[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS82142.1

[Show Plain Result]


## Summary of Sequence Search
    1::285
    1::245     5e-17  28%  304 aa  BENM_ACIAD RecName: Full=HTH-type transcriptional regulator
    6::250     1e-15  27%  297 aa  YNFL_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::239     2e-15  24%  302 aa  ALSR_BACSU RecName: Full=HTH-type transcriptional regulator
    1::173     3e-14  32%  289 aa  CATR_PSEPU RecName: Full=HTH-type transcriptional regulator
    1::240     5e-14  26%  303 aa  CATM_ACIAD RecName: Full=HTH-type transcriptional regulator
    1::252     1e-13  26%  303 aa  CATR_ACILW RecName: Full=Probable cat1 operon transcriptional
    8::258     9e-11  28%  294 aa  XAPR_ECOLI RecName: Full=HTH-type transcriptional regulator
  167::239     8e-09  36%  304 aa  TTUA4_AGRVI RecName: Full=HTH-type transcriptional regulator
    4::231     2e-08  25%  299 aa  CYNR_ECOLI RecName: Full=HTH-type transcriptional regulator
    1::262     3e-08  27%  324 aa  YCGK_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    4::231     9e-08  25%  299 aa  CYNR_ECO57 RecName: Full=HTH-type transcriptional regulator
   13::247     2e-07  34%  311 aa  OXYR_MYCMR RecName: Full=Probable hydrogen peroxide-inducible genes
  129::254     2e-07  34%  311 aa  OXYR_MYCLE RecName: Full=Probable hydrogen peroxide-inducible genes
   13::254     2e-07  38%  311 aa  OXYR_MYCAV RecName: Full=Probable hydrogen peroxide-inducible genes
    6::237     4e-07  24%  299 aa  CYSL_BACSU RecName: Full=HTH-type transcriptional regulator
    1::240     5e-07  23%  296 aa  HCAR_ECOLI RecName: Full=Hca operon transcriptional activator;
    1::239     1e-06  22%  301 aa  YWBI_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::37      3e-06  57%  293 aa  YKUM_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    6::190     4e-06  25%  302 aa  RBCR_CHRVI RecName: Full=RuBisCO operon transcriptional regulator;
    1::38      1e-05  53%  144 aa  YIBL_AZOVI RecName: Full=Uncharacterized HTH-type transcriptional
    1::38      1e-05  50%  228 aa  TFDT_RALEJ RecName: Full=HTH-type transcriptional regulator tfdT;
    8::39      2e-05  56%  317 aa  YBHD_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  123::239     4e-05  28%  292 aa  YYBE_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::38      4e-05  47%  294 aa  CLCR_PSEPU RecName: Full=HTH-type transcriptional regulator
    3::39      6e-05  54%  306 aa  SDSB_PSES9 RecName: Full=SDS degradation transcriptional
    1::38      1e-04  50%  296 aa  ILVR_CAUCR RecName: Full=HTH-type transcriptional regulator
    7::40      2e-04  50%  307 aa  RBCR_PHATR RecName: Full=Probable RuBisCO transcriptional
    8::41      3e-04  47%  307 aa  RBCR_THAPS RecName: Full=Probable RuBisCO transcriptional
   10::42      4e-04  52%  310 aa  RBCR_GUITH RecName: Full=Probable RuBisCO transcriptional
    1::62      4e-04  38%  293 aa  HDFR_YERPY RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPS RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPP RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPN RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPG RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPE RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPB RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERPA RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERP3 RecName: Full=HTH-type transcriptional regulator
