[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81992.1

[Show Plain Result]


## Summary of Sequence Search
    1::220
   94::259     5e-12  32%  317 aa  Y1836_ACTSZ RecName: Full=UPF0190 protein Asuc_1836;Flags:
   92::248     6e-12  33%  312 aa  Y1802_GLUOX RecName: Full=UPF0190 protein GOX1802;Flags: Precursor;
   83::234     3e-10  29%  299 aa  Y3271_SILPO RecName: Full=UPF0190 protein SPO3271;Flags: Precursor;
   94::260     3e-10  31%  318 aa  Y1919_ACTP7 RecName: Full=UPF0190 protein APP7_1919;Flags:
   94::260     3e-10  31%  318 aa  Y1870_ACTPJ RecName: Full=UPF0190 protein APJL_1870;Flags:
   94::260     3e-10  31%  318 aa  Y1832_ACTP2 RecName: Full=UPF0190 protein APL_1832;Flags:
   95::253     1e-09  31%  317 aa  Y1495_HAES2 RecName: Full=UPF0190 protein HSM_1495;Flags:
   83::236     2e-09  28%  297 aa  Y379_CAMJE RecName: Full=UPF0190 protein Cj0379c;Flags: Precursor;
   95::253     2e-09  30%  317 aa  Y1017_HAES1 RecName: Full=UPF0190 protein HS_1017;Flags: Precursor;
   95::261     1e-08  28%  319 aa  Y537_PASMU RecName: Full=UPF0190 protein PM0537;Flags: Precursor;
  110::267     2e-08  31%  334 aa  YEDY_SALG2 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::267     2e-08  31%  334 aa  YEDY_SALEP RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::267     2e-08  31%  334 aa  YEDY_SALDC RecName: Full=UPF0190 protein yedY;Flags: Precursor;
   95::290     2e-08  30%  313 aa  Y1919_AGRT5 RecName: Full=UPF0190 protein Atu1919;Flags: Precursor;
  110::297     3e-08  32%  334 aa  YEDY_ECO27 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  120::292     3e-08  30%  891 aa  NIA7_HORVU RecName: Full=Nitrate reductase [NAD(P)H];       
  110::297     4e-08  32%  334 aa  YEDY_SHIDS RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     4e-08  32%  334 aa  YEDY_SALSV RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     4e-08  32%  334 aa  YEDY_SALCH RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     4e-08  32%  334 aa  YEDY_SALA4 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     4e-08  32%  334 aa  YEDY_ECOLU RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  109::255     4e-08  31%  333 aa  Y247_PECCP RecName: Full=UPF0190 protein PC1_0247;Flags: Precursor;
  128::298     4e-08  27%  905 aa  NIA_FUSOX RecName: Full=Nitrate reductase [NADPH];       
  110::297     5e-08  32%  334 aa  YEDY_SHISS RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SHIB3 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALTY RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALTI RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALPK RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALPB RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALPA RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALNS RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_SALHS RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOUT RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOSM RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOSE RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOLC RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOL6 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOK1 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECOHS RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO8A RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO81 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO7I RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO5E RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO57 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO55 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO45 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::297     5e-08  32%  334 aa  YEDY_ECO24 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
   97::273     5e-08  28%  867 aa  NIA_ASPNG RecName: Full=Nitrate reductase [NADPH];       
  110::297     7e-08  32%  334 aa  YEDY_SALAR RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  109::257     7e-08  30%  333 aa  Y264_ERWCT RecName: Full=UPF0190 protein ECA0264;Flags: Precursor;
  144::317     7e-08  29%  916 aa  NIA1_ORYSJ RecName: Full=Nitrate reductase [NADH] 1;       
  110::258     9e-08  32%  334 aa  YEDY_ECOLI RecName: Full=UPF0190 protein yedY;Flags: Precursor;
  110::258     9e-08  32%  334 aa  YEDY_ECOBW RecName: Full=UPF0190 protein yedY;Flags: Precursor;
   97::293     9e-08  30%  886 aa  NIA1_SOYBN RecName: Full=Inducible nitrate reductase [NADH] 1;     
  112::270     1e-07  28%  334 aa  Y281_ERWT9 RecName: Full=UPF0190 protein ETA_02810;Flags:
   96::252     2e-07  29%  311 aa  Y1748_WOLSU RecName: Full=UPF0190 protein WS1748;Flags: Precursor;
