[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS82156.1

[Show Plain Result]


## Summary of Sequence Search
    1::261
    1::261     e-101 100%  261 aa  UPPP_THET2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::261     1e-98  98%  261 aa  UPPP_THET8 RecName: Full=Undecaprenyl-diphosphatase;       
    1::255     2e-45  45%  256 aa  UPPP_AQUAE RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     1e-36  35%  256 aa  UPPP_WOLSU RecName: Full=Undecaprenyl-diphosphatase;       
    5::237     1e-32  39%  254 aa  UPPP_PERMH RecName: Full=Undecaprenyl-diphosphatase;       
    5::237     2e-31  41%  252 aa  UPPP_SULSY RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     2e-30  35%  267 aa  UPPP_CAMJD RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     1e-29  34%  267 aa  UPPP_CAMJR RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     1e-29  34%  267 aa  UPPP_CAMJJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     2e-29  32%  267 aa  UPPP_CAMJE RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     3e-29  34%  267 aa  UPPP_CAMJ8 RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     4e-28  40%  268 aa  UPPP_OCHA4 RecName: Full=Undecaprenyl-diphosphatase;       
    3::263     2e-27  41%  266 aa  UPPP_SPHWW RecName: Full=Undecaprenyl-diphosphatase;       
    7::252     2e-27  40%  266 aa  UPPP_PHEZH RecName: Full=Undecaprenyl-diphosphatase;       
    6::259     1e-26  35%  268 aa  UPPP_RHOPS RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     2e-26  38%  258 aa  UPPP_CAMHC RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUSU RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUSI RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUO2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUME RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUMB RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUC2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUAB RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUA2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-26  40%  268 aa  UPPP_BRUA1 RecName: Full=Undecaprenyl-diphosphatase;       
    8::254     3e-26  40%  268 aa  UPPP_MESSB RecName: Full=Undecaprenyl-diphosphatase;       
    1::252     7e-26  35%  261 aa  UPPP_NAUPA RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     9e-26  33%  258 aa  UPPP_CAMFF RecName: Full=Undecaprenyl-diphosphatase;       
    7::262     2e-25  39%  270 aa  UPPP_NOVAD RecName: Full=Undecaprenyl-diphosphatase;       
    1::243     2e-25  32%  263 aa  UPPP_BDEBA RecName: Full=Undecaprenyl-diphosphatase;       
    4::255     3e-25  33%  255 aa  UPPP_THICR RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     3e-25  33%  268 aa  UPPP_BRAJA RecName: Full=Undecaprenyl-diphosphatase;       
    5::259     4e-25  31%  268 aa  UPPP_NITWN RecName: Full=Undecaprenyl-diphosphatase;       
    5::259     6e-25  36%  268 aa  UPPP_NITHX RecName: Full=Undecaprenyl-diphosphatase;       
    5::255     4e-24  27%  255 aa  UPPP_META3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     8e-24  33%  277 aa  UPPP_POLSJ RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     8e-24  37%  274 aa  UPPP_DECAR RecName: Full=Undecaprenyl-diphosphatase;       
   43::257     1e-23  40%  266 aa  UPPP_CAUCR RecName: Full=Undecaprenyl-diphosphatase;       
   43::257     1e-23  40%  266 aa  UPPP_CAUCN RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     2e-23  29%  271 aa  UPPP_THETN RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     2e-23  37%  266 aa  UPPP3_ACIAD RecName: Full=Undecaprenyl-diphosphatase 3;       
    8::259     2e-23  33%  273 aa  UPPP_NITMU RecName: Full=Undecaprenyl-diphosphatase;       
    8::258     2e-23  37%  273 aa  UPPP_NITEC RecName: Full=Undecaprenyl-diphosphatase;       
    1::271     2e-23  28%  278 aa  UPPP_DESHD RecName: Full=Undecaprenyl-diphosphatase;       
    5::243     2e-23  32%  263 aa  UPPP_CYTH3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     4e-23  31%  263 aa  UPPP3_BACHK RecName: Full=Undecaprenyl-diphosphatase 3;       
   14::259     4e-23  45%  261 aa  UPPP2_MAGSA RecName: Full=Undecaprenyl-diphosphatase 2;       
    8::263     5e-23  31%  263 aa  UPPP2_BACC1 RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::272     7e-23  37%  272 aa  UPPP_YERPY RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPS RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPP RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPN RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPG RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPE RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPB RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERPA RecName: Full=Undecaprenyl-diphosphatase;       
    6::272     7e-23  37%  272 aa  UPPP_YERP3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     7e-23  36%  263 aa  UPPP2_BACCR RecName: Full=Undecaprenyl-diphosphatase 2;       
    9::259     9e-23  37%  274 aa  UPPP_AZOSE RecName: Full=Undecaprenyl-diphosphatase;       
   10::269     9e-23  33%  271 aa  UPPP_AERS4 RecName: Full=Undecaprenyl-diphosphatase;       
    6::274     2e-22  41%  274 aa  UPPP_SERP5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::259     2e-22  34%  276 aa  UPPP_PSEMY RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-22  32%  254 aa  UPPP3_BACCZ RecName: Full=Undecaprenyl-diphosphatase 3;       
    1::254     2e-22  32%  254 aa  UPPP3_BACAH RecName: Full=Undecaprenyl-diphosphatase 3;       
    1::254     2e-22  32%  254 aa  UPPP2_BACAN RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::264     2e-22  36%  265 aa  UPPP_DESDG RecName: Full=Undecaprenyl-diphosphatase;       
    1::272     2e-22  27%  274 aa  UPPP1_CLOAB RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::273     4e-22  35%  273 aa  UPPP_ERWT9 RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     5e-22  31%  274 aa  UPPP_VEREI RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     5e-22  33%  265 aa  UPPP_RHIE6 RecName: Full=Undecaprenyl-diphosphatase;       
    5::245     6e-22  30%  265 aa  UPPP_FLAJ1 RecName: Full=Undecaprenyl-diphosphatase;       
   10::260     8e-22  33%  276 aa  UPPP_THIDA RecName: Full=Undecaprenyl-diphosphatase;       
   44::259     8e-22  38%  268 aa  UPPP_RHOS4 RecName: Full=Undecaprenyl-diphosphatase;       
   44::259     8e-22  38%  268 aa  UPPP_RHOS1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::255     1e-21  33%  266 aa  UPPP_RHILW RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     1e-21  33%  265 aa  UPPP_RHIEC RecName: Full=Undecaprenyl-diphosphatase;       
    6::279     2e-21  35%  293 aa  UPPP_RALEJ RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     2e-21  34%  280 aa  UPPP_PORGI RecName: Full=Undecaprenyl-diphosphatase;       
    8::260     2e-21  31%  274 aa  UPPP_ACIAC RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     2e-21  36%  269 aa  UPPP_THEPX RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     2e-21  36%  269 aa  UPPP_THEP3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     2e-21  32%  277 aa  UPPP_RHOFD RecName: Full=Undecaprenyl-diphosphatase;       
   10::273     2e-21  35%  274 aa  UPPP1_CLOD6 RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::272     3e-21  37%  272 aa  UPPP_YERE8 RecName: Full=Undecaprenyl-diphosphatase;       
    6::279     3e-21  34%  293 aa  UPPP_RALEH RecName: Full=Undecaprenyl-diphosphatase;       
   10::258     3e-21  32%  271 aa  UPPP_AERHH RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     4e-21  32%  268 aa  UPPP_RHOP5 RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     4e-21  34%  280 aa  UPPP_PORG3 RecName: Full=Undecaprenyl-diphosphatase;       
    9::264     4e-21  35%  268 aa  UPPP_PARL1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::265     5e-21  31%  272 aa  UPPP_LACCB RecName: Full=Undecaprenyl-diphosphatase;       
    7::263     5e-21  33%  265 aa  UPPP_DESMR RecName: Full=Undecaprenyl-diphosphatase;       
    7::260     5e-21  42%  269 aa  UPPP_CAUSK RecName: Full=Undecaprenyl-diphosphatase;       
    1::260     7e-21  33%  274 aa  UPPP2_RHORT RecName: Full=Undecaprenyl-diphosphatase 2;       
   44::259     9e-21  44%  268 aa  UPPP_RHOS5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::259     9e-21  39%  278 aa  UPPP1_BURXL RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::265     1e-20  35%  272 aa  UPPP_LACC3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     1e-20  30%  268 aa  UPPP_BRASB RecName: Full=Undecaprenyl-diphosphatase;       
    8::254     1e-20  31%  268 aa  UPPP_RHOPT RecName: Full=Undecaprenyl-diphosphatase;       
    8::254     1e-20  31%  268 aa  UPPP_RHOPA RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     1e-20  32%  268 aa  UPPP_RHOP2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::279     1e-20  33%  293 aa  UPPP_RALME RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     2e-20  32%  265 aa  UPPP_RHIL3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     2e-20  31%  274 aa  UPPP_DEIGD RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     2e-20  30%  268 aa  UPPP_BRASO RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     3e-20  36%  268 aa  UPPP_OLICO RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     3e-20  30%  277 aa  UPPP_HERAR RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     3e-20  39%  276 aa  UPPP1_BURCH RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::259     3e-20  39%  276 aa  UPPP1_BURCA RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::272     3e-20  37%  272 aa  UPPP_PHOLL RecName: Full=Undecaprenyl-diphosphatase;       
   10::272     3e-20  38%  272 aa  UPPP_ERWCT RecName: Full=Undecaprenyl-diphosphatase;       
    3::263     3e-20  32%  264 aa  UPPP_DESAD RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     4e-20  33%  273 aa  UPPP_NEIMB RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     6e-20  33%  273 aa  UPPP_NEIG2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     6e-20  33%  273 aa  UPPP_NEIG1 RecName: Full=Undecaprenyl-diphosphatase;       
    3::256     6e-20  30%  270 aa  UPPP1_CHRVO RecName: Full=Undecaprenyl-diphosphatase 1;       
   15::264     1e-19  29%  267 aa  UPPP_ZYMMO RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     1e-19  33%  273 aa  UPPP_NEIMF RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     1e-19  33%  273 aa  UPPP_NEIMA RecName: Full=Undecaprenyl-diphosphatase;       
    8::270     1e-19  35%  281 aa  UPPP_POLNS RecName: Full=Undecaprenyl-diphosphatase;       