    1::62      4e-04  38%  293 aa  HDFR_YERE8 RecName: Full=HTH-type transcriptional regulator
    6::39      5e-04  44%  308 aa  YFER_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
    6::39      5e-04  44%  308 aa  YFER_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  153::240     5e-04  27%  304 aa  TTUA3_AGRVI RecName: Full=HTH-type transcriptional regulator
    1::240     5e-04  22%  300 aa  GLTC_BACSU RecName: Full=HTH-type transcriptional regulator gltC;
    9::37      6e-04  59%  299 aa  YCJZ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   10::42      6e-04  48%  303 aa  RBCR_CYAME RecName: Full=Probable RuBisCO transcriptional
  130::242     6e-04  28%  316 aa  CBL_KLEAE RecName: Full=HTH-type transcriptional regulator cbl;
   12::44      8e-04  48%  324 aa  RBCR_CYAPA RecName: Full=Probable RuBisCO transcriptional
  126::189     8e-04  33%  305 aa  OXYR_ECOLI RecName: Full=Hydrogen peroxide-inducible genes
  126::189     8e-04  33%  305 aa  OXYR_ECOL6 RecName: Full=Hydrogen peroxide-inducible genes
  126::189     8e-04  33%  305 aa  OXYR_ECO57 RecName: Full=Hydrogen peroxide-inducible genes
  170::250     8e-04  32%  308 aa  MAUR_KLEPN RecName: Full=Malonate utilization transcriptional
    1::37      8e-04  35%  290 aa  BSDA_BACSU RecName: Full=HTH-type transcriptional regulator
    1::285

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGDXXXXXXXXXX
BENM_ACIAD      MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLL
YNFL_ECOLI      ---RHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTSVLLTAAGKQFLADSRQIL
ALSR_BACSU      MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKVELTAAGEIFLNHCRMAL
CATR_PSEPU      MELRHLRYFKVLAETLNFTRAAELLHIAQPPLSRQIQLEDQLGTLLVVRERPLRLTEAG-RFFYEQSCTV
CATM_ACIAD      MELRHLRYFVTVVEEQSISKAAEKLCIAQPPLSRQIQKLEEELGIQLFERGPAKVTEAGMFFYQHAVQIL
CATR_ACILW      MDLRQFRYFVAVARERNFTRAARQLNIAQPPLSRQIQLLEEEVGVPLLIRNPVQLTDAGRLFFEQAIQVL
XAPR_ECOLI      -DLKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHIKELENQLGTQLFIRHSRSLTHAGKILMEESRRLL
TTUA4_AGRVI     ----------------------------------------------------------------------
CYNR_ECOLI      ---RHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGVPLFDRSTIRLTDAGEVWRQYASRAL
YCGK_BACSU      MDIKVMEYAAEIARRQSFTKAAEHLHIAQPSLSQQIKKLEAELGLTLFHRSSVTLTPHGRRFIEKAEDII
CYNR_ECO57      ---RHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGVPLFDRSTIHLTDAGEVWRQYASRAL
OXYR_MYCMR      -----LRAFVAVAEKQHFGSAANALGVSQSTLSQALAALEAGLNLHLVERSTRRLTTEGRSLLPHXXXXX
OXYR_MYCLE      ----------------------------------------------------------------------
OXYR_MYCAV      -----LRAFVAVAEKRQFSGAATALGVSQSTLSQVLAALEAGLGTQLVERSTRRLTPQG-AELLPHXXXX
CYSL_BACSU      -----LKTFIAVVEEKNFTKAAEKLMISQPSVSLHIKNLEKEFQTALLNRSPFTTTPTGDQMVFLYEQAK
HCAR_ECOLI      MELRHLRYFVAVAQALNFTRAAEKLHTSQPSLSSQIRENCVGVPLLVRDKRKVALTAAGECFLQDALAIL
YWBI_BACSU      MDIRHLTYFLEVARLKSFTKASQSLYVSQPTISKMIKEEELGIELFYRNGRQVELTDAGHVQAQEIIKSF
YKUM_BACSU      MQLQELHMLVVLAEELNMRKAAERLFVSQPALSQRLQ---------------------------------
RBCR_CHRVI      ---RQLRVFEAVARHNSYTRAAEELHLSQPAVSMQVRQLEDEIGLSLFERLGKQLTEAGREVFHYSRAIG
YIBL_AZOVI      MDLASLNAFIAVAETGSFSEAGERLHLTQPAVSKRIAA--------------------------------
TFDT_RALEJ      MEIRQLKYFVAVAEAGGFGTAAQRMHISQPPLTRQIQA--------------------------------
YBHD_ECOLI      -----MKAFVILAESSSFNNAAKLLNITQPALTRRIK---------------------------------
YYBE_BACSU      ----------------------------------------------------------------------
