXXXXSGLEVSEN----------------AIRDGIASAIL
FOLD_SCHPO      -----AEETRAHPFYLAKGKSGENKNEWITFSTPLKGDYQGQNLACAVTALDILSSSFSIVQNGVKNTSW
FOLD_YEAST      DSQLNGNMIDTNSWGCFDLAKLPLNGEYQIFNLRV-----AMGMLDYLQMNELIDITKNEVSTRLAKVDW
FOLC_BUCAP      DVDFIHSNIELLP-----VSRIPLSNTAIALASLFYSGLEVN---------------LKKLKSSISKVQL
FOLC_HAEIN      AENWQWQNKKVRLENLPF-CQIPLANAATVLAAVQYLPFDISE---------------QTLRKSLQEVEL
FOLC_BUCBP      ----------------------------------------------------------------------
FOLC_MOUSE      -----CPPLEALEEGLPLSLGLERSNAALALQLAHCWLERQDHQDIQELKVSRPSIRWQLMRRGLRDTVW
FOLC_CRIGR      CPPLEAXXXXXXXXXXXXXXXHQRSNAALALQLAHCWLEQQDHQDIRELKVSRPSMRWQLMRHGLRDTEW
FOLC_HUMAN      PMXXXXXXXXXXXXXXXXXXH-QRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLMRLGLRNTEW
FOLC_DICDI      ----------------------------------------------------------------------
FOLC_BOVIN      ----------------------------------------------------------------------
FOLC_CAEEL      ----------------------------------------------------------------------
FOLE_YEAST      PPFKQLENVKL---GIAGEFQKSNASLAVMLASEIL---HTSNILEEKIKCSSNASIPEKFIIGLQNTKW
FOLC_BUCAI      ----------------------------------------------------------------------
FOLE_SCHPO      ----------------------------------------------------------------------
FOLE_NEUCR      DVDPRLNGVKIRPDAV------------------------------------------------------
FOLE_CANAL      ----------------------------------------------------------------------
MURE_CAUCR      GEE--GQGLRLLPTPAGQDLVVEAEGVVHHLKLPLAGAFQASNVLVAAGLCIAAGEDSAKVLKALETLEG
FOLC_YEAST      ----------------------------------------------------------------------
MURE_CLOTE      KKDLKAESVRLHSRGGEFTVDFK--GNKEKINIHIPGEYNVSNALGSILACVNEGISLKVIKRGLEKLSG
MURE_LACLS      GADSENKIIES--KGLHFVTDGSVSGE---FDIRLLGRFNQENXXXXXXXXXXXXXSFENIRQGLASAIV
MURE_LACLM      GADSENKIIES--KGLHFVTDGSVSGE---FDIRLLGRFNQENXXXXXXXXXXXXXSFENIRQGLASAIV
MURE_THETN      -KDFAAKEIKNSLSGVKFKVQIQDKKEEISL--KIPGLFSVYNALAAITVADFLGIPLRSVREALSHVTV
MURE_CORGL      GQDFSATDINVSDSGAQSFKINAPSNQSYQVELALPGXXXXXXXXXXXXXXXRVGVDGEAFARGMSKVAV
MURE_COREF      GKDFTAGLVTVKETGQSFTVTVPDHGE-VPVTLALPGXXXXXXXXXXXXXXXXXGVDPVAFARGMAQVAV
MURE_BRAJA      GRDGAGEGIEVGVDGFSQKLTVEHRGKRYVVLLPLAGEFQVENALVSAGLAIGTGSDAANVFASLEHLEG
MURE_ZYMMO      IDIWKAEAIEADSQGQMITLSIK--GESYKIRLPLIGGYQLSNGLVRAGLVLATGGDIKQTMAALTLLKP
MURE_GLOVI      GADIYPEDAVFTPEGIRGTL-VTPVGRAA-FTSPLVGQFXXXXXXXXXXXXXXXXIDLEAIAAGLSGFGG
MURE_LACLA      GADSENKIIES--KGLHFVTDGSVSGA---FDIRLLGRFNQENXXXXXXXXXXXXXXXENIHDGLALAVV
MURF_SYNY3      GGDVHGDGENLILDGVSLPLPLA-------------GVHNASNYLAAIALAQCLGLDWQQLQSGLTVELP
MURE_ALCBS      GDQ---TGATVRCASVAFTAELNVGGESFSVTLPLFGRFNLSNLMAVAGILHGQGVSTDSLAGALAAITP
MURE_PSEMY      SAFLYCSEAQFDDHGVRARLVTPR-GEGV-LRSNLLGRFNLSNLLAVVGALLGMDYGLDEILKVLPQLQG
CPHA_SYNY8      -DHLRRNGMAAVYENGEWTLRIEKA-ENIPVTMKAMAPFMIXXXXXXXXXXFVHGIDIELIRQGVGANQT
MURE_LAWIP      ----------------------------------------------------------------------
MURE_PSEPK      ETRLLSYSLES-PEASLFCREAVFSDDGVRATSQLLGRFNLSNMLAAVATLLALDYALDEILKVTPQLQG
MURE_CHLTR      QEDYRADRLKLYSSGSSYDIWYQ--GQVFPCETSLIGEHNVYNLASLAVVHQFLGRDFADLVRDVRFLSA
MURE_CHLTA      QEDYRADRLKLYSSGSSYDIWYQ--GQVFPCETSLIGEHNVYNLASLAVVHQFLGRDFADLVRDVRFLSA