  138::311     2e-07  30%  912 aa  NIA2_HORVU RecName: Full=Nitrate reductase [NADH];       
  141::314     2e-07  29%  915 aa  NIA1_HORVU RecName: Full=Nitrate reductase [NADH];       
  117::306     2e-07  31%  889 aa  NIA3_MAIZE RecName: Full=Nitrate reductase [NADH] 3;       
   90::254     3e-07  28%  331 aa  Y2981_RALSO RecName: Full=UPF0190 protein RSc2981;Flags: Precursor;
  121::294     4e-07  29%  890 aa  NIA2_SOYBN RecName: Full=Inducible nitrate reductase [NADH] 2;     
  110::297     5e-07  31%  334 aa  YEDY_ESCF3 RecName: Full=UPF0190 protein yedY;Flags: Precursor;
   94::239     5e-07  31%  313 aa  Y1383_RHIME RecName: Full=UPF0190 protein R01383;Flags: Precursor;
   93::252     6e-07  28%  305 aa  Y789_CHRVO RecName: Full=UPF0190 protein CV_0789;Flags: Precursor;
   87::247     6e-07  26%  306 aa  Y2748_CAUCR RecName: Full=UPF0190 protein CC_2748;Flags: Precursor;
   93::238     6e-07  29%  312 aa  Y1217_RHISN RecName: Full=UPF0190 protein NGR_c12170;Flags:
  117::292     6e-07  27%  890 aa  NIA2_PHAVU RecName: Full=Nitrate reductase [NADH] 2;       
   94::231     8e-07  31%  318 aa  Y1916_HAEDU RecName: Full=UPF0190 protein HD_1916;Flags: Precursor;
   95::249     8e-07  28%  315 aa  Y1703_RHIEC RecName: Full=UPF0190 protein RHE_CH01703;Flags:
  135::308     2e-06  28%  904 aa  NIA1_TOBAC RecName: Full=Nitrate reductase [NADH] 1;       
  109::296     2e-06  28%  333 aa  Y4414_SERP5 RecName: Full=UPF0190 protein Spro_4414;Flags:
   99::254     2e-06  28%  319 aa  Y3990_BRUSU RecName: Full=UPF0190 protein BRA0990;Flags: Precursor;
   99::254     2e-06  28%  319 aa  Y3305_BRUME RecName: Full=UPF0190 protein BMEII0305;Flags:
  124::299     2e-06  28%  900 aa  NIA_LOTJA RecName: Full=Nitrate reductase [NADH];         Short=NR;
  112::258     3e-06  31%  334 aa  Y3641_ENTS8 RecName: Full=UPF0190 protein ESA_03641;Flags:
  143::316     3e-06  27%  911 aa  NIA2_BRANA RecName: Full=Nitrate reductase [NADH], clone PBNBR1412;
  103::257     4e-06  27%  322 aa  Y1588_XANCP RecName: Full=UPF0190 protein XCC1588;Flags: Precursor;
  135::308     4e-06  28%  904 aa  NIA2_TOBAC RecName: Full=Nitrate reductase [NADH] 2;       
  205::250     5e-06  41%  310 aa  Y844_METCA RecName: Full=UPF0190 protein MCA0844;Flags: Precursor;
   93::247     5e-06  27%  306 aa  Y3877_CAUSK RecName: Full=UPF0190 protein Caul_3877;Flags:
   95::249     5e-06  27%  315 aa  Y1778_RHIE6 RecName: Full=UPF0190 protein RHECIAT_CH0001778;Flags:
   92::267     5e-06  26%  864 aa  NIA_VOLCA RecName: Full=Nitrate reductase [NADH];         Short=NR;
  140::313     5e-06  28%  911 aa  NIA_SOLLC RecName: Full=Nitrate reductase [NADH];         Short=NR;
  211::257     7e-06  40%  322 aa  Y1647_XANAC RecName: Full=UPF0190 protein XAC1647;Flags: Precursor;
  156::329     7e-06  27%  926 aa  NIA_SPIOL RecName: Full=Nitrate reductase [NADH];         Short=NR;
  103::292     7e-06  28%  881 aa  NIA1_PHAVU RecName: Full=Nitrate reductase [NADH] 1;       
  116::274     9e-06  28%  337 aa  Y4692_PSEAE RecName: Full=UPF0190 protein PA4692;Flags: Precursor;
  100::243     2e-05  27%  313 aa  Y4088_ANASK RecName: Full=UPF0190 protein AnaeK_4088;Flags:
  100::243     3e-05  27%  313 aa  Y4120_ANAD2 RecName: Full=UPF0190 protein A2cp1_4120;Flags:
  100::243     3e-05  28%  313 aa  Y3977_ANADE RecName: Full=UPF0190 protein Adeh_3977;Flags:
  326::363     3e-05  45%  982 aa  NIA_NEUCR RecName: Full=Nitrate reductase [NADPH];       
  228::274     3e-05  36%  337 aa  Y985_PSESM RecName: Full=UPF0190 protein PSPTO_0985;Flags:
  114::265     3e-05  26%  331 aa  Y3178_BURPS RecName: Full=UPF0190 protein BPSL3178;Flags:
  114::265     3e-05  26%  331 aa  Y2758_BURMA RecName: Full=UPF0190 protein BMA2758;Flags: Precursor;
  228::274     4e-05  40%  337 aa  Y4676_PSEPK RecName: Full=UPF0190 protein PP_4676;Flags: Precursor;
  232::271     7e-05  35%  873 aa  NIA_EMENI RecName: Full=Nitrate reductase [NADPH];       
  132::305     7e-05  28%  898 aa  NIA_BETVE RecName: Full=Nitrate reductase [NAD(P)H];       
  251::288     7e-05  37%  894 aa  NIA_BEABA RecName: Full=Nitrate reductase [NADPH];       
  142::290     1e-04  28%  366 aa  Y3662_YERPE RecName: Full=UPF0190 protein
  142::290     1e-04  28%  366 aa  Y3568_YERPS RecName: Full=UPF0190 protein YPTB3568;Flags:
  371::422     1e-04  31%  573 aa  SUOX_DROME RecName: Full=Probable sulfite oxidase, mitochondrial;  
  270::305     5e-04  44%  902 aa  NIA_PHYIN RecName: Full=Nitrate reductase [NADPH];       
  288::320     6e-04  36%  918 aa  NIA_CUCMA RecName: Full=Nitrate reductase [NADH];         Short=NR;
  278::310     6e-04  36%  920 aa  NIA_CICIN RecName: Full=Nitrate reductase [NADH];         Short=NR;