CLCR_PSEPU      MEFRQLRYFIAVAEEGNIGAAARRLHISQPPITRQIQA--------------------------------
SDSB_PSES9      -DLRQLRHFVALAEHGHFARAAEAVNLSQPALSRSIQA--------------------------------
ILVR_CAUCR      MDIRQFRHFAAVAETLHFGRAAERLGITQPPLSQSIQA--------------------------------
RBCR_PHATR      ---QQLRILKAVATEKNFTKAAELLYLSQPSLSKQIK---------------------------------
RBCR_THAPS      ---QQLRIFKAIASEKSFTQAAEILFVSQPSLSKQIK---------------------------------
RBCR_GUITH      ----QLRILKAIASEGSFKKAAESLYISQPAVSLQIQ---------------------------------
HDFR_YERPY      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPS      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPP      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPN      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPG      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPE      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPB      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERPA      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERP3      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
HDFR_YERE8      MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRENQLGANLFTRHRNNIRLTPAGE----------
YFER_SHIFL      ---KQLKVFVTVAQEKSFSRAGERIGLSQSAVSHSVK---------------------------------
YFER_ECOLI      ---KQLKVFVTVAQEKSFSRAGERIGLSQSAVSHSVK---------------------------------
TTUA3_AGRVI     ----------------------------------------------------------------------
GLTC_BACSU      MELRQLRYFMEVAEREHVSEAADHLHVAQSAISRQIAEEELNVTLFEREGRNIKLTPIGKEFLIHVKTAM
YCJZ_ECOLI      -----LMAFVVVAEERSFTRAAARLSMAQSALSQ------------------------------------
RBCR_CYAME      ----QLRIFQAIVVEGSFQKAAQSLYISQPAVSLQIQ---------------------------------
CBL_KLEAE       ----------------------------------------------------------------------
RBCR_CYAPA      ----QLRILKAIATEGSFKKAAESLYMTQPAISLQIQ---------------------------------
OXYR_ECOLI      ----------------------------------------------------------------------
OXYR_ECOL6      ----------------------------------------------------------------------
OXYR_ECO57      ----------------------------------------------------------------------
MAUR_KLEPN      ----------------------------------------------------------------------
BSDA_BACSU      MDIRQLRYFITIAQEQKITSAAKKLHMAQPPLSRQLK---------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXVRRAGQEALRFGVPENXXXXXXXXXXXXRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAG
BENM_ACIAD      SNVDQMVSMTKRIAEKTIRIGFVGSLLFGLLPRIIHLYRQANLRIELYEMGTKAQTEALKEGRIDAGFGR
YNFL_ECOLI      SMVDDAAARAERAGELRIGFTSSAPFIRAVSDTLSLFRRDYPDVLQTREMNTREQIAPLIEGTLDMGLLR
ALSR_BACSU      MQIGQGIELAQRTGLLVIGFVGSATYEFLPPIVREYRKKFPSVKIELREISSSRQQEELLKGNIDIGILH
CATR_PSEPU      LQLQNISDNTRRIGQQWLGIGAPSTLYKVLPELIRELRQDSELELGLNEMTTLQQVEALKSGRIDIAFGR
CATM_ACIAD      THTAQASSMAKRIASQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIELIECGTKDQINALKQGKIDLGFGR
CATR_ACILW      GRVEQMQAATRRVGRSVLSIGVASTLYGVLPTLMRKLRQHAPELIQMVELMSVQQIQAINEGRIDIGFGR
XAPR_ECOLI      VNANNVLARIEQIGREAGRIELGVVGTAMWGRMRPVMRRFLRENVDVLEKMPAMQMALLERRELDAGIWR
TTUA4_AGRVI     ----------------------------------------------------------------------
CYNR_ECOLI      QELGAGKRAIHDVARGSLRIAVTPTFTSYFIGPLMADARYPSITLQLQEMSQEKIEDMLCRDELDVGIAF
YCGK_BACSU      RSRDDLLREMQERSQHKLSIGIPAGRYLFPPLLKQFLARYPHVEVQLVEKDPVSLEKMTAKGEVDLSVLS
CYNR_ECO57      QELGAGKRAIHDVARGSLRIAVTPTFTSYFIGPLMADARYPGITLQLQEMSQEKIEDLLCRDELDVGIAF
OXYR_MYCMR      XXXXXXXXXXXXXXDPSIRFGIIPTVAPYVLPTVLAGRRLPTLTVRVIEDQTERLLTALREGSLDTALIA