MURE_STRSV      EHDFYADSSNTIKDSQAFSF--EATGKAGNYDIQLIGRFNQENAVAAGLACLRLGASLEDIKKGIAATRV
MURC_STRM5      SADVRAENVVQEGSRMRFTLRLPQ-GTSQEVVLALPGKH-------------------------------
MURF_BACSU      HNDYQLQDVSQSEEGTHFTIKIENT-----FFIPILGKHNVMNXXXXXXXXXXXXXXPEDAAKGLSGLKV
MURE_STRA5      PHDFYGDYSEVITESKAFSFKLENTYDI-----KLIGKFNQENAIAAGLACLRLGVSIEDIKNGIAQTTV
MURE_STRA3      PHDFYGDYSEVITESQAFSFKLENTYDI-----KLIGKFNQENAIAAGLACLRLGVSIEDIKNGIAQTTV
MURE_STRA1      PHDFYGDYSEVITESQAFSFKLENTYDI-----KLIGKFNQENAIAAGLACLRLGVSIEDIKNGIAQTTV
MURE_CHLPD      ----------------------------------------------------------------------
MURE_BORAP      ----------------------------------------------------------------------
MURC_SYNS9      NKQSENIAFAALPDGDRCTARFYENGSAVGFTLPMAGLHNLSNATAALAACRMEGIPFEALVEGLAQLQA
MURC_LEPCP      GEDVQVRAVDALPGGMRFTCQ-RRNGTVLEITLNLPGVHSVRN---------------------------
MURE_SYNWW      --DYQAGELKIDLDGSSF--RLHYGDNSLMINMKLIGLFSIYNALAAISFALQEGIDPGLIQSALARVEG
MURC_STRMK      SADVRAENVVQEGSRMRFTLRLPQ-GTSQEVVLALPGRH-------------------------------
MURE_STRR6      ---------------------------------QLIGNFNQENAVAAGLACLRLGASLEDIKKGIAATRV
MURE_STRPN      ---------------------------------QLIGNFNQENAVAAGLACLRLGASLEDIKKGIAATRV
MURE_STRP2      ---------------------------------QLIGNFNQENAVAAGLACLRLGASLEDIKKGIAATRV
MURC_XANCP      NADVRAEDVVQDGPRMRFTLRLPE-GTTTPVTLALPGRHNVLN---------------------------
MURC_XANCB      NADVRAEDVVQDGPRMRFTLRLPE-GTTTPVTLALPGRHNVLN---------------------------
MURC_XANC8      NADVRAEDVVQDGPRMRFTLRLPE-GTTTPVTLALPGRHNVLN---------------------------
MURC_XANC5      NADVRAEDVVQDGPRMRFTLRLPE-GTTTPVTLALPGRHNVLN---------------------------
MURE_STRTD      -HDFYGKDSENTVKGFSFKAKGKLAGD---YDIQLIGDFNQDNAMAAGLACLRLGASLEDIKKGIAQTSV
MURE_STRT2      -HDFYGKDSENTVKGFSFKAKGKLAGD---YDIQLIGDFNQDNAMAAGLACLRLGASLEDIKKGIAQTSV
MURE_STRT1      -HDFYGKDSENTVKGFSFKAKGKLAGD---YDIQLIGDFNQDNAMAAGLACLRLGASLEDIKKGIAQTSV
MURC_XANAC      NADVRAEDVVQDGPCMRFTLRLPE-GTTTPVTLALPGRHNVLN---------------------------


                         .         *         .         .         .         .         +:350
query           PGRLQRLLWRGRELLLDGAHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRY
FOLC_BACSU      PGRLE-LVQEHPPVYLDGAHNEEGVEKLAETMKQRANSRISVVFSALKDKPYQNMIKRLETIAHAI--HF
FOLC_LACCA      PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGILADKDYAAMADRLAAFSTVYLVPV
FOLC_ECOLI      PGRFQ-IVSESPRVIFDVAHNPHAAEYLMKALPKNGRVLA--VIGMLHDKDIAGTLAWLKSV--------
FOLD_SCHPO      PGRLDRSVPSLGDILFDGAHNKEAAIELAKSQRREHNKSVSWVVAFTNTKDVTGIMKILLRKGTVIATNF
FOLD_YEAST      PGRLYRMDYRFDKILMDGAHNGSAAVELVKYLREYGNQPLTFVMAVTHGKNEPLLQPLLRPIDQVILTRF
FOLC_BUCAP      SGRFQ-TVFNSPRIILDVAHNVHAALYLSEEIDTEGQIYAVF--GILKDKDVAGVVQVLQKVVNLKTNRS
FOLC_HAEIN      VGRFQAIKTDKREIIVDVGHNPHAAKYLSEKLSIEGKMIA--VCGMLKDKDANGVFEHL-----------
FOLC_BUCBP      ----------------------------------------------------------------------
FOLC_MOUSE      PGRTQILQRGPLTWYLDGAHTTSSVQA-------------------------------------------
FOLC_CRIGR      PGRTQVLRRGPLTWYLDGAHTTSSVQALQRSKHPSG-GPEVYVLLFNSDRDSAALLKLLQ----------
FOLC_HUMAN      PGRTQVLRRGPLTWYLDGAHTASSAQAFRQALQGRGPEVRVLLFNATGDRDPAALLKLLQ----------