   10::272     1e-19  36%  272 aa  UPPP_PECCP RecName: Full=Undecaprenyl-diphosphatase;       
    1::265     1e-19  29%  277 aa  UPPP_JANMA RecName: Full=Undecaprenyl-diphosphatase;       
    7::250     2e-19  34%  265 aa  UPPP_XANC5 RecName: Full=Undecaprenyl-diphosphatase;       
    7::250     2e-19  34%  265 aa  UPPP_XANAC RecName: Full=Undecaprenyl-diphosphatase;       
    8::271     2e-19  32%  285 aa  UPPP_METPP RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     2e-19  29%  269 aa  UPPP_METFK RecName: Full=Undecaprenyl-diphosphatase;       
    7::272     2e-19  37%  273 aa  UPPP_GEOKA RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     2e-19  38%  276 aa  UPPP_BURMS RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     2e-19  38%  276 aa  UPPP_BURMA RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     2e-19  38%  276 aa  UPPP_BURM9 RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     2e-19  38%  276 aa  UPPP_BURM7 RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     2e-19  38%  276 aa  UPPP2_BURPS RecName: Full=Undecaprenyl-diphosphatase 2;       
    8::259     2e-19  38%  276 aa  UPPP2_BURP1 RecName: Full=Undecaprenyl-diphosphatase 2;       
    8::259     2e-19  38%  276 aa  UPPP2_BURP0 RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::250     4e-19  34%  265 aa  UPPP_XANOR RecName: Full=Undecaprenyl-diphosphatase;       
    7::250     4e-19  34%  265 aa  UPPP_XANOP RecName: Full=Undecaprenyl-diphosphatase;       
    7::250     4e-19  34%  265 aa  UPPP_XANOM RecName: Full=Undecaprenyl-diphosphatase;       
    7::262     4e-19  43%  265 aa  UPPP_DESVV RecName: Full=Undecaprenyl-diphosphatase;       
    7::262     4e-19  43%  265 aa  UPPP_DESVH RecName: Full=Undecaprenyl-diphosphatase;       
   88::259     4e-19  36%  268 aa  UPPP1_RHILO RecName: Full=Undecaprenyl-diphosphatase 1;       
   10::266     5e-19  38%  273 aa  UPPP_SODGM RecName: Full=Undecaprenyl-diphosphatase;       
   19::258     5e-19  30%  273 aa  UPPP_NITEU RecName: Full=Undecaprenyl-diphosphatase;       
    8::255     5e-19  32%  273 aa  UPPP_NEIM0 RecName: Full=Undecaprenyl-diphosphatase;       
    8::256     5e-19  33%  274 aa  UPPP_CELJU RecName: Full=Undecaprenyl-diphosphatase;       
    5::268     5e-19  30%  278 aa  UPPP3_FRASC RecName: Full=Undecaprenyl-diphosphatase 3;       
   13::251     6e-19  31%  254 aa  UPPP_SULNB RecName: Full=Undecaprenyl-diphosphatase;       
    1::260     8e-19  37%  278 aa  UPPP1_FRAAA RecName: Full=Undecaprenyl-diphosphatase 1;       
    9::260     1e-18  29%  266 aa  UPPP_LAWIP RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     1e-18  40%  272 aa  UPPP_ACIBT RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     1e-18  40%  272 aa  UPPP_ACIBS RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     1e-18  40%  272 aa  UPPP_ACIBC RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     1e-18  40%  272 aa  UPPP_ACIBY RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     1e-18  40%  272 aa  UPPP_ACIB5 RecName: Full=Undecaprenyl-diphosphatase;       
    8::268     1e-18  40%  272 aa  UPPP_ACIB3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     1e-18  41%  276 aa  UPPP1_BURCM RecName: Full=Undecaprenyl-diphosphatase 1;       
    7::250     2e-18  33%  263 aa  UPPP_XANCP RecName: Full=Undecaprenyl-diphosphatase;       
    7::250     2e-18  33%  263 aa  UPPP_XANC8 RecName: Full=Undecaprenyl-diphosphatase;       
    6::269     2e-18  29%  272 aa  UPPP_CLOTH RecName: Full=Undecaprenyl-diphosphatase;       
    1::270     2e-18  27%  273 aa  UPPP_CLOPH RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     2e-18  37%  261 aa  UPPP_XYLFT RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     2e-18  37%  261 aa  UPPP_XYLFA RecName: Full=Undecaprenyl-diphosphatase;       
    8::262     2e-18  29%  267 aa  UPPP2_SHEON RecName: Full=Undecaprenyl-diphosphatase 2;       
   10::266     2e-18  29%  276 aa  UPPP2_ENTFA RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     3e-18  30%  268 aa  UPPP_RHOPB RecName: Full=Undecaprenyl-diphosphatase;       
   17::286     3e-18  30%  286 aa  UPPP_ACIBL RecName: Full=Undecaprenyl-diphosphatase;       
    5::204     5e-18  38%  256 aa  UPPP_SULDN RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     5e-18  29%  268 aa  UPPP_METI4 RecName: Full=Undecaprenyl-diphosphatase;       
    8::266     5e-18  34%  274 aa  UPPP1_ACIAD RecName: Full=Undecaprenyl-diphosphatase 1;       
    9::259     7e-18  38%  273 aa  UPPP_METCA RecName: Full=Undecaprenyl-diphosphatase;       
    1::262     7e-18  34%  278 aa  UPPP1_STRCO RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::259     9e-18  39%  276 aa  UPPP1_BURS3 RecName: Full=Undecaprenyl-diphosphatase 1;       
    5::271     1e-17  29%  275 aa  UPPP_LACPL RecName: Full=Undecaprenyl-diphosphatase;       
    8::272     1e-17  32%  273 aa  UPPP_GEOTN RecName: Full=Undecaprenyl-diphosphatase;       
   12::276     2e-17  31%  284 aa  UPPP_STRTD RecName: Full=Undecaprenyl-diphosphatase;       
   16::280     2e-17  31%  288 aa  UPPP_STRT2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     2e-17  30%  277 aa  UPPP_POLNA RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     2e-17  28%  276 aa  UPPP_LACF3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::261     2e-17  30%  280 aa  UPPP_PSYA2 RecName: Full=Undecaprenyl-diphosphatase;       
    5::266     2e-17  29%  275 aa  UPPP_LACDB RecName: Full=Undecaprenyl-diphosphatase;       
    5::266     2e-17  29%  275 aa  UPPP_LACDA RecName: Full=Undecaprenyl-diphosphatase;       
   45::253     3e-17  39%  266 aa  UPPP_SPHAL RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     3e-17  30%  256 aa  UPPP2_PSEHT RecName: Full=Undecaprenyl-diphosphatase 2;       
    8::264     3e-17  37%  283 aa  UPPP_PSYWF RecName: Full=Undecaprenyl-diphosphatase;       
    7::274     4e-17  32%  276 aa  UPPP1_ENTFA RecName: Full=Undecaprenyl-diphosphatase;       
  130::254     6e-17  50%  268 aa  UPPP_SINMW RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     8e-17  27%  282 aa  UPPP_STRGC RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     8e-17  36%  273 aa  UPPP_SHISS RecName: Full=Undecaprenyl-diphosphatase;       
   16::247     8e-17  29%  261 aa  UPPP_FLAPJ RecName: Full=Undecaprenyl-diphosphatase;       
    1::24      8e-17  43%  268 aa  UPPP1_AGRT5 RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::260     1e-16  28%  274 aa  UPPP_VARPS RecName: Full=Undecaprenyl-diphosphatase;       
    8::261     1e-16  29%  280 aa  UPPP_PSYCK RecName: Full=Undecaprenyl-diphosphatase;       
    8::202     1e-16  33%  275 aa  UPPP_LACSS RecName: Full=Undecaprenyl-diphosphatase;       
   10::214     1e-16  38%  272 aa  UPPP_ENTS8 RecName: Full=Undecaprenyl-diphosphatase;       
   16::280     1e-16  30%  288 aa  UPPP_STRT1 RecName: Full=Undecaprenyl-diphosphatase;       
  130::256     2e-16  49%  268 aa  UPPP_RHISN RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  34%  273 aa  UPPP_ENT38 RecName: Full=Undecaprenyl-diphosphatase;       
    3::250     2e-16  30%  266 aa  UPPP_FUSNN RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  36%  273 aa  UPPP_ESCF3 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECOLI RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECOLC RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECOHS RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECODH RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECOBW RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECO7I RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECO5E RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     2e-16  35%  273 aa  UPPP_ECO57 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_SHIFL RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_SHIF8 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_SHIBS RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_SHIB3 RecName: Full=Undecaprenyl-diphosphatase;       
  130::254     3e-16  50%  268 aa  UPPP_RHIME RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECOUT RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECOSE RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECOLU RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECOL6 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECOL5 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECOK1 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECO8A RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECO81 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECO55 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECO45 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECO27 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     3e-16  35%  273 aa  UPPP_ECO24 RecName: Full=Undecaprenyl-diphosphatase;       
    1::268     3e-16  32%  291 aa  UPPP2_STRCO RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::266     5e-16  31%  266 aa  UPPP_SHEWM RecName: Full=Undecaprenyl-diphosphatase;       
    8::272     5e-16  33%  281 aa  UPPP_MACCJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     5e-16  28%  275 aa  UPPP_DEIDV RecName: Full=Undecaprenyl-diphosphatase;       
    8::265     5e-16  37%  276 aa  UPPP1_BURTA RecName: Full=Undecaprenyl-diphosphatase 1;       
   10::215     8e-16  40%  273 aa  UPPP_SALDC RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALTY RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALTI RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALSV RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALPK RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  36%  273 aa  UPPP_SALPC RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALPA RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALNS RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALHS RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALCH RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALAR RecName: Full=Undecaprenyl-diphosphatase;       
   10::215     1e-15  40%  273 aa  UPPP_SALA4 RecName: Full=Undecaprenyl-diphosphatase;       
    5::255     1e-15  31%  276 aa  UPPP_PSEE4 RecName: Full=Undecaprenyl-diphosphatase;       
   10::214     1e-15  40%  272 aa  UPPP_CITK8 RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     1e-15  29%  277 aa  UPPP1_STRAW RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::275     1e-15  31%  279 aa  UPPP_STRP6 RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     2e-15  31%  279 aa  UPPP_STRPM RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     2e-15  31%  279 aa  UPPP_STRP8 RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     2e-15  31%  279 aa  UPPP_STRP3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     2e-15  31%  279 aa  UPPP_STRP1 RecName: Full=Undecaprenyl-diphosphatase;       