    1::220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxEGMDPRVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLARP
Y1836_ACTSZ     --------------------------------------------EPWTIEVSGEVENPMIFTLAQLLAFP
Y1802_GLUOX     ----------------------------------------------WTLEITGLVRKPVRLDVEQLLRSP
Y3271_SILPO     ----------------------------------------------WSIKIDGMVERPGDYDFQDILSEM
Y1919_ACTP7     --------------------------------------------DPWSLEIAGEVENPFVLNHAQLFNTP
Y1870_ACTPJ     --------------------------------------------DPWSLEIAGEVENPFVLNHAQLFNTP
Y1832_ACTP2     --------------------------------------------DPWSLEIAGEVENPFVLNHAQLFNTP
Y1495_HAES2     ----------------------------------------------WKLEIGGEVENPFTLNYDQLFTQP
Y379_CAMJE      ----------------------------------------------WKIDISGEIEKPLTLSMEDILKFP
Y1017_HAES1     ----------------------------------------------WKLDIGGEVENPFTLNYDQLFTQP
Y537_PASMU      --------------------------------------------EPWTLRIEGEVEKPMTFDVHQLMQQP
YEDY_SALG2      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALEP      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALDC      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
Y1919_AGRT5     ----------------------------------------------WTVKVDGLVSKPQEFGIEELMKYP
YEDY_ECO27      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
NIA7_HORVU      --------------------------------VRNHGAVPKADWSTWTVEVTGLVKRPVKFTMEELVTGF
YEDY_SHIDS      --------------------------------------------DTWTLKISGEVAKPLTLDHDDLTRRP
YEDY_SALSV      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALCH      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALA4      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_ECOLU      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
Y247_PECCP      --------------------------------------------EGWTIKIDGDVAKPLTLDIDDLLKRP
NIA_FUSOX       --------------------------------VRNHGHVPRCEDDDWEFEISGLVENPIKMNVRDLINDQ
YEDY_SHISS      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_SHIB3      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_SALTY      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALTI      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALPK      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALPB      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALPA      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALNS      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_SALHS      --------------------------------------------EPWTLKISGEVAKPFTLDYDDLTHRP
YEDY_ECOUT      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOSM      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOSE      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOLC      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOL6      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOK1      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOHS      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO8A      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO81      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO7I      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO5E      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO57      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO55      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO45      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECO24      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
NIA_ASPNG       ----------------------------ELFYVRNHGPVPLVKDEDWEISIEGLVEKPLVLNFRDILQQD
YEDY_SALAR      --------------------------------------------EPWTLKISGEVAKPYTLDYDDLTHRP
Y264_ERWCT      --------------------------------------------DGWTIKIDGDVAKPLTLDIDDLLKRP
NIA1_ORYSJ      --------------------------------VRNHGAVPRGDWSTWTVDVTGLVKRPMRLTMDELVGFP
YEDY_ECOLI      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
YEDY_ECOBW      --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
NIA1_SOYBN      --------------EGPLPRLMHHGFITPRY-VRNHGPVPKIKWDEWTVEVTGLVKRSTHFTMEKLMREP
Y281_ERWT9      ----------------------------------------------WKIEIDGEVAKPLTLSMDDIFKRA
Y1748_WOLSU     ----------------------------------------------WELLASGEVENPQSLSIDELYQFP
NIA2_HORVU      --------------------------------VRNHGAVPRGDWATWTVEVTGLVRRPARLTMDELAGFP
NIA1_HORVU      --------------------------------VRNHGAVPRGDWATWTVEVTGLVRRPARLTMDELAGFP
NIA3_MAIZE      ------------------PRLMRHGFITPRHYVRNHGPVPRGDWATWTVEVTGLVRRPRALTMDELARDP
Y2981_RALSO     ------------------------EFGTDKSDPARYAGT--LRPHPWQVSVEGLVKAPKTYDLDDLMKMP
NIA2_SOYBN      --------------------------------VRNHGPVPRARWEDWTVEVTGLVTRPTCFTMEQLLHDP
YEDY_ESCF3      --------------------------------------------DPWTLKISGEVAKPLTLDHDALTRRP