OXYR_MYCLE      --------------------------------------------LRVVEDQTEHLLTALREGALDAAMIA
OXYR_MYCAV      XXXXXXXXXXXXGSTDPLRAGMXXXXXXXXXXXAGIAERRPGLTLRVTEDQTERLLAVLREGALDAALIA
CYSL_BACSU      AEIYAHHHYVKGELKIAASFTIGEYILPPLLAQLQKLYPELN--LDVMIGNTEEVSERVRMLQADIGLIE
HCAR_ECOLI      EQAENAKLRARKIVQEQLTIGVPSAEVNLLPKVLPMFRRQPDTLIELVSLITTQQEEKIRRGELDVGLMR
YWBI_BACSU      QNLTSELNDIMEVKKGHVRIGLPPMIGSGFFPRVLGDFRENYPNVQLVEDGSIKVQEGVGDGSLDIGVVV
YKUM_BACSU      ----------------------------------------------------------------------
RBCR_CHRVI      QSLREMEEVLKGVSRGSLRIAVASTVNYFAPRLMAIFQQGIGLRLDVTNRES--LVQMLDSNSVDLVLMG
YIBL_AZOVI      ----------------------------------------------------------------------
TFDT_RALEJ      ----------------------------------------------------------------------
YBHD_ECOLI      ----------------------------------------------------------------------
YYBE_BACSU      ---------------------------------------------QLKQNHSYWLLERLKSGDLDLCLAS
CLCR_PSEPU      ----------------------------------------------------------------------
SDSB_PSES9      ----------------------------------------------------------------------
ILVR_CAUCR      ----------------------------------------------------------------------
RBCR_PHATR      ----------------------------------------------------------------------
RBCR_THAPS      ----------------------------------------------------------------------
RBCR_GUITH      ----------------------------------------------------------------------
HDFR_YERPY      ----------------------------------------------------------------------
HDFR_YERPS      ----------------------------------------------------------------------
HDFR_YERPP      ----------------------------------------------------------------------
HDFR_YERPN      ----------------------------------------------------------------------
HDFR_YERPG      ----------------------------------------------------------------------
HDFR_YERPE      ----------------------------------------------------------------------
HDFR_YERPB      ----------------------------------------------------------------------
HDFR_YERPA      ----------------------------------------------------------------------
HDFR_YERP3      ----------------------------------------------------------------------
HDFR_YERE8      ----------------------------------------------------------------------
YFER_SHIFL      ----------------------------------------------------------------------
YFER_ECOLI      ----------------------------------------------------------------------
TTUA3_AGRVI     ----------------------------------------------------------------------
GLTC_BACSU      KAIDYAKEQIDEPHRGTVKIGFPTSLASQLLPTVISAFKEEYPHVEFLLRQGSYKIEAVRNRDIDLALLG
YCJZ_ECOLI      ----------------------------------------------------------------------
RBCR_CYAME      ----------------------------------------------------------------------
CBL_KLEAE       ---------------------------------------------------TPQEIEALHNGGADIGIAS
RBCR_CYAPA      ----------------------------------------------------------------------
OXYR_ECOLI      ------------------------------------------------EAQTHQLLAQLDSGKLDCVILA
OXYR_ECOL6      ------------------------------------------------EAQTHQLLAQLDSGKLDCVILA
OXYR_ECO57      ------------------------------------------------EAQTHQLLAQLDSGKLDCVILA
MAUR_KLEPN      ----------------------------------------------------------------------