   43::253     2e-15  34%  267 aa  UPPP_PARDP RecName: Full=Undecaprenyl-diphosphatase;       
    1::257     2e-15  34%  292 aa  UPPP_THEFY RecName: Full=Undecaprenyl-diphosphatase;       
    1::273     2e-15  29%  273 aa  UPPP_GEOSW RecName: Full=Undecaprenyl-diphosphatase;       
    8::265     2e-15  32%  278 aa  UPPP_EXIS2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::271     2e-15  29%  279 aa  UPPP_ALKOO RecName: Full=Undecaprenyl-diphosphatase;       
    4::265     3e-15  29%  266 aa  UPPP_THISH RecName: Full=Undecaprenyl-diphosphatase;       
  144::254     3e-15  38%  264 aa  UPPP_STRM5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::248     3e-15  27%  274 aa  UPPP_DEIRA RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     4e-15  28%  279 aa  UPPP_STRPF RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     4e-15  28%  279 aa  UPPP_STRPD RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     4e-15  28%  279 aa  UPPP_STRPC RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     4e-15  28%  279 aa  UPPP_STRPB RecName: Full=Undecaprenyl-diphosphatase;       
   11::274     4e-15  34%  284 aa  UPPP2_CLOD6 RecName: Full=Undecaprenyl-diphosphatase 2;       
    8::275     5e-15  28%  279 aa  UPPP_STRPZ RecName: Full=Undecaprenyl-diphosphatase;       
    8::275     5e-15  30%  279 aa  UPPP_STRPG RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     5e-15  31%  273 aa  UPPP_KLEP7 RecName: Full=Undecaprenyl-diphosphatase;       
   10::256     5e-15  31%  273 aa  UPPP_KLEP3 RecName: Full=Undecaprenyl-diphosphatase;       
  144::254     7e-15  38%  264 aa  UPPP_STRMK RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     7e-15  29%  266 aa  UPPP_ALTMD RecName: Full=Undecaprenyl-diphosphatase;       
   10::285     9e-15  37%  287 aa  UPPP_BORPD RecName: Full=Undecaprenyl-diphosphatase;       
    7::264     9e-15  31%  278 aa  UPPP2_AGRT5 RecName: Full=Undecaprenyl-diphosphatase 2;       
    8::63      1e-14  40%  274 aa  UPPP_DIAST RecName: Full=Undecaprenyl-diphosphatase;       
    8::63      2e-14  40%  274 aa  UPPP_ACISJ RecName: Full=Undecaprenyl-diphosphatase;       
    9::259     2e-14  31%  265 aa  UPPP_CHRSD RecName: Full=Undecaprenyl-diphosphatase;       
   10::281     2e-14  37%  287 aa  UPPP_BORPE RecName: Full=Undecaprenyl-diphosphatase;       
   13::259     2e-14  40%  274 aa  UPPP_AZOSB RecName: Full=Undecaprenyl-diphosphatase;       
    7::259     3e-14  27%  264 aa  UPPP_TERTT RecName: Full=Undecaprenyl-diphosphatase;       
   19::268     3e-14  28%  280 aa  UPPP_STRSV RecName: Full=Undecaprenyl-diphosphatase;       
    1::271     3e-14  30%  290 aa  UPPP_STRGG RecName: Full=Undecaprenyl-diphosphatase;       
   10::281     3e-14  37%  287 aa  UPPP_BORPA RecName: Full=Undecaprenyl-diphosphatase;       
   10::281     3e-14  37%  287 aa  UPPP_BORBR RecName: Full=Undecaprenyl-diphosphatase;       
    7::263     4e-14  32%  265 aa  UPPP_DESDA RecName: Full=Undecaprenyl-diphosphatase;       
    8::187     4e-14  35%  187 aa  UPPP_AZOBR RecName: Full=Undecaprenyl-diphosphatase;       
    5::255     5e-14  29%  276 aa  UPPP_PSEU2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-14  32%  274 aa  UPPP_NOCSJ RecName: Full=Undecaprenyl-diphosphatase;       
   13::253     5e-14  35%  271 aa  UPPP_CLOTE RecName: Full=Undecaprenyl-diphosphatase;       
   17::295     5e-14  32%  304 aa  UPPP_CLOPE RecName: Full=Undecaprenyl-diphosphatase;       
   17::295     5e-14  32%  304 aa  UPPP_CLOP1 RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     6e-14  36%  304 aa  UPPP_ANADF RecName: Full=Undecaprenyl-diphosphatase;       
    1::274     6e-14  27%  275 aa  UPPP_ALKMQ RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     8e-14  29%  277 aa  UPPP_PSE14 RecName: Full=Undecaprenyl-diphosphatase;       
    1::267     8e-14  28%  282 aa  UPPP_CHLPB RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     8e-14  30%  276 aa  UPPP1_PSEU5 RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::196     1e-13  28%  260 aa  UPPP_SYNWW RecName: Full=Undecaprenyl-diphosphatase;       
    5::255     1e-13  29%  276 aa  UPPP_PSESM RecName: Full=Undecaprenyl-diphosphatase;       
   78::249     1e-13  27%  254 aa  UPPP_DESPS RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     1e-13  28%  267 aa  UPPP_VIBHB RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     1e-13  26%  291 aa  UPPP_STAAT RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     1e-13  26%  291 aa  UPPP_STAAE RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     1e-13  26%  291 aa  UPPP_STAA8 RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     1e-13  26%  291 aa  UPPP_STAA3 RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     1e-13  30%  291 aa  UPPP2_STRAW RecName: Full=Undecaprenyl-diphosphatase 2;       
    5::255     2e-13  31%  276 aa  UPPP_PSEF5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::205     2e-13  33%  282 aa  UPPP_LEUCK RecName: Full=Undecaprenyl-diphosphatase;       
    5::257     2e-13  29%  266 aa  UPPP_HAHCH RecName: Full=Undecaprenyl-diphosphatase;       
    6::267     2e-13  38%  269 aa  UPPP_GEOMG RecName: Full=Undecaprenyl-diphosphatase;       
    1::259     2e-13  28%  266 aa  UPPP_SHEPA RecName: Full=Undecaprenyl-diphosphatase;       
    1::268     2e-13  29%  281 aa  UPPP_RHOSR RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     3e-13  26%  291 aa  UPPP_STAAW RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     3e-13  26%  291 aa  UPPP_STAAS RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     3e-13  26%  291 aa  UPPP_STAAC RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     3e-13  29%  266 aa  UPPP_SHESH RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     3e-13  31%  266 aa  UPPP_SHEB9 RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     3e-13  31%  266 aa  UPPP_SHEB8 RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     3e-13  31%  266 aa  UPPP_SHEB5 RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     3e-13  31%  266 aa  UPPP_SHEB2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     3e-13  38%  273 aa  UPPP_LARHH RecName: Full=Undecaprenyl-diphosphatase;       
    6::255     3e-13  31%  277 aa  UPPP_AZOVD RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     4e-13  29%  266 aa  UPPP_SHESW RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     4e-13  29%  266 aa  UPPP_SHEPW RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     4e-13  29%  266 aa  UPPP_SHEPC RecName: Full=Undecaprenyl-diphosphatase;       
  153::267     4e-13  35%  267 aa  UPPP_DICNV RecName: Full=Undecaprenyl-diphosphatase;       
    7::64      4e-13  39%  278 aa  UPPP1_OENOB RecName: Full=Undecaprenyl-diphosphatase 1;       
  151::264     4e-13  37%  265 aa  UPPP1_BACHK RecName: Full=Undecaprenyl-diphosphatase 1;       
  151::264     4e-13  37%  265 aa  UPPP1_BACAN RecName: Full=Undecaprenyl-diphosphatase 1;       
  151::264     4e-13  37%  265 aa  UPPP1_BACAH RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::282     5e-13  25%  291 aa  UPPP_STAAN RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     5e-13  25%  291 aa  UPPP_STAAM RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     5e-13  25%  291 aa  UPPP_STAAB RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     5e-13  25%  291 aa  UPPP_STAA9 RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     5e-13  25%  291 aa  UPPP_STAA2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::282     5e-13  25%  291 aa  UPPP_STAA1 RecName: Full=Undecaprenyl-diphosphatase;       
   10::269     5e-13  32%  286 aa  UPPP_ARTS2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::265     7e-13  34%  267 aa  UPPP_PHOPR RecName: Full=Undecaprenyl-diphosphatase;       
    9::265     7e-13  28%  276 aa  UPPP2_BACLD RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::249     9e-13  34%  261 aa  UPPP_DESAP RecName: Full=Undecaprenyl-diphosphatase;       
    5::249     9e-13  28%  259 aa  UPPP4_BACAH RecName: Full=Undecaprenyl-diphosphatase 4;       
    5::242     9e-13  29%  259 aa  UPPP3_BACCR RecName: Full=Undecaprenyl-diphosphatase 3;       
    5::259     9e-13  28%  276 aa  UPPP1_PSEPF RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::257     1e-12  30%  276 aa  UPPP_ACIC1 RecName: Full=Undecaprenyl-diphosphatase;       
    5::242     1e-12  29%  259 aa  UPPP4_BACCZ RecName: Full=Undecaprenyl-diphosphatase 4;       
    1::266     1e-12  29%  266 aa  UPPP_SHEHH RecName: Full=Undecaprenyl-diphosphatase;       
   17::239     1e-12  37%  304 aa  UPPP_CLOPS RecName: Full=Undecaprenyl-diphosphatase;       
    4::263     1e-12  28%  265 aa  UPPP_ALCBS RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     1e-12  30%  266 aa  UPPP1_SHEON RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::282     2e-12  25%  291 aa  UPPP_STAAU RecName: Full=Undecaprenyl-diphosphatase;       
    1::216     2e-12  38%  282 aa  UPPP_PROA2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::272     2e-12  28%  272 aa  UPPP_COLP3 RecName: Full=Undecaprenyl-diphosphatase;       
    1::193     2e-12  31%  261 aa  UPPP_CARHZ RecName: Full=Undecaprenyl-diphosphatase;       
    1::263     3e-12  28%  267 aa  UPPP_VIBPA RecName: Full=Undecaprenyl-diphosphatase;       
   13::279     3e-12  30%  293 aa  UPPP_RALSO RecName: Full=Undecaprenyl-diphosphatase;       
    1::264     3e-12  27%  267 aa  UPPP_PSYIN RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     3e-12  38%  272 aa  UPPP_CLAM3 RecName: Full=Undecaprenyl-diphosphatase;       
  129::255     3e-12  39%  277 aa  UPPP_PSEA7 RecName: Full=Undecaprenyl-diphosphatase;       
    4::266     3e-12  33%  270 aa  UPPP_GEOSF RecName: Full=Undecaprenyl-diphosphatase;       
    8::274     4e-12  30%  279 aa  UPPP_STRA5 RecName: Full=Undecaprenyl-diphosphatase;       
    8::274     4e-12  30%  279 aa  UPPP_STRA3 RecName: Full=Undecaprenyl-diphosphatase;       
    8::274     4e-12  30%  279 aa  UPPP_STRA1 RecName: Full=Undecaprenyl-diphosphatase;       
    5::263     4e-12  27%  266 aa  UPPP_SHEAM RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     4e-12  28%  265 aa  UPPP_SACD2 RecName: Full=Undecaprenyl-diphosphatase;       
   89::255     4e-12  38%  277 aa  UPPP_PSEAB RecName: Full=Undecaprenyl-diphosphatase;       
  146::266     4e-12  33%  284 aa  UPPP_PROAC RecName: Full=Undecaprenyl-diphosphatase;       