Y1383_RHIME     ----------------------------------------------WTVKVDGLVGKPREFGLEELLAFP
Y789_CHRVO      ----------------------------------------------WSVLVDGEVAKPRRFSIEELLKFP
Y2748_CAUCR     ----------------------------------------KFKPRPWTVRIDGACEAPRTVGIEDLIGKN
Y1217_RHISN     ----------------------------------------------WTVKVDGLVGKPRQFGLDELLALP
NIA2_PHAVU      --------------------------------VRNHGPVPKANWEDWTVEITGLVKRPTRFTMDRLVREP
Y1916_HAEDU     --------------------------------------------DPWQLEISGEVENPFVLNHQQLFTFP
Y1703_RHIEC     ----------------------------------------------WAVKVDGMVNKPGTFDVEALIKEP
NIA1_TOBAC      --------------------------------VRNHGPVPKGTWDDWTVEVTGLVKRPMKFTMDQLVNEP
Y4414_SERP5     --------------------------------------------EGWQVRIDGEVAKPITLDIDDLIKRP
Y3990_BRUSU     ----------------------------------------------WKLTVDGLVKQPKEFDVEELIAKP
Y3305_BRUME     ----------------------------------------------WKLTVDGLVKQPKEFDVEELIAKP
NIA_LOTJA       --------------------------------VRNHGPVPKARWDDWTVEVTGLVKTPTRFSMDRLVRDP
Y3641_ENTS8     ----------------------------------------------WTLKIGGEVAKPLTLDHDDLTKKP
NIA2_BRANA      --------------------------------VRNHGTVPKADWSEWTVEITGLVKRPAKFTMEELISEP
Y1588_XANCP     ----------------------------------------------WSVKVSGECEKPGSLSLDELLKGI
NIA2_TOBAC      --------------------------------VRNHGPVPKGTWDDWTVEVTGLVKRPMKFTMDQLVNEP
Y844_METCA      ----------------------------------------------------------------------
Y3877_CAUSK     ----------------------------------------------WTVRVDGECEKPATFAIDDLIKGN
Y1778_RHIE6     ----------------------------------------------WTVKVDGMVNKPGTFDLEALMKEP
NIA_VOLCA       --------------------------------VRNHGAAPRIPWAEHRIEINGLVDKPLFLTMDELVALP
NIA_SOLLC       --------------------------------VRNHGPVPKASWSDWTVEVTGLVKRPMKFTMDQLVNEP
Y1647_XANAC     ----------------------------------------------------------------------
NIA_SPIOL       --------------------------------VRNHGPVPNAKWEDWTVEVTGLVKRPIRFTMDQLVRRK
NIA1_PHAVU      ------------------PRLMQHGFITPSHYVRSHGPVPHARWEDWTVEVTGLVTRPTCFTMEQLVNDP
Y4692_PSEAE     --------------------------------------------EPWSVVIDGEVGKPGTYALEDFVKPY
Y4088_ANASK     ----------------------------------------------WTVTIAGEVKRPQTLDVDALVRMP
Y4120_ANAD2     ----------------------------------------------WTVTIAGEVKRPQTLDVDALVRMP
Y3977_ANADE     ----------------------------------------------WTVTVAGEVKKPQTLDLDALTRMP
NIA_NEUCR       ----------------------------------------------------------------------
Y985_PSESM      ----------------------------------------------------------------------
Y3178_BURPS     ----------------------------------------------WRVSVEGEVRNPKVYDIDALLKAP
Y2758_BURMA     ----------------------------------------------WRVSVEGEVRNPKVYDIDALLKAP
Y4676_PSEPK     ----------------------------------------------------------------------
NIA_EMENI       ----------------------------------------------------------------------
NIA_BETVE       --------------------------------VRNHGPVPKARWEDWSVEVCGLVKRPARFTMDRLVTQN
NIA_BEABA       ----------------------------------------------------------------------
Y3662_YERPE     --------------------------------------------EDWQIKIDGDVVKPMTLDMDYLMCFP
Y3568_YERPS     --------------------------------------------EDWQIKIDGDVVKPMTLDMDYLMCFP
SUOX_DROME      ----------------------------------------------------------------------
NIA_PHYIN       ----------------------------------------------------------------------
NIA_CUCMA       ----------------------------------------------------------------------
NIA_CICIN       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QVELTRDFHCVTRWSRLDVTWKGVRTRDLXXXXXXXXXXXXXXXESYGGYTTNXXXXXXXXXXXXXAHTL
Y1836_ACTSZ     LEERIYRLRCVEAWSMI-VPWIGFELSRLLEKAKPTGKAKYVAFETFGGYKEGLTLAEAMNPLTILSVGL
Y1802_GLUOX     AIERIYRMRCVEAWSMV-IPWDGIPLATLLKDADPDPHATHVAFESIWPYVEGLRLDEAMNPLTLLALGI
Y3271_SILPO     TIERIYRFRCVEAWSMV-IPWNGFELADLLAMAGVQEGAKYVAFETLWPYREGLRLDEAMHPLTLMATGI
Y1919_ACTP7     LEERIYRFRCVEAWSMV-IPWVGFELARLVEMAKPTSKAKFVIFHTFGGYVEALTIEEAMNPLTLLSVGL
Y1870_ACTPJ     LEERIYRFRCVEAWSMV-IPWVGFELARLVEMAKPTSKAKFVIFHTFGGYVEALTIEEAMNPLTLLSVGL
Y1832_ACTP2     LEERIYRFRCVEAWSMV-IPWVGFELARLVEMAKPTSKAKFVIFHTFGGYVEALTIEEAMNPLTLLSVGL
Y1495_HAES2     LEERIYRFRCVEAWAMV-VPWIGFELNKLLEKAKPTSKAKYVVFHTFGGYVEALTLAEAMHSLTLMSVGL
Y379_CAMJE      LEERIYRFRCVETWSMV-VPWVGFELRRLIEMAKPTSEAKFVKFTTLYPYVEGLRMDEAMHPLTLLAVGM
Y1017_HAES1     LEERIYRFRCVEAWAMV-VPWIGFELNKLLEKAKPTSKAKYVVFHTFGGYVEALTLAEAMHSLTLMSVGL
Y537_PASMU      LEERIYRFRCVEAWSMV-IPWIGFELNKLLALVQPTSQAKYVEFETFGGYVEGLTMAEAMHPLTLLSVGL
YEDY_SALG2      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALEP      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALDC      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