FOLC_DICDI      ----------------------------------------------------------------------
FOLC_BOVIN      ----------------------------------------------------------------------
FOLC_CAEEL      ----------------------------------------------------------------------
FOLE_YEAST      EGRCQ-VLEKGKNVYIDGAHTKDSMVA-------------------------------------------
FOLC_BUCAI      ----------------------------------------------------------------------
FOLE_SCHPO      ----------------------------------------------------------------------
FOLE_NEUCR      ----------------------------------------------------------------------
FOLE_CANAL      ----------------------------------------------------------------------
MURE_CAUCR      AGRLQRVGRKGGEAYVDYAHTPDGLQTVLEALRPHGKLIAVFGAGGDRDRGKRPLMGAIGALADIAIVTD
FOLC_YEAST      ----------------------------------------------------------------------
MURE_CLOTE      PGRCEIVTMLGYDVIVDYAHTPDGLNVLRTARDFKGKLISVYGCGGDRDRKRPIMGRIGTELSDLAILTS
MURE_LACLS      PGRMELLTAKGAHIYIDYAHNGLSLENLVEVVEDHHAGQLFLVLGSSRRKDFGQVIENHPRLN-VILTTD
MURE_LACLM      PGRMELLTAKGAHIYIDYAHNGLSLENLVEVVEDHHAGQLFLVLGSSRRKDFGQVIENHPRLN-VILTTD
MURE_THETN      KGRFEPVE-TGRDVFIDYAHTPDGIRNIMEALKEYEAGRKILVFGAGGDRDKSLMGEVAGKYADFCILTS
MURE_CORGL      PGRMER-IDEGQDFLVDYAHKPAAVAAVLDTLRTQIDGRLGVVIGAGGDRDRGPMGQLSAQRADLVIVTD
MURE_COREF      PGRMER-IDEGQDFLVDYAHKPAAVAAVLDTLRTQIDGRLGVVIGAGGDRDRAPMGELSARRADLVI---
MURE_BRAJA      AGRLERVGERGAPIFVDYAHKPDALAKALQALRPYAKRRLVVVFGAGGDRDRPIMGEIAAENADGVIITD
MURE_ZYMMO      VGRLERATQNGAEVYVDYAHTPDGLRAAIEALRPHGLLWVVFGAGGDRDKKRPEMGKIAANLADHVIVTD
MURE_GLOVI      PGRMERVSGSDDDIIVDYAHTPDGLRKLLEATRVRGRLICVFGCGGDRDRKRPQMGRIAAELSDLPVVTS
MURE_LACLA      PGRMELLTAKGAHIYIDYAHNGLSLENLXXXXXXHHAGQLVLVLGSSRRKDFGQVIEKHPRL-DVILTTD
MURF_SYNY3      KGRARRYQWGQDVVLLDETYN-------------------------------------------------
MURE_ALCBS      PGRMEPVQQAGPTVIVDYAHTPDGLEKALQACRAHFAGRLFCIIGCGGDRDMAAVAE--RGADHVVFTS-
MURE_PSEMY      PGRMQRLGGGDKPLVVDYAHTPDALEKVLEAMRPHGRLVCLFGCGGDRDRKRPLMAAVAERLADVVWVTD
CPHA_SYNY8      PGRMNLFDMKDFSVLIDYAHNPAGYLAV------------------------------------------
MURE_LAWIP      PGRLERIVNKKQDIFVDYAHTPDALINVLSALRDVGFKRIITVFGCGGNRDKALMGKAVAKLSDVAVLTS
MURE_PSEPK      PGRMQRLGGGDKPLVVDYAHTPDALEKVLEALRAHGKLLCLFGCGGDRDRKRPLMAEVAERLADRVLVTD
MURE_CHLTR      PGRLDPILLGPFPVYIDYAHTPDACRILLQLLPKDGRLIIVFGCGGDRDRKRPLMAKVSEHYGFSFVTS-
MURE_CHLTA      PGRLDPILLGPFPVYIDYAHTPDACRILLQLLPKDGRLIIVFGCGGDRDRKRPLMAKVSEHYGFSFVTS-
MURE_STRSV      PGRMEVLTQKGAKVFVDYAHNGVSLRNLLSVVEEHQLLGATGNKGESRRKDFGLLLNQHPEL-TVILTA-
MURC_STRM5      ----------------------------------------------------------------------
MURF_BACSU      TGRLELIKTDSGLSIINDAYNAKAAIQLTESLEGYG----------------------------------
MURE_STRA5      PGRMEVLTTNGAKIFVDYAHNGDSLKKLLAVVEEHQKGDIILVLGAPGNKGQSRRKD------------F
MURE_STRA3      PGRMEVLTTNGAKIFVDYAHNGDSLKKLLAVVEEHQKGDIILVLGAPGNKGQSRRKD------------F
MURE_STRA1      PGRMEVLTTNGAKIFVDYAHNGDSLKKLLAVVEEHQKGDIILVLGAPGNKGQSRRKD------------F
MURE_CHLPD      ----------------------------------------------------------------------
MURE_BORAP      ----------------------------------------------------------------------
MURC_SYNS9      PGRRFDLTWEGRHIVDDYAHHP------------------------------------------------