   14::274     4e-12  29%  281 aa  UPPP_LEUMM RecName: Full=Undecaprenyl-diphosphatase;       
  150::276     4e-12  31%  284 aa  UPPP_LACLS RecName: Full=Undecaprenyl-diphosphatase;       
   30::285     4e-12  35%  294 aa  UPPP_BLOPB RecName: Full=Undecaprenyl-diphosphatase;       
    1::210     4e-12  34%  276 aa  UPPP_BACA2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::261     4e-12  29%  265 aa  UPPP_ANATD RecName: Full=Undecaprenyl-diphosphatase;       
    5::242     4e-12  29%  259 aa  UPPP4_BACHK RecName: Full=Undecaprenyl-diphosphatase 4;       
    8::66      6e-12  34%  281 aa  UPPP_STRZT RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRZP RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRZJ RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRR6 RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRPS RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRPN RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRPJ RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRPI RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRP7 RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRP4 RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      6e-12  34%  281 aa  UPPP_STRP2 RecName: Full=Undecaprenyl-diphosphatase;       
    8::206     6e-12  35%  281 aa  UPPP_STRMU RecName: Full=Undecaprenyl-diphosphatase;       
    5::260     6e-12  31%  277 aa  UPPP_ARTAT RecName: Full=Undecaprenyl-diphosphatase;       
    1::205     6e-12  28%  276 aa  UPPP2_BURS3 RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::205     6e-12  28%  276 aa  UPPP2_BURCH RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::205     6e-12  28%  276 aa  UPPP2_BURCA RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::266     7e-12  29%  266 aa  UPPP_SHESR RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     7e-12  29%  266 aa  UPPP_SHESA RecName: Full=Undecaprenyl-diphosphatase;       
    6::62      7e-12  35%  284 aa  UPPP_LACLA RecName: Full=Undecaprenyl-diphosphatase;       
    4::260     7e-12  30%  277 aa  UPPP_ARTCA RecName: Full=Undecaprenyl-diphosphatase;       
   12::266     7e-12  31%  281 aa  UPPP1_CORJK RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::266     1e-11  29%  266 aa  UPPP_SHESM RecName: Full=Undecaprenyl-diphosphatase;       
    1::259     1e-11  28%  266 aa  UPPP_SHEDO RecName: Full=Undecaprenyl-diphosphatase;       
   89::255     1e-11  37%  277 aa  UPPP_PSEA8 RecName: Full=Undecaprenyl-diphosphatase;       
    1::220     1e-11  30%  282 aa  UPPP_CHLTE RecName: Full=Undecaprenyl-diphosphatase;       
    1::216     1e-11  38%  282 aa  UPPP_CHLP8 RecName: Full=Undecaprenyl-diphosphatase;       
   10::65      1e-11  45%  282 aa  UPPP_BORA1 RecName: Full=Undecaprenyl-diphosphatase;       
    1::205     1e-11  28%  276 aa  UPPP2_BURCM RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::64      1e-11  39%  278 aa  UPPP_STRSY RecName: Full=Undecaprenyl-diphosphatase;       
    7::64      1e-11  39%  278 aa  UPPP_STRS2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::216     1e-11  40%  282 aa  UPPP_PELPB RecName: Full=Undecaprenyl-diphosphatase;       
    1::210     1e-11  28%  276 aa  UPPP_BACSU RecName: Full=Undecaprenyl-diphosphatase;       
    5::242     1e-11  28%  259 aa  UPPP3_BACC1 RecName: Full=Undecaprenyl-diphosphatase 3;       
    1::266     2e-11  28%  267 aa  UPPP_VIBVY RecName: Full=Undecaprenyl-diphosphatase;       
    1::266     2e-11  28%  267 aa  UPPP_VIBVU RecName: Full=Undecaprenyl-diphosphatase;       
  105::281     2e-11  26%  290 aa  UPPP_STAES RecName: Full=Undecaprenyl-diphosphatase;       
  105::281     2e-11  26%  290 aa  UPPP_STAEQ RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     2e-11  28%  280 aa  UPPP_RENSM RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     2e-11  33%  273 aa  UPPP_PELPD RecName: Full=Undecaprenyl-diphosphatase;       
    5::260     2e-11  34%  277 aa  UPPP_MICLC RecName: Full=Undecaprenyl-diphosphatase;       
    1::214     2e-11  30%  282 aa  UPPP_CHLPD RecName: Full=Undecaprenyl-diphosphatase;       
   12::259     2e-11  29%  277 aa  UPPP_SYNJB RecName: Full=Undecaprenyl-diphosphatase;       
    5::272     2e-11  27%  275 aa  UPPP_SOLUE RecName: Full=Undecaprenyl-diphosphatase;       
  150::276     2e-11  31%  284 aa  UPPP_LACLM RecName: Full=Undecaprenyl-diphosphatase;       
    9::271     2e-11  32%  281 aa  UPPP_CLOCE RecName: Full=Undecaprenyl-diphosphatase;       
    1::216     2e-11  32%  283 aa  UPPP_CHLL2 RecName: Full=Undecaprenyl-diphosphatase;       
    1::255     2e-11  27%  277 aa  UPPP2_PSEPF RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::267     3e-11  25%  267 aa  UPPP_VIBSL RecName: Full=Undecaprenyl-diphosphatase;       
   11::207     3e-11  36%  276 aa  UPPP_SYNJA RecName: Full=Undecaprenyl-diphosphatase;       
  152::263     3e-11  37%  266 aa  UPPP_PSEA6 RecName: Full=Undecaprenyl-diphosphatase;       
   16::268     3e-11  30%  281 aa  UPPP_CORST RecName: Full=Undecaprenyl-diphosphatase;       
   24::276     3e-11  30%  293 aa  UPPP_COREF RecName: Full=Undecaprenyl-diphosphatase;       
  122::256     4e-11  30%  257 aa  UPPP_THEYD RecName: Full=Undecaprenyl-diphosphatase;       
  106::282     4e-11  24%  291 aa  UPPP_STAAR RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     4e-11  31%  277 aa  UPPP_PSEPK RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     4e-11  31%  276 aa  UPPP_PSEP1 RecName: Full=Undecaprenyl-diphosphatase;       
   89::255     4e-11  37%  277 aa  UPPP_PSEAE RecName: Full=Undecaprenyl-diphosphatase;       
    7::268     4e-11  31%  280 aa  UPPP_LEPBL RecName: Full=Undecaprenyl-diphosphatase;       
    7::268     4e-11  31%  280 aa  UPPP_LEPBJ RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     4e-11  34%  267 aa  UPPP_GEMAT RecName: Full=Undecaprenyl-diphosphatase;       
   54::268     4e-11  29%  286 aa  UPPP_CLONN RecName: Full=Undecaprenyl-diphosphatase;       
    4::273     4e-11  35%  297 aa  UPPP3_FRAAA RecName: Full=Undecaprenyl-diphosphatase 3;       
    1::253     5e-11  27%  267 aa  UPPP_VIBCM RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     5e-11  27%  267 aa  UPPP_VIBCH RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     5e-11  27%  267 aa  UPPP_VIBC3 RecName: Full=Undecaprenyl-diphosphatase;       
   20::288     5e-11  27%  293 aa  UPPP_PROM3 RecName: Full=Undecaprenyl-diphosphatase;       
    5::260     5e-11  37%  261 aa  UPPP_MOOTA RecName: Full=Undecaprenyl-diphosphatase;       
    4::190     5e-11  26%  259 aa  UPPP_HALOH RecName: Full=Undecaprenyl-diphosphatase;       
    5::207     5e-11  35%  273 aa  UPPP_DESOH RecName: Full=Undecaprenyl-diphosphatase;       
   13::287     6e-11  25%  296 aa  UPPP_STACT RecName: Full=Undecaprenyl-diphosphatase;       
    7::264     6e-11  27%  282 aa  UPPP_MYCTU RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     6e-11  27%  276 aa  UPPP_MYCTA RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     6e-11  27%  276 aa  UPPP_MYCBT RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     6e-11  27%  276 aa  UPPP_MYCBP RecName: Full=Undecaprenyl-diphosphatase;       
    1::258     6e-11  27%  276 aa  UPPP_MYCBO RecName: Full=Undecaprenyl-diphosphatase;       
    5::254     8e-11  28%  276 aa  UPPP_PSEPG RecName: Full=Undecaprenyl-diphosphatase;       
    7::64      8e-11  35%  277 aa  UPPP_LEPIN RecName: Full=Undecaprenyl-diphosphatase;       
    7::64      8e-11  35%  277 aa  UPPP_LEPIC RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     8e-11  30%  266 aa  UPPP_BACV8 RecName: Full=Undecaprenyl-diphosphatase;       
  163::263     8e-11  34%  292 aa  UPPP2_FRASC RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::256     1e-10  35%  273 aa  UPPP_SACEN RecName: Full=Undecaprenyl-diphosphatase;       
    1::264     1e-10  31%  282 aa  UPPP_PROVI RecName: Full=Undecaprenyl-diphosphatase;       
    1::248     1e-10  30%  276 aa  UPPP_MYCUA RecName: Full=Undecaprenyl-diphosphatase;       
   24::276     1e-10  27%  293 aa  UPPP_CORGL RecName: Full=Undecaprenyl-diphosphatase;       
   24::276     1e-10  27%  293 aa  UPPP_CORGB RecName: Full=Undecaprenyl-diphosphatase;       
    7::254     1e-10  30%  282 aa  UPPP_MYCMM RecName: Full=Undecaprenyl-diphosphatase;       
    1::205     1e-10  28%  276 aa  UPPP1_BURPS RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::205     1e-10  28%  276 aa  UPPP1_BURP1 RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::205     1e-10  28%  276 aa  UPPP1_BURP0 RecName: Full=Undecaprenyl-diphosphatase 1;       
   12::268     2e-10  29%  286 aa  UPPP_SYNR3 RecName: Full=Undecaprenyl-diphosphatase;       
    2::198     2e-10  26%  249 aa  UPPP_METVS RecName: Full=Undecaprenyl-diphosphatase;       
    1::202     2e-10  26%  266 aa  UPPP_PARD8 RecName: Full=Undecaprenyl-diphosphatase;       
  113::259     2e-10  31%  265 aa  UPPP_MARAV RecName: Full=Undecaprenyl-diphosphatase;       
    4::254     3e-10  25%  267 aa  UPPP_VIBFM RecName: Full=Undecaprenyl-diphosphatase;       
  200::279     3e-10  36%  293 aa  UPPP_RALPJ RecName: Full=Undecaprenyl-diphosphatase;       
  132::258     3e-10  35%  276 aa  UPPP_MYCVP RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     3e-10  29%  264 aa  UPPP_GRAFK RecName: Full=Undecaprenyl-diphosphatase;       
    9::275     3e-10  28%  290 aa  UPPP2_CORJK RecName: Full=Undecaprenyl-diphosphatase 2;       
  152::277     4e-10  28%  281 aa  UPPP_SYNFM RecName: Full=Undecaprenyl-diphosphatase;       
    4::60      4e-10  40%  307 aa  UPPP_SORC5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::204     4e-10  33%  272 aa  UPPP_RUBXD RecName: Full=Undecaprenyl-diphosphatase;       
    1::203     4e-10  34%  257 aa  UPPP_PARUW RecName: Full=Undecaprenyl-diphosphatase;       
    5::267     4e-10  29%  270 aa  UPPP2_PSEU5 RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::256     4e-10  26%  266 aa  UPPP1_PSEHT RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::270     5e-10  33%  294 aa  UPPP_BIFAA RecName: Full=Undecaprenyl-diphosphatase;       
   10::63      5e-10  40%  275 aa  UPPP_BAUCH RecName: Full=Undecaprenyl-diphosphatase;       
    8::272     5e-10  33%  273 aa  UPPP_ANOFW RecName: Full=Undecaprenyl-diphosphatase;       
  151::252     5e-10  36%  265 aa  UPPP1_BACCZ RecName: Full=Undecaprenyl-diphosphatase 1;       
    8::65      9e-10  40%  279 aa  UPPP_STRS7 RecName: Full=Undecaprenyl-diphosphatase;       
    8::65      9e-10  40%  279 aa  UPPP_STREM RecName: Full=Undecaprenyl-diphosphatase;       