Y1919_AGRT5     LEERTYRMRCVEGWSMV-IPWIGFPLSALLDKVEPLGSAKYVSFETVWPYVEGLRLDEARHPLTILAVGL
YEDY_ECO27      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
NIA7_HORVU      QVEFPVTLVCAGNWGPGAISWRGVRLRDVLRRCGVMGAGAASNVCFEGGTSLRRSVAMDPARDVILAYMQ
YEDY_SHIDS      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALSV      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALCH      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALA4      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOLU      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
Y247_PECCP      LEERIYRFRCVEAWSMV-IPWVGFELAKLIKFAEPTSNARYVAFQTMGGYVEGLRMDEAMNPLALLAVGV
NIA_FUSOX       QLTYPVTFVCAGNWGPAGLSWTGVAIGDLLSAAKPKRGARYVCFEGYYGTSIKLNWCMDPNRGVMVAHKM
YEDY_SHISS      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SHIB3      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALTY      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALTI      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALPK      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALPB      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALPA      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALNS      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_SALHS      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLAQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOUT      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOSM      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOSE      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOLC      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOL6      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOK1      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOHS      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO8A      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO81      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO7I      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO5E      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO57      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO55      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO45      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECO24      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
NIA_ASPNG       QITAPITLVCAGNWGSAGLSWTGPMMADILRSAKPLRKAKYVCMEGYYGTSIKLNWAMDPNRGIMLAHKM
YEDY_SALAR      LEERIYRMRCVEAWSMV-VPWIGFPLYKLLTQAQPTSHAKYVAFETLGGYVEGLRLDEAMHPLTLMTVGV
Y264_ERWCT      LEERIYRFRCVEAWSMV-IPWVGFELAKLIKFAEPTSNARYVAFQTLGGYVEGLRMDEAMNPLALLAVGV
NIA1_ORYSJ      AVEIPVTLVCAGNWGAAGVSWRGARLRDVLRRCGIMPSKGGALNVCFEGYGTSITRQWALDPSRDIAYMQ
YEDY_ECOLI      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
YEDY_ECOBW      LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
NIA1_SOYBN      HREFPATLVCAGNWGAAGGSWRGVPLRHVLKRCGILARMKGAMYVSFEGYGTSVKREMAMDPSRDIAFMQ
Y281_ERWT9      QEQRIYRMRCVEGWSMV-VPWVGFELGKLLQAAEPTSNARFVAFHTLGGYVEGLRLDEAMHPLTLLTTGV
Y1748_WOLSU     LEERIYRFRCVEGWSMV-VPWIGFTTKARYVKFTTLLDPTQFPDQKRGAYVEGLRLDEAMHPLTLLAVGM
NIA2_HORVU      AAEVPATLVCAGNWGAAGVSWRGARLRDVLLRCGVMSKKGQALNVCFEGYGTSMSREWAMDPSRDIIYAQ
NIA1_HORVU      AAEVPATLVCAGNWGAAGVSWRGARLRDVLLRCGVMSKKGQALNVCFEGASVSREWAMDPSRDIILPYAQ
NIA3_MAIZE      ALELPVTLVCAGNWGPGAVSWRGARLSDVLRRCGSMSRKGGALFVCFEGYGTSITREVALDPTMDVAYQQ
Y2981_RALSO     MEERIYRLRCVEGWSMV-IPWVGFPLAELIRRVEPQGSARYIQFISLADYSEGLRMDEAMHPLVLLTFGL
NIA2_SOYBN      SREFPATLVCAGNWGAAAISWRGVPLRTLLKSCGIYTRTKGALHVCFEGYGTSILREVALDPSRDIAYMQ
YEDY_ESCF3      LEERIYRMRCVEAWSMV-VPWIGFPLNKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLLTVGV
Y1383_RHIME     LEERIYRMRCVEAWSMV-IPWIGFRVEPLGSAKYVAFETVVRPEEMPGQYREGLRLDEARHPLTILSVGL
Y789_CHRVO      LEERVYRLRCVEGWSMV-IPWVGFPLASLIKQMNPTSRAKYVAFETLQRYREGLRIDEVMHPLAILAVGL
Y2748_CAUCR     KLERIYRMRCVEGWSMV-IPWVGFPLKDLLASVKPTSKAKFVAFETVWPYREGLRIDEAMHPLTLMAVGL
Y1217_RHISN     LEERIYRMRCVEAWSMV-IPWVGFPLASLLDKVEPLGSAKYVAFETVWPYQEGLRLDEARHPLTILAVGL
NIA2_PHAVU      HREFPATLVCAGNWGSAGTSWRGVPVRHVLRRCGILTRGKGALHVSFEGYGTSISREMAMDPSRDIAYMQ
Y1916_HAEDU     LEERIYRFRCVEAWSMV-VPWIGFELARLVEMAKPSSKAKYVVFHTFGGYVEALTIEEAMNSLTLLSVGL
Y1703_RHIEC     IEERTYRMRCVEAWSMV-IPWNGFPLAALLNKVEPLGSAKYVAFETVWPYVEGLRLDEARHPLTLLAVGL
NIA1_TOBAC      SRELPVTLVCAGNWGAAAVSWRGVPLRALLKRYGVFSKNKGALNVCFEGYGTSIKKEFAMDPARDIAYMQ
Y4414_SERP5     LEQRIYRMRCVEAWSMV-VPWIGFELGKLIKFAEPNSNARYVAFQTLGGYVEGLRLDEAMNPLALLTVGV
Y3990_BRUSU     LEERIYRMRCVEAWSMV-IPWIGFQVEPLGSAKYIAFTGVVRPDEMPGQYVEGLRLDEAMHPLTILSVGL
Y3305_BRUME     LEERIYRMRCVEAWSMV-IPWIGFQVEPLGSAKYIAFTGVVRPDEMPGQYVEGLRLDEAMHPLTILSVGL
NIA_LOTJA       SRELPVTLVCAGNWGSAGVSWRGVSLRHILRRCRIQTRSRGALHVCFEGYSTSIRREVAMDPSRDVAYMQ