MURC_LEPCP      ----------------------------------------------------------------------
MURE_SYNWW      PGRFEKVCGQDFAVIVDYAHTPDGLENILQTSRELGKKRLICVFGCGGDRDRSLMGEIAAKYSDFCVVTS
MURC_STRMK      ----------------------------------------------------------------------
MURE_STRR6      PGRMEVLTQKGAKVFIDYAHNGDSLKKLINVVETHQTGKIALVLGSTGNK--------------------
MURE_STRPN      PGRMEVLTQKGAKVFIDYAHNGDSLKKLINVVETHQTGKIALVLGSTGNK--------------------
MURE_STRP2      PGRMEVLTQKGAKVFIDYAHNGDSLKKLINVVETHQTGKIALVLGSTGNK--------------------
MURC_XANCP      ----------------------------------------------------------------------
MURC_XANCB      ----------------------------------------------------------------------
MURC_XANC8      ----------------------------------------------------------------------
MURC_XANC5      ----------------------------------------------------------------------
MURE_STRTD      PGRMEILTQNGAKVFVDYAHNGDSLDKLLQVVTDHQKGKISLILGAPGNK-----GESRRQDFGHVLNTY
MURE_STRT2      PGRMEILTQNGAKVFVDYAHNGDSLDKLLQVVTDHQKGKISLILGAPGNK-----GESRRQDFGHVLNTY
MURE_STRT1      PGRMEILTQNGAKVFVDYAHNGDSLDKLLQVVTDHQKGKISLILGAPGNK-----GESRRQDFGHVLNTY
MURC_XANAC      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ASLRSEDPRALLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRLEGxxxxxxxx
FOLC_BACSU      ASF--DFPRASLDLYDASEISEDPDDVIKFIESKKGSVLITGSLYFISDIRKRLK---------
FOLC_LACCA      PGTPRALPEAGYEALHEGRLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
FOLC_ECOLI      ----------------------------------------------------------------
FOLD_SCHPO      SSIKSMEPEVIKNSISSESSVEDNLEILRLAKEKNSSVIVCGSLYLLGDMYRYLK---------
FOLD_YEAST      NNIHATDPEEIKDFYTKEIVIENDLHQVLPSLSDEQRIVVCGSLYLCGELLR------------
FOLC_BUCAP      ASINYLKKKLSLNNALFFNNINESWQAIKKVITKKDIILVFGSFFTVSEFM-------------
FOLC_HAEIN      ----------------------------------------------------------------
FOLC_BUCBP      ----------------------------------------------------------------
FOLC_MOUSE      ----------------------------------------------------------------
FOLC_CRIGR      ----------------------------------------------------------------
FOLC_HUMAN      ----------------------------------------------------------------
FOLC_DICDI      ----------------------------------------------------------------
FOLC_BOVIN      ----------------------------------------------------------------
FOLC_CAEEL      ----------------------------------------------------------------
FOLE_YEAST      ----------------------------------------------------------------
FOLC_BUCAI      ----------------------------------------------------------------
FOLE_SCHPO      ----------------------------------------------------------------
FOLE_NEUCR      ----------------------------------------------------------------
FOLE_CANAL      ----------------------------------------------------------------
MURE_CAUCR      DNPRSEDPAAILEAAPGAREIGDRRAAIRAAVASEGDVVVAGKGHEQGQIV-------------
FOLC_YEAST      ----------------------------------------------------------------
MURE_CLOTE      DNPRTEEPFSIIDIVKGVTIVQSRREAIKKAMTKDDVIVVAG----------------------
MURE_LACLS      DSNR-ENPKTI-----------------------------------------------------