BSDA_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEXXXXXXXXXXXXXYEAFMEVFRRAGFAP
BENM_ACIAD      LKISDPAIKRTLLRNERLMVAVHASHPLMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEP
YNFL_ECOLI      NTALPESLEHAVIVHEPLMAMIPHDHPLANNPNVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYHLTP
ALSR_BACSU      PPLQHTALHIETAQSSPCVLALPKQHPLTSKESITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRP
CATR_PSEPU      IRIDDPAIHQQVLCEDPLVAVLPKDHPLA-----------------------------------------
CATM_ACIAD      LKITDPAIRRIVLHKEQLKLAIHKHHHLNQFAAVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVP
CATR_ACILW      VHHSDPNVSSIVLHEERLAVALPMESPMARESTLPVHQLAGEKLIVYPKEPRPGFADQVLNILDRHDVQP
XAPR_ECOLI      MATEPPTFTSLRLHESAFLVAMPEEHHLSSFSTVPLEALRDEYFVTMPPVYTD--WDFLQRVCQQVGFSP
TTUA4_AGRVI     ------------------VIALPVTHPLANRERISVDELREEPLIVPERRSRPHSYDLTMKLFEDAGLHP
CYNR_ECOLI      APVHSPELEAIPLLTESLALVVAQHHPLAVHEQVALSRLHDEKLVLLSAEFATR--EQIDHYCEKAGLHP
YCGK_BACSU      LPIEDERLSITPLLTEPVVLAVPEKQRWMPPELVALKALEEDEGRQPCVPIDMVRNVPFILLFRRSGFKP
CYNR_ECO57      APVHLPELEAIPLLTESLALVVAQHHPLAACEQVALSRLHDEKLVLLSAEFATR--EQIDHYCEKAGLHP
OXYR_MYCMR      LPADYRGLTEMPIYEEDFVLALPPGHPMADRHGVPVAAXXXXXXXXXDEGHCLR--DQALDVCQNAGVRA
OXYR_MYCLE      LPVETAGIAEIPIYDEDFVLALPPGHPLSGKRRVXXXXXXXXXXXXXDEGHCLR--DQTLDICRKSGVQA
OXYR_MYCAV      LPAETAGVTAIPIYDEDFVLALPPGHPLAGKRRVXXXXXXXXXXXXXXEGHCLR--DQALDVCHKAGVRA
CYSL_BACSU      GHTNENELEIEPFMEDEMCIAAPNQHPLAGRKEISISDLQNEAWVTREKGSGTREY--LDHVLSSNGLRP
HCAR_ECOLI      HPVYSPEIDYXXXXXXXXXXXXXXXHPLAHEKEITAAQLDGVNFVSTDPVYSGSLAPIVKAWFAQENSQP
YWBI_BACSU      LPANEDIFHSFTIVKETLMLVVHPSHRLADEKECQLRELKDE--PFIFFREDFVLHNRIMTECIKAGFRP
YKUM_BACSU      ----------------------------------------------------------------------
RBCR_CHRVI      VPPRNVEVEAEAFMDNPLVVIAPPDHPLAGERAISLARLAEE----------------------------
YIBL_AZOVI      ----------------------------------------------------------------------
TFDT_RALEJ      ----------------------------------------------------------------------
YBHD_ECOLI      ----------------------------------------------------------------------
YYBE_BACSU      IKPENP-IQWIKLWSEELFVFVPNDHPLASRESITLNEIAGERFILLKKGYALRM--TVDELFEKANIQP
CLCR_PSEPU      ----------------------------------------------------------------------
SDSB_PSES9      ----------------------------------------------------------------------
ILVR_CAUCR      ----------------------------------------------------------------------
RBCR_PHATR      ----------------------------------------------------------------------
RBCR_THAPS      ----------------------------------------------------------------------
RBCR_GUITH      ----------------------------------------------------------------------
HDFR_YERPY      ----------------------------------------------------------------------
HDFR_YERPS      ----------------------------------------------------------------------
HDFR_YERPP      ----------------------------------------------------------------------
HDFR_YERPN      ----------------------------------------------------------------------
HDFR_YERPG      ----------------------------------------------------------------------
HDFR_YERPE      ----------------------------------------------------------------------
HDFR_YERPB      ----------------------------------------------------------------------
HDFR_YERPA      ----------------------------------------------------------------------
HDFR_YERP3      ----------------------------------------------------------------------