    8::65      9e-10  40%  279 aa  UPPP_STRE4 RecName: Full=Undecaprenyl-diphosphatase;       
    8::223     9e-10  28%  291 aa  UPPP_STAHJ RecName: Full=Undecaprenyl-diphosphatase;       
    5::255     9e-10  25%  276 aa  UPPP_PSEPW RecName: Full=Undecaprenyl-diphosphatase;       
  153::264     9e-10  28%  266 aa  UPPP_PROMP RecName: Full=Undecaprenyl-diphosphatase;       
  129::294     9e-10  31%  313 aa  UPPP_NOCFA RecName: Full=Undecaprenyl-diphosphatase;       
    2::197     9e-10  26%  249 aa  UPPP_METMP RecName: Full=Undecaprenyl-diphosphatase;       
    7::205     9e-10  27%  276 aa  UPPP2_BURXL RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::205     9e-10  26%  276 aa  UPPP2_BURTA RecName: Full=Undecaprenyl-diphosphatase 2;       
   13::204     1e-09  36%  276 aa  UPPP_SYMTH RecName: Full=Undecaprenyl-diphosphatase;       
    2::190     1e-09  26%  249 aa  UPPP_METM7 RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     2e-09  30%  266 aa  UPPP_SHELP RecName: Full=Undecaprenyl-diphosphatase;       
    2::199     2e-09  26%  249 aa  UPPP_METM6 RecName: Full=Undecaprenyl-diphosphatase;       
    4::190     2e-09  26%  266 aa  UPPP_BACFN RecName: Full=Undecaprenyl-diphosphatase;       
    4::254     2e-09  25%  267 aa  UPPP_VIBF1 RecName: Full=Undecaprenyl-diphosphatase;       
    7::254     2e-09  27%  282 aa  UPPP_MYCLE RecName: Full=Undecaprenyl-diphosphatase;       
    7::254     2e-09  27%  282 aa  UPPP_MYCLB RecName: Full=Undecaprenyl-diphosphatase;       
  132::257     2e-09  36%  276 aa  UPPP_MYCGI RecName: Full=Undecaprenyl-diphosphatase;       
  171::278     2e-09  44%  279 aa  UPPP_LEPBP RecName: Full=Undecaprenyl-diphosphatase;       
  171::278     2e-09  44%  279 aa  UPPP_LEPBA RecName: Full=Undecaprenyl-diphosphatase;       
    5::267     2e-09  34%  283 aa  UPPP_CHLT3 RecName: Full=Undecaprenyl-diphosphatase;       
   19::75      3e-09  36%  297 aa  UPPP_SYNP6 RecName: Full=Undecaprenyl-diphosphatase;       
   10::66      3e-09  36%  288 aa  UPPP_SYNE7 RecName: Full=Undecaprenyl-diphosphatase;       
    7::252     3e-09  23%  264 aa  UPPP_CAMC1 RecName: Full=Undecaprenyl-diphosphatase;       
    4::190     3e-09  26%  266 aa  UPPP_BACFR RecName: Full=Undecaprenyl-diphosphatase;       
    2::197     3e-09  25%  249 aa  UPPP_METM5 RecName: Full=Undecaprenyl-diphosphatase;       
    1::249     4e-09  26%  266 aa  UPPP_SHEFN RecName: Full=Undecaprenyl-diphosphatase;       
   10::283     4e-09  30%  285 aa  UPPP_GLUDA RecName: Full=Undecaprenyl-diphosphatase;       
    4::261     4e-09  31%  290 aa  UPPP_GLOVI RecName: Full=Undecaprenyl-diphosphatase;       
    5::215     6e-09  30%  276 aa  UPPP_MYCS2 RecName: Full=Undecaprenyl-diphosphatase;       
    4::253     6e-09  25%  267 aa  UPPP_ALISL RecName: Full=Undecaprenyl-diphosphatase;       
  153::269     8e-09  37%  269 aa  UPPP_GEOSL RecName: Full=Undecaprenyl-diphosphatase;       
  168::265     8e-09  33%  282 aa  UPPP_CORDI RecName: Full=Undecaprenyl-diphosphatase;       
    6::189     1e-08  28%  248 aa  UPPP_FERNB RecName: Full=Undecaprenyl-diphosphatase;       
    4::267     1e-08  33%  294 aa  UPPP_BIFLI RecName: Full=Undecaprenyl-diphosphatase;       
   55::296     1e-08  37%  307 aa  UPPP2_CLOAB RecName: Full=Undecaprenyl-diphosphatase 2;       
  154::261     2e-08  30%  266 aa  UPPP_PROM0 RecName: Full=Undecaprenyl-diphosphatase;       
    1::214     2e-08  45%  292 aa  UPPP_ANAD2 RecName: Full=Undecaprenyl-diphosphatase;       
  182::290     3e-08  33%  305 aa  UPPP_MYCPA RecName: Full=Undecaprenyl-diphosphatase;       
  182::290     3e-08  33%  305 aa  UPPP_MYCA1 RecName: Full=Undecaprenyl-diphosphatase;       
  144::264     3e-08  31%  270 aa  UPPP_MAGSM RecName: Full=Undecaprenyl-diphosphatase;       
  132::215     4e-08  41%  276 aa  UPPP_MYCSS RecName: Full=Undecaprenyl-diphosphatase;       
  132::215     4e-08  41%  276 aa  UPPP_MYCSK RecName: Full=Undecaprenyl-diphosphatase;       
  132::215     4e-08  41%  276 aa  UPPP_MYCSJ RecName: Full=Undecaprenyl-diphosphatase;       
    7::252     4e-08  33%  281 aa  UPPP_KINRD RecName: Full=Undecaprenyl-diphosphatase;       
    5::190     4e-08  25%  264 aa  UPPP_BACTN RecName: Full=Undecaprenyl-diphosphatase;       
  139::269     4e-08  34%  278 aa  UPPP2_BACHD RecName: Full=Undecaprenyl-diphosphatase 2;       
   12::204     4e-08  40%  285 aa  UPPP2_ACIAD RecName: Full=Undecaprenyl-diphosphatase 2;       
  178::270     5e-08  31%  286 aa  UPPP_SYNPW RecName: Full=Undecaprenyl-diphosphatase;       
    1::246     5e-08  29%  264 aa  UPPP_PELTS RecName: Full=Undecaprenyl-diphosphatase;       
    5::216     5e-08  26%  280 aa  UPPP_GLUOX RecName: Full=Undecaprenyl-diphosphatase;       
  129::250     5e-08  32%  258 aa  UPPP_ELUMP RecName: Full=Undecaprenyl-diphosphatase;       
  152::262     5e-08  34%  276 aa  UPPP_DESAA RecName: Full=Undecaprenyl-diphosphatase;       
    1::214     5e-08  38%  292 aa  UPPP_ANADE RecName: Full=Undecaprenyl-diphosphatase;       
  141::263     6e-08  29%  264 aa  UPPP_VESOH RecName: Full=Undecaprenyl-diphosphatase;       
  153::256     6e-08  30%  266 aa  UPPP_PROM5 RecName: Full=Undecaprenyl-diphosphatase;       
    7::261     6e-08  24%  266 aa  UPPP_PROM2 RecName: Full=Undecaprenyl-diphosphatase;       
   20::204     6e-08  29%  265 aa  UPPP_BUCAT RecName: Full=Undecaprenyl-diphosphatase;       
   20::204     6e-08  29%  265 aa  UPPP_BUCAI RecName: Full=Undecaprenyl-diphosphatase;       
   20::204     6e-08  29%  265 aa  UPPP_BUCA5 RecName: Full=Undecaprenyl-diphosphatase;       
  169::267     6e-08  31%  294 aa  UPPP_BIFLO RecName: Full=Undecaprenyl-diphosphatase;       
  169::267     6e-08  31%  294 aa  UPPP_BIFLD RecName: Full=Undecaprenyl-diphosphatase;       
   10::67      8e-08  34%  283 aa  UPPP_SYNS3 RecName: Full=Undecaprenyl-diphosphatase;       
  102::210     8e-08  29%  276 aa  UPPP_METST RecName: Full=Undecaprenyl-diphosphatase;       
    1::215     8e-08  29%  287 aa  UPPP_HALHL RecName: Full=Undecaprenyl-diphosphatase;       
    1::214     8e-08  37%  292 aa  UPPP_ANASK RecName: Full=Undecaprenyl-diphosphatase;       
  103::222     1e-07  27%  291 aa  UPPP_STAS1 RecName: Full=Undecaprenyl-diphosphatase;       
    4::202     1e-07  37%  270 aa  UPPP_SALRD RecName: Full=Undecaprenyl-diphosphatase;       
  162::269     1e-07  30%  274 aa  UPPP_PROMS RecName: Full=Undecaprenyl-diphosphatase;       
  174::285     1e-07  34%  285 aa  UPPP_ERYLH RecName: Full=Undecaprenyl-diphosphatase;       
    4::209     1e-07  30%  276 aa  UPPP_DESAH RecName: Full=Undecaprenyl-diphosphatase;       
  161::263     1e-07  43%  295 aa  UPPP_BIFA0 RecName: Full=Undecaprenyl-diphosphatase;       
   99::260     1e-07  30%  277 aa  UPPP_METS3 RecName: Full=Undecaprenyl-diphosphatase;       
    1::206     1e-07  27%  269 aa  UPPP_METKA RecName: Full=Undecaprenyl-diphosphatase;       
   90::212     1e-07  29%  264 aa  UPPP_BUCAP RecName: Full=Undecaprenyl-diphosphatase;       
  148::215     1e-07  47%  290 aa  UPPP_ALHEH RecName: Full=Undecaprenyl-diphosphatase;       
    8::66      2e-07  33%  283 aa  UPPP_SYNS9 RecName: Full=Undecaprenyl-diphosphatase;       
   26::83      2e-07  36%  299 aa  UPPP_PROMM RecName: Full=Undecaprenyl-diphosphatase;       
  161::269     2e-07  31%  285 aa  UPPP_HYPNA RecName: Full=Undecaprenyl-diphosphatase;       
    4::189     2e-07  26%  248 aa  UPPP_THEAB RecName: Full=Undecaprenyl-diphosphatase;       
   40::115     2e-07  35%  343 aa  UPPP_SYNAS RecName: Full=Undecaprenyl-diphosphatase;       
  152::216     2e-07  43%  265 aa  UPPP_IDILO RecName: Full=Undecaprenyl-diphosphatase;       
  151::200     2e-07  50%  266 aa  UPPP_BORGA RecName: Full=Undecaprenyl-diphosphatase;       
  152::212     3e-07  43%  262 aa  UPPP_KOSOT RecName: Full=Undecaprenyl-diphosphatase;       
    1::68      3e-07  45%  275 aa  UPPP2_BACSK RecName: Full=Undecaprenyl-diphosphatase 2;       
  139::213     4e-07  39%  269 aa  UPPP_TREDE RecName: Full=Undecaprenyl-diphosphatase;       
  141::256     4e-07  32%  268 aa  UPPP_MARMM RecName: Full=Undecaprenyl-diphosphatase;       
    1::269     5e-07  30%  278 aa  UPPP_THERP RecName: Full=Undecaprenyl-diphosphatase;       
  140::200     5e-07  44%  266 aa  UPPP_BORBZ RecName: Full=Undecaprenyl-diphosphatase;       
  140::200     5e-07  44%  266 aa  UPPP_BORBU RecName: Full=Undecaprenyl-diphosphatase;       
  151::200     5e-07  48%  264 aa  UPPP_BORAP RecName: Full=Undecaprenyl-diphosphatase;       
    3::188     7e-07  26%  250 aa  UPPP_THEM4 RecName: Full=Undecaprenyl-diphosphatase;       
   13::70      9e-07  32%  287 aa  UPPP_SYNPX RecName: Full=Undecaprenyl-diphosphatase;       
  176::280     9e-07  44%  295 aa  UPPP_GRABC RecName: Full=Undecaprenyl-diphosphatase;       
  144::202     9e-07  44%  267 aa  UPPP_DINSH RecName: Full=Undecaprenyl-diphosphatase;       
    7::252     9e-07  27%  264 aa  UPPP_CAMC5 RecName: Full=Undecaprenyl-diphosphatase;       
   51::254     1e-06  28%  326 aa  UPPP_SYNY3 RecName: Full=Undecaprenyl-diphosphatase;       
  156::263     1e-06  27%  268 aa  UPPP_PROM9 RecName: Full=Undecaprenyl-diphosphatase;       
   47::246     1e-06  31%  320 aa  UPPP_ANASP RecName: Full=Undecaprenyl-diphosphatase;       
  137::253     2e-06  27%  265 aa  UPPP_NITOC RecName: Full=Undecaprenyl-diphosphatase;       
  142::250     2e-06  32%  262 aa  UPPP_KORCO RecName: Full=Undecaprenyl-diphosphatase;       
    5::200     2e-06  28%  267 aa  UPPP_SILST RecName: Full=Undecaprenyl-diphosphatase;       
  146::198     2e-06  46%  263 aa  UPPP_PELCD RecName: Full=Undecaprenyl-diphosphatase;       
    6::208     2e-06  27%  282 aa  UPPP_ACICJ RecName: Full=Undecaprenyl-diphosphatase;       
   34::238     3e-06  37%  312 aa  UPPP_TRIEI RecName: Full=Undecaprenyl-diphosphatase;       
    3::181     3e-06  46%  237 aa  UPPP_THEMA RecName: Full=Undecaprenyl-diphosphatase;       
    3::181     4e-06  46%  237 aa  UPPP_THESQ RecName: Full=Undecaprenyl-diphosphatase;       
    3::181     4e-06  46%  237 aa  UPPP_THEP1 RecName: Full=Undecaprenyl-diphosphatase;       
    1::202     4e-06  29%  277 aa  UPPP1_BACSK RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::58      5e-06  34%  279 aa  UPPP_TROW8 RecName: Full=Undecaprenyl-diphosphatase;       
    4::58      6e-06  33%  279 aa  UPPP_TROWT RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     6e-06  35%  272 aa  UPPP_GEOLS RecName: Full=Undecaprenyl-diphosphatase;       
  144::206     6e-06  40%  268 aa  UPPP_BUCBP RecName: Full=Undecaprenyl-diphosphatase;       