Y3641_ENTS8     LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALVEPTSNAKYVAFKTLGGYVEALRLDEAMHPLTMLTTGV
NIA2_BRANA      SREFPVTLVCAGNWGSAGVSWKGVPLSEILGRCGIYSRRGGGLNVCFEGYGTSIKKEMAMDPARDIAYMQ
Y1588_XANCP     SAERIYRLRCVEGWSMV-IPWTGVPLGEVLKRFAPTSRAKYVAFTTLADYREGLRIDEAMHPLTLLATGL
NIA2_TOBAC      CRELPVTLVCAGNWGAAAVSWRGVPLRALLKRCGVFSKNKGALNVCFEGYGTSIKKEFAMDPARDIAYMQ
Y844_METCA      ---------------------------------------------------------------------L
Y3877_CAUSK     KLERIYRMRCVEGWSMV-IPWVGFPLKDLIAQVKPTSKAKFVAFETLWPYREGLRIDEAVHPLAILAVGL
Y1778_RHIE6     IEERTYRMRCVEAWSMV-IPWDGFPLASLLDKVEPLGSAKYVAFETIWPYVEGLRLDEARHPLTLLAVGL
NIA_VOLCA       SITFPCTLVCAFNWGPCATSWTGVRLRDLLLLAGIKSPEQGANFVCFGSYGTSYAKAMDPSSDVIIAYKQ
NIA_SOLLC       SREFPVTLVCAGNWGAAAVSWRGVPLRALLKRCGVQSKKKGALNVCFEGYGTSIKKEFAMDPSRDIAYMQ
Y1647_XANAC     ---------------------------------------------------------------------L
NIA_SPIOL       EQNMTKQ-SIGFNWGSAAVSWRGVPLRDVLKRCGVMSSLKGALNVCFEGYGTSVKREFAMDPARDIAYMQ
NIA1_PHAVU      SHEFPATLVCAGNWGAGGVSWRGVSLRSLLKRCGIYSRAKGALHVCFGGGGSNYGTSLMREVALDPSRDI
Y4692_PSEAE     QLERIYRLRCVEAWSMV-IPWLGFPLADLLKRVEPNGQAKFVRFETLSGFSVIDWPYMEGLRMDEAMHPL
Y4088_ANASK     PEERVYRMRCVEAWSMV-IPWVGFPLADLVRRLEPTSRAKYVAFQTLWPYVEALRIDEATHPLALLAVGL
Y4120_ANAD2     PEERVYRMRCVEAWSMV-IPWVGFPLADLVRRLEPTSRAKYVAFQTLWPYVEALRIDEANHPLALLAVGL
Y3977_ANADE     LEERVYRMRCVEAWSMV-IPWVGFPLGDLVRRLEPTSRAKYVAFQTLWPYVESLRIDEAAHPLALLAVGL
NIA_NEUCR       ------------------------------------------------------------------AHKM
Y985_PSESM      ---------------------------------------------------------------------M
Y3178_BURPS     LEERVYRLRCVEGWSMV-IPWIGFPLAELIKRVEPTANAKYVQFVTLADYSEGLRMDEAMNPLTLLTIGV
Y2758_BURMA     LEERVYRLRCVEGWSMV-IPWIGFPLAELIKRVEPTANAKYVQFVTLADYSEGLRMDEAMNPLTLLTIGV
Y4676_PSEPK     ---------------------------------------------------------------------M
NIA_EMENI       ------------------------------------------------------------------AHKM
NIA_BETVE       MVKKTIGFN----WGAAGVSWRGVPLRDVLKRCGIFSRGRGAFNVCFGGGGSKYGTSVKYEMAMDPARDI
NIA_BEABA       ------------------------------------------------------------------AHKM
Y3662_YERPE     LEERIYRLRCVEAWSMV-VPWIGFELGKLLKLAEPTSNARYVAFQTLGGYVEGLRLDEAMHPLAFMVVGV
Y3568_YERPS     LEERIYRLRCVEAWSMV-VPWIGFELGKLLKLAEPTSNARYVAFQTLGGYVEGLRLDEAMHPLAFMVVGV
SUOX_DROME      ------------------------------------------------------------------AYEM
NIA_PHYIN       ----------------------------------------------------------------------
NIA_CUCMA       ----------------------------------------------------------------------
NIA_CICIN       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRI
Y1836_ACTSZ     YGKTLTPQNGAPIRLVVPWKYGFKSIKSIVKIRLTERQPVTTWNQLTPHEYG------------------
Y1802_GLUOX     YGETLPNQNGAPLRLVVPWKYGFKGIKSIQRIRLLDHEPPTTWNRL------------------------
Y3271_SILPO     YGKPLPNQNGAPLRLVVPWKYGFKSIKSIVRITLTDREPPASW---------------------------
Y1919_ACTP7     YGKMLPPQNGAPIRLVVPWKYGFKSIKSIVKITFSETRPRTTWEKLAPHEYG------------------
Y1870_ACTPJ     YGKMLPPQNGAPIRLVVPWKYGFKSIKSIVKITFSETRPRTTWEKLAPHEYG------------------
Y1832_ACTP2     YGKMLPPQNGAPIRLVVPWKYGFKSIKSIVKITFSETRPRTTWEKLAPHEYG------------------
Y1495_HAES2     YGKALAPQNGAPIRLVVPWKYGFKSIKSIVKITLSETRPRTTWESL------------------------
Y379_CAMJE      YKKALKPQNGAPIRLVVPWKYGFKSIKSIVKIEFTKEQPKSTWE--------------------------
Y1017_HAES1     YGKALAPQNGAPIRLVVPWKYGFKSIKSIVKITLSETRPRTTWESL------------------------
Y537_PASMU      YGKTLAPQNGAPIRLVVPWKYGFKNIKSIVKITLKSEQPMTTWHHAAPHEYG------------------
YEDY_SALG2      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTRERPLTTW---------------------------
YEDY_SALEP      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTRERPLTTW---------------------------
YEDY_SALDC      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTRERPLTTW---------------------------
Y1919_AGRT5     YGETLPNQNGAPIRLVVPWKYGFKGIKSIMRISLVEKREYGFYSNVNPHVDHPRWSEQRIGEGGF-----
YEDY_ECO27      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTSEREYGFYANVNPHVDHPRWSQERF----------
NIA7_HORVU      NGEPLAPDHGFPVRVIVPGFIGGRMVKWLKRIVV------------------------------------
YEDY_SHIDS      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTEHPEYGFYANVNPHVDHPRWSQERF----------
YEDY_SALSV      YGKALPPQNGAPIRLIVPWKYGFKGIKSVVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALCH      YGKALPPQNGAPIRLIVPWKYGFKGIKSVVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALA4      YGKALPPQNGAPIRLIVPWKYGFKGIKSVVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOLU      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTRECEYGFYANVNPHVDHPRWSQERF----------
Y247_PECCP      YGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHI--------------------------------------
NIA_FUSOX       NGNPLPPDHGKPVRIVIPGQIGGRSIKWLKKITI------------------------------------