HDFR_YERE8      ----------------------------------------------------------------------
YFER_SHIFL      ----------------------------------------------------------------------
YFER_ECOLI      ----------------------------------------------------------------------
TTUA3_AGRVI     ----DPKLKTVFLFHETAVVAMSENHRLAHNTSVTIHDLADEPLIVPERRSRPHSHDLTMKLFIEAGLQA
GLTC_BACSU      VPTNFSDITGKILFTEKIYALVPLNHPLAKQKTVHLIDLRNDQFVLFPEGFVLR--EMAIDTCKQAGFAP
YCJZ_ECOLI      ----------------------------------------------------------------------
RBCR_CYAME      ----------------------------------------------------------------------
CBL_KLEAE       ERLSDPTLAAFPWFRWHHSLLVPKDHPLTQVSPLTLEAIAR--WPLITYRQGITGRSRIDEAFNRKGLMP
RBCR_CYAPA      ----------------------------------------------------------------------
OXYR_ECOLI      LVKESEAFIEVPLFDEPMLLAIYEDHPWANRECVPMADLAGE----------------------------
OXYR_ECOL6      LVKESEAFIEVPLFDEPMLLAIYEDHPWANRECVPMADLAGE----------------------------
OXYR_ECO57      LVKESEAFIEVPLFDEPMLLAIYEDHPWANRECVPMADLAGE----------------------------
MAUR_KLEPN      -----------PLFEDDIFLAAPATERLDASRLADLRDYADRKFVSLAEGFAT--YAGFREAFHIAGFEP
BSDA_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KVVREVARFSQAVSLVAAGLGVHLTLAPYRVYPHPGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
BENM_ACIAD      TKINEVREVQLALGLVAAGEGISLVPA-------------------------------------------
YNFL_ECOLI      VITQEVGEAMTIIGLVSAGLGVSILPASFK----------------------------------------
ALSR_BACSU      NIVQEATEYQMVIGLVSAGIGM------------------------------------------------
CATR_PSEPU      ----------------------------------------------------------------------
CATM_ACIAD      SKLTEIREIQLALGLVAAGEGV------------------------------------------------
CATR_ACILW      GQVMEVREIQTALGLVAAEFGVCVIPASARQMRH------------------------------------
XAPR_ECOLI      VVIREVNEPQTVLAMVSMGIGITLIADSYAQMNWPG----------------------------------
TTUA4_AGRVI     RIAQTADEKQTIINLVAAGIG-------------------------------------------------
CYNR_ECOLI      QVVIEANSISAVLELI------------------------------------------------------
YCGK_BACSU      NAAFKTSHIETAQSLVANGLGV--TMAPNMV---------------------------------------
CYNR_ECO57      QVVIEANSISAVLELI------------------------------------------------------
OXYR_MYCMR      ELATRAASLATAVQCVNGGLGVTL----------------------------------------------
OXYR_MYCLE      ELANRAASLATAVQCVTGGLGV--TLLPQSAAP-------------------------------------
OXYR_MYCAV      ELANRAASLATAVQCVTGGLGV--TLIPQSAVP-------------------------------------
CYSL_BACSU      KSMFTISSNQGVKEAVINGMGL------------------------------------------------
HCAR_ECOLI      NIVQVATNILVTMNLVGMGLGVTL----------------------------------------------
YWBI_BACSU      HIIYETSQWDFISEMVSANLGIGL----------------------------------------------
YKUM_BACSU      ----------------------------------------------------------------------
RBCR_CHRVI      ----------------------------------------------------------------------
YIBL_AZOVI      ----------------------------------------------------------------------
TFDT_RALEJ      ----------------------------------------------------------------------
YBHD_ECOLI      ----------------------------------------------------------------------
YYBE_BACSU      NIMFEGEEATTAAGFVAAGLGISI----------------------------------------------
CLCR_PSEPU      ----------------------------------------------------------------------
SDSB_PSES9      ----------------------------------------------------------------------