  212::335     6e-06  33%  343 aa  UPPP2_FRAAA RecName: Full=Undecaprenyl-diphosphatase 2;       
    1::200     1e-05  25%  267 aa  UPPP_ROSDO RecName: Full=Undecaprenyl-diphosphatase;       
    8::188     1e-05  30%  257 aa  UPPP_RHOBA RecName: Full=Undecaprenyl-diphosphatase;       
  140::190     1e-05  43%  256 aa  UPPP_PELUB RecName: Full=Undecaprenyl-diphosphatase;       
  175::220     1e-05  46%  289 aa  UPPP_PROMA RecName: Full=Undecaprenyl-diphosphatase;       
   68::115     1e-05  48%  181 aa  UPPP_METTH RecName: Full=Undecaprenyl-diphosphatase;       
  142::252     1e-05  43%  267 aa  UPPP1_MAGSA RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::199     2e-05  26%  267 aa  UPPP_JANSC RecName: Full=Undecaprenyl-diphosphatase;       
  139::247     2e-05  28%  264 aa  UPPP2_RHILO RecName: Full=Undecaprenyl-diphosphatase 2;       
  146::205     2e-05  43%  276 aa  UPPP2_CHRVO RecName: Full=Undecaprenyl-diphosphatase 2;       
  147::216     3e-05  36%  278 aa  UPPP_SULIM RecName: Full=Undecaprenyl-diphosphatase;       
  147::216     3e-05  36%  278 aa  UPPP_SULIK RecName: Full=Undecaprenyl-diphosphatase;       
    1::200     3e-05  26%  267 aa  UPPP_SILPO RecName: Full=Undecaprenyl-diphosphatase;       
  154::212     4e-05  43%  266 aa  UPPP_BORRA RecName: Full=Undecaprenyl-diphosphatase;       
  154::212     4e-05  43%  266 aa  UPPP_BORDL RecName: Full=Undecaprenyl-diphosphatase;       
  132::200     7e-05  36%  264 aa  UPPP_BORHD RecName: Full=Undecaprenyl-diphosphatase;       
  167::211     9e-05  44%  279 aa  UPPP_PROMT RecName: Full=Undecaprenyl-diphosphatase;       
  167::211     9e-05  44%  279 aa  UPPP_PROM1 RecName: Full=Undecaprenyl-diphosphatase;       
  147::216     1e-04  34%  278 aa  UPPP_SULSO RecName: Full=Undecaprenyl-diphosphatase;       
   96::199     1e-04  31%  270 aa  UPPP1_BACLD RecName: Full=Undecaprenyl-diphosphatase 1;       
  154::258     1e-04  33%  266 aa  UPPP_ACAM1 RecName: Full=Undecaprenyl-diphosphatase;       
  130::200     2e-04  27%  256 aa  UPPP_METTP RecName: Full=Undecaprenyl-diphosphatase;       
  158::200     2e-04  44%  270 aa  UPPP_HALMA RecName: Full=Undecaprenyl-diphosphatase;       
    1::59      2e-04  37%  282 aa  UPPP_CHLCH RecName: Full=Undecaprenyl-diphosphatase;       
  154::208     2e-04  40%  271 aa  UPPP2_OENOB RecName: Full=Undecaprenyl-diphosphatase 2;       
   97::199     3e-04  30%  270 aa  UPPP3_BACAN RecName: Full=Undecaprenyl-diphosphatase 3;       
   13::70      3e-04  33%  287 aa  UPPP_SYNSC RecName: Full=Undecaprenyl-diphosphatase;       
  209::246     3e-04  45%  320 aa  UPPP_ANAVT RecName: Full=Undecaprenyl-diphosphatase;       
  155::199     3e-04  50%  270 aa  UPPP2_BACHK RecName: Full=Undecaprenyl-diphosphatase 2;       
  155::199     3e-04  50%  270 aa  UPPP2_BACCZ RecName: Full=Undecaprenyl-diphosphatase 2;       
  155::199     3e-04  50%  270 aa  UPPP2_BACAH RecName: Full=Undecaprenyl-diphosphatase 2;       
  155::199     3e-04  50%  270 aa  UPPP1_BACCR RecName: Full=Undecaprenyl-diphosphatase 1;       
  155::199     3e-04  50%  270 aa  UPPP1_BACC1 RecName: Full=Undecaprenyl-diphosphatase 1;       
  160::275     4e-04  29%  275 aa  UPPP_OCEIH RecName: Full=Undecaprenyl-diphosphatase;       
  166::202     4e-04  49%  274 aa  UPPP1_BACHD RecName: Full=Undecaprenyl-diphosphatase 1;       
  190::216     6e-04  56%  282 aa  UPPP_PELLD RecName: Full=Undecaprenyl-diphosphatase;       
  256::300     7e-04  47%  371 aa  UPPP1_FRASC RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::261

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGRVSAWEALLLGVVEGLTEFLPVXXXXXXXXXXXXXXXPVEEDPFLKTFLVAIQLGAILAVLLLYGXXX
UPPP_THET2      MGRVSAWEALLLGVVEGLTEFLPVXXXXXXXXXXXXXXXPVEEDPFLKTFLVAIQLGAILAVLLLYGXXX
UPPP_THET8      MGRVSAWEALLLGVVEGLTEFLPVXXXXXXXXXXXXXXXPVEEDPFLKTFLVAIQLGAILAVLLLYGXXX
UPPP_AQUAE      ---MTEWQAVVLGIVEGISEFLPISSTGHLILTAHILG--IKHTDFVKSFEISIQLGSILAVVVLYFNRL
UPPP_WOLSU      ------FHAIILGIVEGLTEFLPVSSTGHLILVSELLG--IKQDDFHKTFEISIQLGSILAVLALFRERL
UPPP_PERMH      -------ESIILGIVEGLTEFLPVSSTGHLILVSKLLG--LEQTDAHKAFEVAIQSGAILAVVFLYREKL
UPPP_SULSY      -------EAVILGIVEGLTEFLPISSTGHLILVSNLLG--IQQTEQHKAFEVSIQLGSILAVVFLY-FKK
UPPP_CAMJD      --------ALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDE--FWKSFLIIIQLGSILAVIFVFWRKL
UPPP_CAMJR      --------ALILGIIEGLTEFLPISSTGHMILGTTILGIDIDE--FWKSFLIIIQLGSILAVIFVFWRKL
UPPP_CAMJJ      --------ALILGIIEGLTEFLPISSTGHMILGTTILGIDIDE--FWKSFLIIIQLGSILAVIFVFWRKL
UPPP_CAMJE      --------ALILGIIEGLTEFLPISSTGHMILGTTILGIDIDE--FWKSFLIIIQLGSILAVIFVFWRKL
UPPP_CAMJ8      --------ALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDE--FWKSFLIIIQLGSILAVIFVFWRKL
UPPP_OCHA4      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILTVYSAKL
UPPP_SPHWW      ---MSLLSIVLLGIVEGVTEFLPVSSTGHLILAGEVMKVPQGTE----TFDIVIQLGAILAVVVLYGRRD
UPPP_PHEZH      --------AIILGVVEGLTEFIPVSSTGHIXXXXXXXXXXSTG----KVFEVMIQLGAILAVISVYFGRL
UPPP_RHOPS      ------FRAVILGVVEGVTEFLPVSSTGHLLLVGRFFN--LGEDSFWKSFAVLIQLGAILAILSIYFAKL
UPPP_CAMHC      ---MSIIDAVILGIVEGLTEFLPVSSTGHLILTAGLLN--LEQTDTLKCFEVVIQLGSILAVVFTFFERL
UPPP_BRUSU      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUSI      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUO2      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUME      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUMB      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUC2      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUAB      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUA2      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_BRUA1      -------EAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXX----ESTGKTFEVLIQLGAILAILSVYSAKL
UPPP_MESSB      -------QALMLGVLEGFTEFIPVSSTGHILLAGHFLGFQSTG----KAFEILIQLGAILAVLSVYAGRL
UPPP_NAUPA      ---MSIFDSIILGIVEGITEFLPISSTAHMIIVSTLLG--LKQSVQNVAFEVIIQLGATLAIVLIYEKIN
UPPP_CAMFF      --------AVILGIVEGLTEFLPVSSTGHMILSAKLLG--LEQTSVLKCFEVVIQLGSILAVVFMFFDRL
UPPP_NOVAD      --------AILLGIVEGLTEFLPVSSTGHLILATELFGYDAHQ---WAMFNVVIQLGAILAVVVQYWRTF
UPPP_BDEBA      ---MSYLHAIILGIVEGITEFLPISSTGHMIIASSMMG--IEDSSFTKAFEVIIQFGAIMSVLVLYWKRF
UPPP_THICR      ------FQAAILGIIEGLTEFLPISSTGHLIVVSDWLG--IEQTKQNTAFEVIIQVAAILAIFSHYKEKF
UPPP_BRAJA      -----AIRAVILGIIEGVTEFLPVSSTGHLLLAERFFH--LGEGAFWDSFTVLIQLGAILAIVGLYFKKL
UPPP_NITWN      -----AIRAVILGIIEGVTEFLPVSSTGHLLLAERFFD--LGSGNFWDTFTVLIQPGAILAIVVIYFAKL
UPPP_NITHX      -----AIRAVILGIVEGVTEFLPVSSTGHLLLAERFFD--LGSGNFWNTFTVLIQLGAILAIVVIYFEKL
UPPP_META3      -------QVIVLSIIEGITEFLPISSTGHLIIVSNLMN--LAQNAVQTNFEITIQLASIFAVCYEYREKF
UPPP_POLSJ      -------KAAIMGVVEGLTEFLPISSTGHLILAGALLGF---DDDKAKVFDIAIQTGAIFAVILVYWQKI
UPPP_DECAR      -------KALILGIVEGLTEFLPISSTGHLILAGDLLNF---NDDRGKLFEIVIQSGAILAVVWEYAFSE
UPPP_CAUCR      ------------------------------------------------TFQVLIQLGAILAITGVYGLLT
UPPP_CAUCN      ------------------------------------------------TFQVLIQLGAILAITGVYGLLT
UPPP_THETN      -------KAFIMGIVEGLTEFLPISSTGHLIIVGSFIKFTGK---FATMFEIVIQLGAILAVVYYFKDKI
UPPP3_ACIAD     MGNIEAFKALFLGFIEGLTEFLPISSTGHLILFGHLIDFHSDSG---RAFEVVIQLGAILAVCWLYRKKI
UPPP_NITMU      -------KGLILGIVEGLTEFLPISSTGHLILVSDLLNFNDEKG---KVFTIVIQLGAILAVCWEYRVKL
UPPP_NITEC      -------KAFLLGIVEGLTEFLPISSTGHLILAGDLLDF---NDDKAQVFTVAIQLGAILSVCWEYGWGT
UPPP_DESHD      MALVEIFKAILLGIVEGITEWLPISSTGHMILVDEFIKLNMSA-AFMEMFFVVIQLGAILAVVLLYWKKL
UPPP_CYTH3      -------ESIILAIVEGVTEFLPVSSTGHMIITSALMG--IKSDPFTKVFEVAIQFGAILSVVVLYFKRF
UPPP3_BACHK     ---------IIMGAVEGLTEFLPVSSTGHMILTGHLIGF---DDDRAKVFEVVIQLGSILAVVVIFGKVT
UPPP2_MAGSA     ------------------TEFLPISSTAHLMLIGDMLGF---EGPPGKTYEIVVQLGAILAVCVVFRQRL
UPPP2_BACC1     ---------IIMGAVEGLTEFLPVSSTGHMILTGHLLGF---DDERAKVFEVVIQLGSILAVVVIFGKVT
UPPP_YERPY      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPS      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPP      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPN      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPG      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPE      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPB      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERPA      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_YERP3      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP2_BACCR     ---------LIMGAVEGLTEFLPVSSTGHMILTGHLIGF---DDERAKVFEVVIQLGSILAVVVIFGKVT
UPPP_AZOSE      --------ALILGIVEGLTEFLPISSTGHLIIIGDLLGY---NDATSKVFKIVIQFAAILAVCWDYRERL
UPPP_AERS4      --------AFVLGIVEGLTEFLPVSSTGHMIIVGHLLGF---EGPKAATFEVVIQMGSILAVVAVFWRRL
UPPP_SERP5      ----SLFIAFVLGVVEGLTEFLPVSSTGHMIIVGEWLGFTGDK---AKTFEVIIQLGSILAVVVMFWRRL
UPPP_PSEMY      -----AFQALILGIVEGLTEFLPISSTGHLIVVGDLLGFNGET---ATAFKIIIQLGAILAVMVLGLRSE
UPPP3_BACCZ     -----------MGAVEGLTEFLPVSSTGHMILTGHLIGF---DDDRAKVFEVVIQLGSILAVVVIFGKVT
UPPP3_BACAH     -----------MGAVEGLTEFLPVSSTGHMILTGHLIGF---DDDRAKVFEVVIQLGSILAVVVIFGKVT
UPPP2_BACAN     -----------MGAVEGLTEFLPVSSTGHMILTGHLIGF---DDDRAKVFEVVIQLGSILAVVVIFGKVT
UPPP_DESDG      --------AAVLGLVEGLTEFLPVSSTGHLIITGYLLEYT---GPKAESFQVAIQLGAILAVVFLYGHGR
UPPP1_CLOAB     MEHIEILKAIFLGIVEGITEWLPISSTGHMILVNEFIRLNVTE-AFKQVFLVVIQLGAILSVVLLYFNKL
UPPP_ERWT9      ------WIAAILGLVEGLTEFLPVSSTGHMILVGHLLGF---EGNKAETFEVVIQLGSILAVVVMFWRRL
UPPP_VEREI      -------KAAIMGVVEGLTEFLPISSTGHLILAGALLGF---DDAKAQVFDVAIQTGAILAVILVYWAKI
UPPP_RHIE6      --------AALLGVIEGITEFLPISSTGHLIIAEQWLGHRSD------MFNIVIQAGAILAVTIIYGWRE
UPPP_FLAJ1      -------QAIVLAVIEGITEFLPVSSTGHMIIASSFFG--IAHEDFTKLFTIVIQLGAILSVVVLYFKRF
UPPP_THIDA      --------ALILGFVEGFTEFLPISSTGHLILAGQLLGFNGEK---AKVFMXXXXXXXXXXVVWEYRVRL
UPPP_RHOS4      -----------------------------------------------RSFEVVIQLGAVLAVLTVYAAKL
UPPP_RHOS1      -----------------------------------------------RSFEVVIQLGAVLAVLTVYAAKL
UPPP_RHILW      --------AALLGVIEGITEFLPISSTGHLIIAEQWLGHRSD------MFNIVIQAGAILAVTIIYGWRE
UPPP_RHIEC      --------AAILGVIEGITEFLPISSTGHLIIAEQWLGHRSD------MFNIVIQAGAILAVTIIYGWRE
UPPP_RALEJ      -----ALKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEKG---KIFEIVIQFGAILAVCVLSGLTT
UPPP_PORGI      -------QAIVLAIVEGLTEFLPVSSTGHMIIAEGIMG--VESTSFVRAFTVMIQFGAILSVLVLYGKEF
UPPP_ACIAC      -------KAAVMGVVEGLTEFLPVSSTGHLILAGALLGF---DDDKAKVFDIAIQTGAIFAVVLVYWQKI
UPPP_THEPX      -------KAFIMGIVEGLTEFLPISSTGHLIIVGKFIHFTGN---FATMFEIVIQLGAILAVVFYYRKKI
UPPP_THEP3      -------KAFIMGIVEGLTEFLPISSTGHLIIVGKFIHFTGN---FATMFEIVIQLGAILAVVFHYRKKI
UPPP_RHOFD      -------KAAIMGLVEGLTEFLPISSTGHLILAGTLLGFDNEVG---KVFDIAIQTGAIFAVILVYWQKI
UPPP1_CLOD6     ------FKAVILGIVQGITEWLPVSSTGHMILVDEFIKLNFS-NTFISTFLVVIQFGSILAVLVIFFRKL
UPPP_YERE8      ----SLFVAFVLGVVEGLTEFLPVSSTGHMIIVGELLGFTGDK---AKTFEVIIQLGSILAVVVVFWRRL
UPPP_RALEH      -----ALKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEKG---KIFEIVIQFGAILAVCWEFRARI