YEDY_SHISS      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SHIB3      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALTY      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALTI      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALPK      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALPB      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALPA      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALNS      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_SALHS      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOUT      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOSM      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOSE      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOLC      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOL6      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOK1      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECOHS      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO8A      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO81      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO7I      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO5E      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO57      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO55      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO45      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
YEDY_ECO24      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
NIA_ASPNG       NGEDLRPDHGRPLRAVVPGQIGGRSVKWLKKLILTD----------------------------------
YEDY_SALAR      YGKALPPQNGAPIRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
Y264_ERWCT      YGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRL------------------------------------
NIA1_ORYSJ      NGEPLLPDHGFPVRAIIPGCIGGRMVKWVKRIIV------------------------------------
YEDY_ECOLI      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
YEDY_ECOBW      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
NIA1_SOYBN      NGEPLAPDHGFPVRMIIPGFIGGRMVKWLKRIVVTEH---------------------------------
Y281_ERWT9      YGKALPPQNGAPIRLTVPWKYGFKGIKSIVKISLVKAMPPTTWNQL------------------------
Y1748_WOLSU     YGEKLPAQNGAPLRLIVPWKYGFKSIKSIAKIELTQEEPLNTWKLL------------------------
NIA2_HORVU      NGEPLLPDHGYPVRVLIPGCIGGRMVKWVRRIVV------------------------------------
NIA1_HORVU      NGEPLLPDHGYPVRVLIPGCIGGRMVKWVRRIVV------------------------------------
NIA3_MAIZE      NGGPLLPDHGFPVRLIVPGCTAGRMVKWLKRIVV------------------------------------
Y2981_RALSO     YGQVLPNQNGAPVRVIVPWKYGFKSAKSIVRIRFVD----------------------------------
NIA2_SOYBN      NGEPLSPDHGFPVRMIIPGFIGGRMVKWLKRIIV------------------------------------
YEDY_ESCF3      YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTREREYGFYANVNPHVDHPRWSQERF----------
Y1383_RHIME     YGKTLPNQNGAPIRLVVPWKYGFKGIKSIVRISLTE----------------------------------
Y789_CHRVO      YGNALPNQNGAPIRLVVPWKYGFKSIKSIVRIRLQETMPATSWNMANAHEYG------------------
Y2748_CAUCR     YGDVLPNQNGAPLRLVVPWKYGFKGIKSIVRISLVEKQPVTSWNVL------------------------
Y1217_RHISN     YGKTLPNQNGAPLRLVVPWKYGFKGIKSIVRISLTE----------------------------------
NIA2_PHAVU      NGEPLAPDHGFPIRMIIPGFIGGRMVKWLKRIVVTE----------------------------------
Y1916_HAEDU     YGKMLPPQNGAPIRLVMPWKYGF-----------------------------------------------
Y1703_RHIEC     YGETLPNQNGAPIRLVVPWKYGFKGIKSIVRITLTDQQPKNTWQ--------------------------
NIA1_TOBAC      NGEKLAPDHGFPVRMIIPGFIGGRMVKWIKRIIV------------------------------------
Y4414_SERP5     YGKTLPPQNGAPLRLITPWKYGFKGIKSIVHIRLVRDQEYGFYANVNPHVDHPRWSQERF----------
Y3990_BRUSU     YGETLPNANGAPIRLVVPWKYGFKGIKAITRISFVEKQPPTSWNR-------------------------
Y3305_BRUME     YGETLPNANGAPIRLVVPWKYGFKGIKAITRISFVEKQPPTSWNR-------------------------
NIA_LOTJA       NGEVLAPDHGFPVRVIIPGFIGGRMVKWLKRIVVTE----------------------------------
Y3641_ENTS8     YGKALPPQNGAPVRLTVPWKYGFKGIKSIVSITL------------------------------------
NIA2_BRANA      NGELLTPDHGFPVRIIVPGFIGGRMVKWLKRIIV------------------------------------
Y1588_XANCP     YGKPLPQQNGAPLRLVVPWKYGFKSIKSIVEIRFVEKMPETAWHDL------------------------
NIA2_TOBAC      NGEKLAPDHGFPVRMIIPGFIGGRMVKWIKRIIV------------------------------------
Y844_METCA      YGEVLPNQNGAPVRVVVPWKYGFKSAKSIVRIRFVEQQPVSTWTR-------------------------
Y3877_CAUSK     YGDVLPNQNGAPLRLVVPWKYGFKGIKSIVRISLVETMPATAWNVL------------------------
Y1778_RHIE6     YGETLANQNGAPIRLVVPWKYGFKGIKSIVRITLTDQQPKNTWQ--------------------------
NIA_VOLCA       NHRWLTPDHGFPVRMIIPGFIGGRMVKWLSEITVTE----------------------------------
NIA_SOLLC       NGEMLSPDHGFPVRMIIPGFIGGRMVKWLKRIVV------------------------------------