MURE_LACLM      DSNR-ENPKTI-----------------------------------------------------
MURE_THETN      DNPRSENPKEIIQIEEGIKVIEDRREAIRYALSKDDVIILAG----------------------
MURE_CORGL      DNPRSEVPATIRAAVQGASESERPVEVLEIGDRAEAGIVVAGKGHEVGQLV-------------
MURE_COREF      --VTDDNPRSEVPATIRAAVMEGARRGAAEA---------------------------------
MURE_BRAJA      DNPRSEQPEAI-----------------------------------------------------
MURE_ZYMMO      DNPRGEDAKEVLVGAPLAEEIGGRKEAIFSAIKRAEKVLIAGKGHEQGQIIGRGE---------
MURE_GLOVI      DNPRTENPEAILDILAGIPVGVSPLQALLEAKAGD-CVVIAG----------------------
MURE_LACLA      DSNR-EDPKII-----------------------------------------------------
MURF_SYNY3      ----------------------------------------------------------------
MURE_ALCBS      DNPRSEDPQKII----------------------------------------------------
MURE_PSEMY      DNPRSEDPAQIV----------------------------------------------------
CPHA_SYNY8      ----------------------------------------------------------------
MURE_LAWIP      DNPRNEDPELIMDVLPGLKIITEP--DREKAIRQAIELVSPGDALLV-----------------
MURE_PSEPK      DNPRTEDP--------------------------------------------------------
MURE_CHLTR      DNPRTEDPDQII----------------------------------------------------
MURE_CHLTA      DNPRTEDPDQII----------------------------------------------------
MURE_STRSV      DDPNYEDPLAIAESYPVEKIA-DREEAIKKALSREGDAVI------------------------
MURC_STRM5      ----------------------------------------------------------------
MURF_BACSU      ----------------------------------------------------------------
MURE_STRA5      GDVINQHPNLQVILTADDPNFEDPLVISQEIASHINRPV-------------------------
MURE_STRA3      GDVINQHPNLQVILTADDPNFEDPLVISQEIASHINRPV-------------------------
MURE_STRA1      GDVINQHPNLQVILTADDPNFEDPLVISQEIASHINRPV-------------------------
MURE_CHLPD      ----------------------------------------------------------------
MURE_BORAP      ----------------------------------------------------------------
MURC_SYNS9      ----------------------------------------------------------------
MURC_LEPCP      ----------------------------------------------------------------
MURE_SYNWW      DNPRSEDPHAIIEIIPGMDKVEDRREAIRHALARTGDLVV------------------------
MURC_STRMK      ----------------------------------------------------------------
MURE_STRR6      ----------------------------------------------------------------
MURE_STRPN      ----------------------------------------------------------------
MURE_STRP2      ----------------------------------------------------------------
MURC_XANCP      ----------------------------------------------------------------
MURC_XANCB      ----------------------------------------------------------------
MURC_XANC8      ----------------------------------------------------------------
MURC_XANC5      ----------------------------------------------------------------
MURE_STRTD      PELSTDDPNK-----------EDPLTICQEIASHINRKV-------------------------
MURE_STRT2      PELSTDDPNK-----------EDPLTICQEIASHINRKV-------------------------
MURE_STRT1      PELSTDDPNK-----------EDPLTICQEIASHINRKV-------------------------
MURC_XANAC      ----------------------------------------------------------------