UPPP_AERHH      --------AFVLGIVEGLTEFLPVSSTGHMIIVGHLLGF---DGPKAATFEVVIQMGSILAVVAVFWRRL
UPPP_RHOP5      --------AIILGVVEGVTEFLPVSSTGHLLLAERFFN--LGEGPFWKSFAVXXXXXXXXXXXXXYFSKL
UPPP_PORG3      -------QAIVLAIVEGLTEFLPVSSTGHMIIAEGIMG--VESTSFVRAFTVMIQFGAILSVLVLYGKEF
UPPP_PARL1      --------AIILGIVEGVSEFLPISSTGHLIIVGELLGFSSVPG---KVFEVVIQLGAILAICVLYSGRL
UPPP_LACCB      -------KAVIIGIVEGLTEFLPISSTGHIDLVNHVIKLSQSQD-FISMFEYVIQFGAILAVVLLYAKAR
UPPP_DESMR      --------AVVLGIVEGATEFLPVSSTGHLILVGHLIGFTGEK---ADSFDVIIQLGAILAVVCLYPHHA
UPPP_CAUSK      --------AIVLGLVEGLTEFIPVSSTGHLLLTKIALGLT---DPAWDTFIVLIQLGAVLGVVALYFQRL
UPPP2_RHORT     MDLVMLIKAAILGLVEGITEFLPISSTGHLIIAGSLLDFLDEQKR--DVFVIVIQLGAILAVCWEYRRRL
UPPP_RHOS5      -----------------------------------------------RSFEVVIQLGAVLAVLTVYASKL
UPPP1_BURXL     -----ACKALILGVVEGLTEFLPVSSTGHLIVAGSLLNFT---DEHAKTFDVVIQLGAILAVCWEYRRRI
UPPP_LACC3      -------KAVIIGIVEGLTEFLPISSTGHIDLVNHVIKLSQSQD-FINMFEYVIQFGAILAVILLYAKAR
UPPP_BRASB      --------AVLLGIIEGVTEFLPVSSTGHLLLAERFFG--LGEDGFWKSFXXXXXXXXXXXXXXXYALSN
UPPP_RHOPT      --------AVILGIVEGVTEFLPVSSTGHLLLAERFFN--LGEGNFWKSFAVXXXXXXXXXXXXXYFVKL
UPPP_RHOPA      --------AVILGIVEGVTEFLPVSSTGHLLLAERFFN--LGEGNFWKSFAVXXXXXXXXXXXXXYFVKL
UPPP_RHOP2      --------AVILGVVEGVTEFLPVSSTGHLLLVGRFFN--LGEGDFWKTFDVXXXXXAKLWRIALGMFSD
UPPP_RALME      -----ALKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEKG---KIFEIVIQFGAILAVCWEFRQRI
UPPP_RHIL3      --------AAILGVIEGITEFLPISSTGHLIIAEQWLGHRSD------MFNIVIQAGAILAVTIIYGWRD
UPPP_DEIGD      --------AIIYGIVEGITEFLPISSTGHLIVAGNLMGVPWSKE-IRDTFEVVIQGGAILAVLAYYWRDF
UPPP_BRASO      --------AVLLGIVEGVTEFLPVSSTGHLLLAERFFG--LGEDGFWKSFXXXXXXXXXXXXXXXYALTN
UPPP_OLICO      ------FKALVLGIVEGVTEFLPVSSTGHILLAERIFD--LDQDNFWKTFXXXXXXXXXXXXXXXYFQRL
UPPP_HERAR      MDTILALKVIIMGIVEGLTEFLPISSTGHLILAGSLLEFT---GPKVKVFEIAIQTGAMLAVVWEYRVKI
UPPP1_BURCH     -------KALILGVVEGLTEFLPVSSTGHLIVAGSFLNF---NDSHAKTFDVVIQFGAILAVCWEYRQRI
UPPP1_BURCA     -------KALILGVVEGLTEFLPVSSTGHLIVAGSFLNF---NDSHAKTFDVVIQFGAILAVCWEYRQRI
UPPP_PHOLL      ------FHAAILGVVEGLTEFLPVSSTGHMIIVGHMLGFTGDK---AETFEVIIQLGSILAVVVVFWRRL
UPPP_ERWCT      --------AFILGVVEGLTEFLPVSSTGHMIIVGHWLGFVDEK---AKTFEVIIQLGSILAVVVMFWRRL
UPPP_DESAD      ----SLFTAAILGIVEGLTEFLPVSSTGHLIITGHLLGFTGEK---AASFEVAIQLGAILAVVVLYWSRF
UPPP_NEIMB      -------KALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNH----KVFEIAIQLGAVLAVVFEYRQRF
UPPP_NEIG2      -------KALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNH----KVFEIAIQLGAVLAVVFEYRQRF
UPPP_NEIG1      -------KALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNH----KVFEIAIQLGAVLAVVFEYRQRF
UPPP1_CHRVO     ------FHSLIMGLVEGITEFLPISSTGHLILTGDLLGFLDKEKR--DVYEIFIQLGAMLAVVWEYAVRP
UPPP_ZYMMO      ---------------EGVTEFIPVSSTGHLILAERLLGAHGANSA---SFDIIIQLGAILAVIVFYWERF
UPPP_NEIMF      -------KALMMGLVEGFTEFLPISSTGHLIVFGNL----IDFHSNHKVFEITIQLGAVLAVVFEYRQRF
UPPP_NEIMA      -------KALMMGLVEGFTEFLPISSTGHLIVFGNL----IDFHSNHKVFEITIQLGAVLAVVFEYRQRF
UPPP_POLNS      -------KAVILGVVEGLTEFLPISSTGHLILVGDLLDF---NDDRGKAFEVIIQFGAILAVCWEFREKL
UPPP_PECCP      --------AFILGVVEGLTEFLPVSSTGHMIIVGHWLGFVDEK---AKTFEVIIQLGSILAVVVMFWRRL
UPPP_JANMA      MDPILALKAIIMGIVEGFTEFLPISSTGHLILAGSLLDFT---GPKVKVFEIAIQTGAMLAVVWEYRAKI
UPPP_XANC5      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_XANAC      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_METPP      -------KAAIMGIVEGLTEFLPISSTGHLILTASLLNFTGE---IVKVFDIAIQTGAMFAVIWEYRVRL
UPPP_METFK      -------KAFILGIIEGATEFLPISSTGHLIIVGDLLDF---NDDKGKVFEIVIQLGAILAVCWEYTLHT
UPPP_GEOKA      ------WKAIILGMVEGLTEFAPVSSTGHMIMVDDLWLKSTE---FLNTFKVVIQLGSILAAVVVFXXXX
UPPP_BURMS      -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP_BURMA      -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP_BURM9      -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP_BURM7      -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP2_BURPS     -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP2_BURP1     -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP2_BURP0     -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRPAQ
UPPP_XANOR      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_XANOP      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_XANOM      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_DESVV      --------AAILGLVEGLTEFLPVSSTGHLIITGELLGFT---GPKAATFEVAIQLGAILAVVVLRGIMX
UPPP_DESVH      --------AAILGLVEGLTEFLPVSSTGHLIITGELLGFT---GPKATTFEVAIQLGAILAVVVLRGIMX
UPPP1_RHILO     ----------------------------------------------------------------------
UPPP_SODGM      --------AFILGGVEGLTEFLPVSSTGHMILVGSLLGFT---DDKAKTFEVIIQLGSILAVVVVFWRRL
UPPP_NITEU      ------------------TEFLPISSTGHLILAGDLLNF---NDDKAKVFTVAIQLGAILAVCWEYNLGT
UPPP_NEIM0      -------KALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNH----KVFEIAIQLGAVLAVVFEYRQRF
UPPP_CELJU      -------KAIIMGIVEGITELLPISSTGHLILAADVMNFLSHDKRVV--FEIFIQMGAMLAIVWEYAVRP
UPPP3_FRASC     -------EAVFLGAVEGLTEFLPVSSTGHLTILEKLLGHDID-DPDITAFTAIIQVGAVFATLLYFAWRE
UPPP_SULNB      ---------------EGFTEFLPISSTGHMIVASKFLG--VAETDLTKAYEVIIQFAAILAVMLIYREKI
UPPP1_FRAAA     MSAISVGQAIILGVVEGLTEFLPISSTGHLKIAEGLMDIQVD-DKAVVGFTAVIQVGAIAAVLVYFAART
UPPP_LAWIP      ---------VILGLVQGITEFLPVSSTGHLIIVAKFLHFTGSK---ASVFEVAVQLGSIMAVVVIYKNKK
UPPP_ACIBT      -------KALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGG---RVFEVVIQLGAILAVCWLYRQKI
UPPP_ACIBS      -------KALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGG---RVFEVVIQLGAILAVCWLYRQKI
UPPP_ACIBC      -------KALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGG---RVFEVVIQLGAILAVCWLYRQKI
UPPP_ACIBY      -------KALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGG---RVFEVVIQLGAILAVCWLYRQKI
UPPP_ACIB5      -------KALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGG---RVFEVVIQLGAILAVCWLYRQKI
UPPP_ACIB3      -------KALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGG---RVFEVVIQLGAILAVCWLYRQKI
UPPP1_BURCM     -------KALILGVVEGLTEFLPVSSTGHLIVAGSFLNF---NDAHAKTFDVVIQFGAILAVCWEYRQRI
UPPP_XANCP      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_XANC8      --------ALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSD------FFNIVIQAGAILAICLALGLGE
UPPP_CLOTH      -------KAIFLGIVEGITEWLPISSTGHMILVEEFINMNLS-DEFMEMFRVVIQLGAIMAVVVLYWNKL
UPPP_CLOPH      MDFIELLKVIFLGIVEGITEWLPISSTGHLLLVDEFLKVNLSKD-FMSMFNVVIQLGAILAVVVLFNFIK
UPPP_XYLFT      --------ALMLGILEGITEFLPVSSTGHLLIAEHWLGSRSD------FFNIVIQAGAILAITFVFGLDK
UPPP_XYLFA      --------ALMLGILEGITEFLPVSSTGHLLIAEHWLGSRSD------FFNIVIQAGAILAITFVFGLDK
UPPP2_SHEON     -------KAFFLGVIEGITEFLPISSTGHLILIGDWINFSSNEE---KVFEVVIQLGGILAVCWLFRDKI
UPPP2_ENTFA     -------KVIFLGIVEGITEWLPISSTGHMLLVDEFITLNMSE-AFKEMFFVVIQLGAILAVVVMFSIIK
UPPP_RHOPB      --------AVILGIVEGVTEFLPVSSTGHLLLAERFFD--LGDTNFWKSFTXXXXXXXXXXXIALGMFSD
UPPP_ACIBL      ------------------TEFLPVSSTAHLRICEALLHIDLG-DGFWKMFSIVIQLGAILCLPIYFSGNH
UPPP_SULDN      -------DSIILGAIEGFTEFLPISSTGHLIVASEFLG--LEQNAINKAYEVIIQFSAILAVIFNYDKFS
UPPP_METI4      ------WPTILLGIIEGLSEFLPISSTGHLLVAEHWLGERSE------TFNIFIQLGAVLAVCLIYKERL
UPPP1_ACIAD     -------KAAIMGIVEGITEFLPISSTGHLILASELMNFWTKEKSAV--FVVAIQMGAIAAVIYEYWSRL
UPPP_METCA      --------ALILGLVEGLTEFLPVSSTGHLILVGELLKF---NDDRGKLFEVVIQSGAILAVCLLFGLGH
UPPP1_STRCO     MSAISIGQAVVLGAVEGVTEFLPVSSTGHLKIVEGLMGIPVDDDAVIG-FSAVIQVGAIAAVLVYFSKDI
UPPP1_BURS3     -------KALILGVVEGLTEFLPVSSTGHLIVAGSFLNF---NDSHAKTFDVVIQFGAILAVCWEYRQRI
UPPP_LACPL      ------FKAVILGIVEGITEFLPISSTGHLVLVDEFIKMQ-QSTQFTDMFNVVIQLGAIMAVVVLYTTEK
UPPP_GEOTN      -------KAVILGMVEGLTEFAPVSSTGHMIIVDDLWLKSTE---FLNTFKVVIQLGSILAAVVVFKDRF
UPPP_STRTD      -------KAVFLGIVEGITEWLPISSTGHLILVNEFLNLRQSKD-FIDMFNIVIQLGAILAVMVIYAREV
UPPP_STRT2      -------KAVFLGIVEGITEWLPISSTGHLILVNEFLNLRQSKD-FIDMFNIVIQLGAILAVMVIYAREV
UPPP_POLNA      -------KAAIMGIVEGLTEFLPISSTGHLILAGALLGF---DDDKAKVFDIAIQTGAIFAVILVYWQKI
UPPP_LACF3      -------KAVILGIVEGITEFLPISSTGHLVLVDEFIKLN-EPKKFIDMFNVVIQLGAIMAVVVLYRLER
UPPP_PSYA2      -------QAVIMGIVEGITEFLPISSTGYLILSADLMGFWTKEKVDL--FVVVVQFGAILAVIYDYAEGM
UPPP_LACDB      ------FKAIILGIIEGVTEFLPISSTGHLYLADYIIKLD-QPTSFINMFMVVIQLGAILSVIVIYKREK
UPPP_LACDA      ------FKAIILGIIEGVTEFLPISSTGHLYLADYIIKLD-QPTSFINMFMVVIQLGAILSVIVIYKREK
UPPP_SPHAL      -------------------------------------------------FKIAIQLGAILAVLVAYRARF
UPPP2_PSEHT     ------FNAIILGIIEGITEFLPISSTGHIIVAAQWLG--IEATATNQAFGXXXXXXXXXXXXXNYDKFT
UPPP_PSYWF      -------KAVIMGIVEGITEFLPISSTGYLILSADLMSFWTKEKADL--FIVVIQLGAILAVIYEYWGRL
UPPP1_ENTFA     ------WKAIILGIIEGITEWLPISSTGHLILVDEFIKLDLSKD-FMEMFNVVIQLGAIMAVVILYGEEK
UPPP_SINMW      ----------------------------------------------------------------------
UPPP_STRGC      -------KSVIFGIIEGITEWLPISSTGHLILVQEFIHYQKQNAAFMEMFNVVIQLGAILAVVFIYFDKL
UPPP_SHISS      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_FLAPJ      ------------------TEFLPVSSTGHMIIASSFFG--IAHEDFTKLFTIVIQLGAILSVVVLYFKRF
UPPP1_AGRT5     MGDQSIISALLLGIIEGLTEFIPV----------------------------------------------
UPPP_VARPS      -------KAAVMGIVEGLTEFLPISSTGHLILAGSLLGF---DDDKAKVFDIAIQTGAIFAVILVYWQKI
UPPP_PSYCK      -------QAVIMGIVEGITEFLPISSTGYLILSADLMGFWTKEKVDL--FVVVVQFGAILAVIYDYAEGM
UPPP_LACSS      -------KAIILGIVEGFTEWLPISSTGHLVLVGSVLKMG-ESKAFMDMFNYVIQFGAILAVVVLYQLEQ
UPPP_ENTS8      --------AAILGIVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_STRT1      -------KAVFLGIVEGITEWLPISSTGHLILVNEFLNLRQSKD-FIDMFNIVMHLGAILAVMVIYAREV
UPPP_RHISN      ----------------------------------------------------------------------
UPPP_ENT38      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGETAKTFEVVIQLGSILAVVVMFWRRL
UPPP_FUSNN      ---------VILAIVEGITEFLPISSTGHMILVNKLIGGEYLSPTFRNSFLIIIQLGAIFSVVVYFWKDI
UPPP_ESCF3      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOLI      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOLC      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOHS      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECODH      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOBW      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO7I      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO5E      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO57      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SHIFL      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SHIF8      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SHIBS      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SHIB3      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_RHIME      ----------------------------------------------------------------------