ILVR_CAUCR      ----------------------------------------------------------------------
RBCR_PHATR      ----------------------------------------------------------------------
RBCR_THAPS      ----------------------------------------------------------------------
RBCR_GUITH      ----------------------------------------------------------------------
HDFR_YERPY      ----------------------------------------------------------------------
HDFR_YERPS      ----------------------------------------------------------------------
HDFR_YERPP      ----------------------------------------------------------------------
HDFR_YERPN      ----------------------------------------------------------------------
HDFR_YERPG      ----------------------------------------------------------------------
HDFR_YERPE      ----------------------------------------------------------------------
HDFR_YERPB      ----------------------------------------------------------------------
HDFR_YERPA      ----------------------------------------------------------------------
HDFR_YERP3      ----------------------------------------------------------------------
HDFR_YERE8      ----------------------------------------------------------------------
YFER_SHIFL      ----------------------------------------------------------------------
YFER_ECOLI      ----------------------------------------------------------------------
TTUA3_AGRVI     RVAQLAEEKQTIVNLVAAEIGL------------------------------------------------
GLTC_BACSU      LVSTEGEDLDAIKGLVSAGMGVTL----------------------------------------------
YCJZ_ECOLI      ----------------------------------------------------------------------
RBCR_CYAME      ----------------------------------------------------------------------
CBL_KLEAE       DIVLSAQDSDVIKTYVELGLGVGL----------------------------------------------
RBCR_CYAPA      ----------------------------------------------------------------------
OXYR_ECOLI      ----------------------------------------------------------------------
OXYR_ECOL6      ----------------------------------------------------------------------
OXYR_ECO57      ----------------------------------------------------------------------
MAUR_KLEPN      EIVTRVNDIFSMISLVQAGVGFAL----------------------------------------------
BSDA_BACSU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxx
BENM_ACIAD      -----
YNFL_ECOLI      -----
ALSR_BACSU      -----
CATR_PSEPU      -----
CATM_ACIAD      -----
CATR_ACILW      -----
XAPR_ECOLI      -----
TTUA4_AGRVI     -----
CYNR_ECOLI      -----
YCGK_BACSU      -----
CYNR_ECO57      -----
OXYR_MYCMR      -----
OXYR_MYCLE      -----
OXYR_MYCAV      -----
CYSL_BACSU      -----
HCAR_ECOLI      -----
YWBI_BACSU      -----
YKUM_BACSU      -----
RBCR_CHRVI      -----
YIBL_AZOVI      -----
TFDT_RALEJ      -----
YBHD_ECOLI      -----
YYBE_BACSU      -----
CLCR_PSEPU      -----
SDSB_PSES9      -----
ILVR_CAUCR      -----
RBCR_PHATR      -----
RBCR_THAPS      -----
RBCR_GUITH      -----
HDFR_YERPY      -----
HDFR_YERPS      -----
HDFR_YERPP      -----
HDFR_YERPN      -----
HDFR_YERPG      -----
HDFR_YERPE      -----
HDFR_YERPB      -----
HDFR_YERPA      -----
HDFR_YERP3      -----
HDFR_YERE8      -----
YFER_SHIFL      -----
YFER_ECOLI      -----
TTUA3_AGRVI     -----
GLTC_BACSU      -----
YCJZ_ECOLI      -----
RBCR_CYAME      -----
CBL_KLEAE       -----
RBCR_CYAPA      -----
OXYR_ECOLI      -----
OXYR_ECOL6      -----
OXYR_ECO57      -----
MAUR_KLEPN      -----
BSDA_BACSU      -----