Y1647_XANAC     YGKPLPQQNGAPLRLVVPWKYGFKSIKSIVEIRFVEKMPETAWHDL------------------------
NIA_SPIOL       NGEKLSPDHGYPVRMIIPGFIGGRMVKWLKRIIV------------------------------------
NIA1_PHAVU      IGELLSPDHGFPVRMIIPGFIGGRMVKWLKRIVV------------------------------------
Y4692_PSEAE     YGRLLPNQNGAPLRLVVPWKYGFKSIKSIVRISLVREQPKTTWESI------------------------
Y4088_ANASK     YGRALPGQNGAPLRLVVPWKYGFKGAKSIVRITFL-----------------------------------
Y4120_ANAD2     YGRVLPGQNGAPLRLVVPWKYGFKGAKSIVRITFL-----------------------------------
Y3977_ANADE     YGRVLPGQNGAPLRLVVPWKYGFKGAKSIVRITFL-----------------------------------
NIA_NEUCR       NGENLHPDHGRPVRVVVPGQIGGRSVKWLKRIVV------------------------------------
Y985_PSESM      YGRELPNQNGAPLRLVVPWKYGFKSVKSIVRISLVSEQPKTTWQSI------------------------
Y3178_BURPS     YGQVLPNQNGAPVRVIVPWKYGFKSAKSIVKIRFVDRQPPTSW---------------------------
Y2758_BURMA     YGQVLPNQNGAPVRVIVPWKYGFKSAKSIVKIRFVDRQPPTSW---------------------------
Y4676_PSEPK     YGRELPNQNGAPLRLVVPWKYGFKSIKSIVRISLVAEQPGTTWEGL------------------------
NIA_EMENI       NGEDLRPDHGRPLRAVVPGQIGGRSVKWLKKLIITD----------------------------------
NIA_BETVE       IGERLSPDHGFPVRMIIPGFIGGRMVKWLKRIIV------------------------------------
NIA_BEABA       NGQSLHPDHGKPVRIIIPGQIGGRSVKWLKKITI------------------------------------
Y3662_YERPE     YGKTLPPQNGAPLRLMTPWKYGFKSIKSIVHIRL------------------------------------
Y3568_YERPS     YGKTLPPQNGAPLRLMTPWKYGFKSIKSIVHIRL------------------------------------
SUOX_DROME      NDEPLSRDHGFPIRVIVPGTVGARNVKWLTRIVVADKESDSHWQQNDY----------------------
NIA_PHYIN       -GELLGPDHGFPVRLIVPGHIGGRMVKWLERIHVSDH---------------------------------
NIA_CUCMA       -GEQLAPDHGFPVRMIIPGFIGGRMVKWLKRIIV------------------------------------
NIA_CICIN       -GEKLSPDHGFPVRMIIPGFIGGRMVKWLKRIIV------------------------------------


                         .         .         .         +         .         .         .:280
query           RFAARNKPxx
Y1836_ACTSZ     ----------
Y1802_GLUOX     ----------
Y3271_SILPO     ----------
Y1919_ACTP7     ----------
Y1870_ACTPJ     ----------
Y1832_ACTP2     ----------
Y1495_HAES2     ----------
Y379_CAMJE      ----------
Y1017_HAES1     ----------
Y537_PASMU      ----------
YEDY_SALG2      ----------
YEDY_SALEP      ----------
YEDY_SALDC      ----------
Y1919_AGRT5     -FGTQNRP--
YEDY_ECO27      ----------
NIA7_HORVU      ----------
YEDY_SHIDS      ----------
YEDY_SALSV      ----------
YEDY_SALCH      ----------
YEDY_SALA4      ----------
YEDY_ECOLU      ----------
Y247_PECCP      ----------
NIA_FUSOX       ----------
YEDY_SHISS      ----------
YEDY_SHIB3      ----------
YEDY_SALTY      ----------
YEDY_SALTI      ----------
YEDY_SALPK      ----------
YEDY_SALPB      ----------
YEDY_SALPA      ----------
YEDY_SALNS      ----------
YEDY_SALHS      ----------
YEDY_ECOUT      ----------
YEDY_ECOSM      ----------
YEDY_ECOSE      ----------
YEDY_ECOLC      ----------
YEDY_ECOL6      ----------
YEDY_ECOK1      ----------
YEDY_ECOHS      ----------
YEDY_ECO8A      ----------
YEDY_ECO81      ----------
YEDY_ECO7I      ----------
YEDY_ECO5E      ----------
YEDY_ECO57      ----------
YEDY_ECO55      ----------
YEDY_ECO45      ----------
YEDY_ECO24      ----------
NIA_ASPNG       ----------
YEDY_SALAR      ----------
Y264_ERWCT      ----------
NIA1_ORYSJ      ----------
YEDY_ECOLI      ----------
YEDY_ECOBW      ----------
NIA1_SOYBN      ----------
Y281_ERWT9      ----------
Y1748_WOLSU     ----------
NIA2_HORVU      ----------
NIA1_HORVU      ----------
NIA3_MAIZE      ----------
Y2981_RALSO     ----------
NIA2_SOYBN      ----------
YEDY_ESCF3      ----------
Y1383_RHIME     ----------
Y789_CHRVO      ----------
Y2748_CAUCR     ----------
Y1217_RHISN     ----------
NIA2_PHAVU      ----------
Y1916_HAEDU     ----------
Y1703_RHIEC     ----------
NIA1_TOBAC      ----------
Y4414_SERP5     ----------
Y3990_BRUSU     ----------
Y3305_BRUME     ----------
NIA_LOTJA       ----------
Y3641_ENTS8     ----------
NIA2_BRANA      ----------
Y1588_XANCP     ----------
NIA2_TOBAC      ----------
Y844_METCA      ----------
Y3877_CAUSK     ----------
Y1778_RHIE6     ----------
NIA_VOLCA       ----------
NIA_SOLLC       ----------
Y1647_XANAC     ----------
NIA_SPIOL       ----------
NIA1_PHAVU      ----------
Y4692_PSEAE     ----------
Y4088_ANASK     ----------
Y4120_ANAD2     ----------
Y3977_ANADE     ----------
NIA_NEUCR       ----------
Y985_PSESM      ----------
Y3178_BURPS     ----------
Y2758_BURMA     ----------
Y4676_PSEPK     ----------
NIA_EMENI       ----------
NIA_BETVE       ----------
NIA_BEABA       ----------
Y3662_YERPE     ----------
Y3568_YERPS     ----------
SUOX_DROME      ----------
NIA_PHYIN       ----------
NIA_CUCMA       ----------
NIA_CICIN       ----------