UPPP_ECOUT      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOSE      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOLU      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOL6      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOL5      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECOK1      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO8A      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO81      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO55      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO45      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO27      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_ECO24      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP2_STRCO     ---MSWFESLVLGLVQGLTEFLPVSSSAHLRLTAAFSGW---HDPGA-AFTAITQIGTEAAVLIYFSMRH
UPPP_SHEWM      ---MDTFQVIILALIQGLTEFLPISSSAHLILPSQILGW---EDQGL-AFDVAVHIGSLLAVVLIFKGQK
UPPP_MACCJ      -------KALILGIVEGLTEFAPVSSTGHQILVDDMWLQTLNSQESANTFKIVIQLGSIFAVLHIEKTKT
UPPP_DEIDV      --------AIVYGIVEGITEFLPISSTGHLILTGNLMGVPWSKE-VKDAFEVVIQGGAILSVLVYYWRDF
UPPP1_BURTA     -------KALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHPEQ---AKTFDVVIQFGAILAVCWEYRRRI
UPPP_SALDC      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALTY      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALTI      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALSV      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALPK      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRQL
UPPP_SALPC      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALPA      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRQL
UPPP_SALNS      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALHS      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALCH      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRQL
UPPP_SALAR      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_SALA4      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAKTFEVVIQLGSILAVVVMFWRRL
UPPP_PSEE4      ----SALQAIILGVVEGLTEFLPISSTGHQIIVADLINFGGER---AMAFNIIIQLGAILAVVVLGLPTQ
UPPP_CITK8      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTAETFEVVIQLGSILAVVVMFWRRL
UPPP1_STRAW     MSVINVGQAVVLGAVEGVTEFLPVSSTGHLKITEGLMGIPVDDNAVVG-FSAVIQVGAIAAVLVYFDERH
UPPP_STRP6      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRPM      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRP8      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRP3      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRP1      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_PARDP      -----------------------------------------------RAFEVLIQLGAIMAILGVYAGRL
UPPP_THEFY      ---MSIIEAIILGLVQGLTEFLPISSSGHLRIVAAFSGWP---DPGA-AFTAVSQIGTELAVLIYFRKDV
UPPP_GEOSW      MDIVEIIKAIILGMVEGLTEFAPVSSTGHMIIVDDMW---LKSQEFLNTFKVVIQLGSILAVVVVFKDRF
UPPP_EXIS2      -------KALLLGFIEGMTEFAPVSSTGHMIIVDDMW---LQTTDFLNTFKIVIQLGSILAVIVVFWKRL
UPPP_ALKOO      MSIIELLKVIFLGIVEGITEWLPISSTGHMILVEEFIQLNASA-AFKEMFFVVVQLGAIMAVVLLYKREK
UPPP_THISH      ------FQTLVLALVQGLTEFLPISSAAHLILVPEL----TDWDDQGLAFDVATHVGSLAAVVILAGRGL
UPPP_STRM5      ----------------------------------------------------------------------
UPPP_DEIRA      --------SLIYGIVEGITEFLPISSTGHLILTGNLLHVPWPKE-VKDTFEVVIQGGAILAVLVYYWRDF
UPPP_STRPF      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRPD      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRPC      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_STRPB      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP2_CLOD6     -------KSVIIAIVEGLTEFIPVSSTGHMILVGNLIDF---KGQFAEMFEVVIQLGAILAVVVLYGKEG
UPPP_STRPZ      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIIIQLGAIIAVMLIYAREV
UPPP_STRPG      -------KAIFFGIIEGITEWLPVSSTGHLILVQEFIRLN-QDKAFIEMFNIVIQLGAIIAVMLIYAREV
UPPP_KLEP7      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTANTFEVVIQLGSILAVVVMFWRRL
UPPP_KLEP3      --------AAILGVVEGLTEFLPVSSTGHMIIVGHLLGF---EGDTANTFEVVIQLGSILAVVVMFWRRL
UPPP_STRMK      ----------------------------------------------------------------------
UPPP_ALTMD      ---MTLFEIIILAIIQGVTEFLPISSSGHLLL-------PAELLGWVSAFDVAVHVGSLLAVMIYFSKQQ
UPPP_BORPD      -------KAFFLGIIEGLTEFIPVSSTGHLILIGDWINFTSSSG---KVFEVVIQFGSILAVMWIFRARL
UPPP2_AGRT5     -------EAGFLGLLQGLTEFLPVSSSAHLRIAGEFL--PSGADPGA-AFTAITQIGTEMAVLVYFGEYN
UPPP_DIAST      -------KAAIMGVVEGLTEFLPISSTGHLILAGSLLGF---DDAKAKVFDIAIQTGAIFAVILVY----
UPPP_ACISJ      -------KAAIMGVVEGLTEFLPISSTGHLILAGSLLGF---DDAKAKVFDIAIQTGAIFAVILVY----
UPPP_CHRSD      -----------LAVIQGLTEFLPISSSAHLILPSQLLGWPDQG----LAFDVAVHVGSLAAVVLAFGGPA
UPPP_BORPE      -------KAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSSG---KVFEVVIQFGSILAVMWIFRARL
UPPP_AZOSB      ------------GIVEGLTEFLPVSSTGHLIILGDLLGY---NDEASKVFKIVIQLAAILAVCWDYRERL
UPPP_TERTT      ---------VVLALIQGITEFLPISSSAHLILPKEILGWPDQG----LAFDVAVHVGTLTAVAVYFGRGT
UPPP_STRSV      ------------------TEWLPISSTGHLILIQDFIQFKNQSPAFMEMFNVVIQLGAILAVVVIYFDKL
UPPP_STRGG      ---MSWFESFVLGLVQGLTEFLPISSSAHLRLTAAFAGW---HDPGA-AFTAISQIGTEAAVLIYFSMRG
UPPP_BORPA      -------KAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSSG---KVFEVVIQFGSILAVMWIFRARL
UPPP_BORBR      -------KAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSSG---KVFEVVIQFGSILAVMWIFRARL
UPPP_DESDA      --------ALILSIVEGLTEFLPVSSSGHLILAGDLLGFVGEK---AATFDVVIQLGAIMAVVVLYWKRF
UPPP_AZOBR      -------DAALLGLIEGLTEFLPVSSTGHLIIFDTLLGF---EGPPGKVFEVVIQLGAILAICTVYFARL
UPPP_PSEU2      ----TAAQALILGVVEGLTEFLPISSTGHQIIVADLIDFGGER---AMAFNIIIQLGAILAVVWEFRPKQ
UPPP_NOCSJ      -------QALVLGLIQGLTEFLPISSSAHLRIYPELFGWG---DPGA-AFTAVIQIGTEVAVLMFFRKDI
UPPP_CLOTE      --------------VEGLTEFVPVSSTGHLILVSDVINF---KGDYANLFNVVIQLGAILAVVVVYWDKL
UPPP_CLOPE      --------------VEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGAILAVVVLYWRKI
UPPP_CLOP1      --------------VEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGAILAVVVLYWRKI
UPPP_ANADF      ---MSLLAAVFLGVLQAATEFLPVSSTAHLLVFGELLGHDLA-DPRFRAFATIIQTGTTLAVLVYFXXXE
UPPP_ALKMQ      ---MTTFKAILLGIVQGLTEFLPVSSSGHLAVTQHLLGVPEDRILFLT---ILLHVGTLFSVFFVYADDI
UPPP_PSE14      ----TAAQALILGVVEGLTEFLPISSTGHQIIVADLIDFGGER---AMAFNIIIQLGAILAVVWEFRRKI
UPPP_CHLPB      ---MTLFEAIILGIVQGLTEFLPISSTAHLRIVPALAGW---QDPGA-AFSAIVQIGTLAAVLIYFGRPF
UPPP1_PSEU5     -----AIQALILGVVEGITEFLPVSSTGHQIIVADLIGFGGER---ALAFNIIIQLGAILAVIWEYRPEE
UPPP_SYNWW      ---MTLFQAFILGAVQGLTEFLPVSSSGHLVIFQHIFA--IEEPPL--TFDVLVHLGTLIAVFVIWGILK
UPPP_PSESM      ----TAAQALILGIVEGLTEFLPISSTGHQIIVADLIDFGGER---AMAFNIIIQLGAILAVVWEFRPKQ
UPPP_DESPS      ----------------------------------------------------------------------
UPPP_VIBHB      ---MSYFEAFILALIQGLTEFLPISSSAHLILPSAILGW---EDQGL-AFDVAVHVGTLMAVVIIFKGDR
UPPP_STAAT      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAAE      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAA8      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAA3      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP2_STRAW     ---MSWFESLILGLVQGLTEFLPVSSSAHLRLTAAFAGW---EDPGA-AFTAITQIGTEAAVLIYFRKDI
UPPP_PSEF5      ----TAAQALILGIVEGLTEFLPISSTGHQIIVADLLDFGGER---AMAFNIIIQLGAILAVVVIGLPTQ
UPPP_LEUCK      -------KSIIIGIVEGLTEFLPVSSTGHIILAEALMKIPVWTKSFTAVFDYAIQLGAIFAVIQLYSREQ
UPPP_HAHCH      -------EIVVLALIQGLTEFLPISSSAHLILPSEVWGW---QDQGL-AFDVAVHVGTLLAVMVYFGGGA
UPPP_GEOMG      --------ATVLGAIQGLTEVLPVSSSAHLILIPWLFGWPESGI----TFDVALHLGTLIALALYFGGAH
UPPP_SHEPA      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLLAVVMYFRREI
UPPP_RHOSR      MGEAMSWQAIVLGTVQGLTEFLPISSSGHLRIVSEVFFG----DDAGASFTAVTQLGTEAAVLIYFARDI
UPPP_STAAW      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAAS      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAAC      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_SHESH      ---MDTFQVIILALIQGLTEFLPISSSAHLILPSQLLGW---EDQGL-SFDVAVNTGSLLAVVMYFRHEL
UPPP_SHEB9      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIIFRGQQ
UPPP_SHEB8      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIIFRGQQ
UPPP_SHEB5      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIIFRGQQ
UPPP_SHEB2      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIIFRGQQ
UPPP_LARHH      -------KAAIMGIVEGLTEFFPISSTGHLIVVGDLINF---DDRIGNVFEVVIQLGAILAVCWEYRARL
UPPP_AZOVD      -----AAQAFILGVVEGLTEFLPISSTGHQIIIADLIGFGGDR---AKAFNIIIQLGAILAVVILGLPRE
UPPP_SHESW      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAELLGW---EDQGL-SFDVAVNTGSLLAVVIIFKGKQ
UPPP_SHEPW      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLDW---QDQGL-SFDVAVNTGSLLAVVMYFSGKQ
UPPP_SHEPC      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAELLGW---EDQGL-SFDVAVNTGSLLAVVIIFKGKQ
UPPP_DICNV      ----------------------------------------------------------------------
UPPP1_OENOB     -------KAIILGIVEGITEFLPISSTGHLIIVDQFVKIS-SNKAFTTTFEYVIQLGAIIAVVLLY----
UPPP1_BACHK     ----------------------------------------------------------------------
UPPP1_BACAN     ----------------------------------------------------------------------
UPPP1_BACAH     ----------------------------------------------------------------------
UPPP_STAAN      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAAM      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAAB      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAA9      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAA2      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_STAA1      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_ARTS2      ---VNWFEAALLGLVQGLTEFLPISSSAHLRIVGSFL--PNAADPGA-AFTAITQLGTETAVIVYFWRDI
UPPP_PHOPR      ---MSHFEAFMLALIQGLTEFLPVSSSAHLILPSEILGWPDQG----LAFDVAVHVGTLAAVILIFKGKH
UPPP2_BACLD     --------AIILGIVEGLTEYAPVSSTGHMIIVDDVWLKSKETPEAANTFKVVIQLGSILAVAFVFKDRI
UPPP_DESAP      ---MNPFEGIVMGIVQGLTEFLPVSSSAHLVLVPWLFGF---ETPGL-VFDVALHLGTLVAVLVYFWRDW
UPPP4_BACAH     -------EAFILGIIQGLTEFLPISSTGHLYLGRHLFQLD-EAGLFLDTML---HIGTLLAVFIYYKKEF
UPPP3_BACCR     -------EAFILGIIQGLTEFLPISSTGHLYLGRHLFRLD-EAGLFLDTML---HIGTLLAVFIYYKKEF
UPPP1_PSEPF     ----TALQALILGVVEGLTEFLPISSTGHQIIVADLLDFGGER---AMAFNIIIQLGAILAVVVIGLPTQ
UPPP_ACIC1      --------AVVLGVIEGVTEFLPVSSTAHLTIAEALMGMKTDA-PAVTAFTAVIQMGAILAAIVYFRRDI
UPPP4_BACCZ     -------EAFILGIIQGLTEFLPISSTGHLYLGRHLFQLD-EAGLFLDTML---HIGTLLAVFIYYKKEF
UPPP_SHEHH      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLLAVVMYFRREL
UPPP_CLOPS      --------------VEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGAILAVVVLYWRKI
UPPP_ALCBS      ------FQALVLALIQGLTEFLPISSSAHLILPSQILGWPDQG----LAFDVAVHLGTLLAVMMYYRRDL
UPPP1_SHEON     ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIYFRHEL
UPPP_STAAU      -------KGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEQSAF--TFKIVIQLGSVFAAAWVFRERF
UPPP_PROA2      ---MSLFEAIILGIAQGLTEFLPISSTAHLRIVPALAGW---QDPGA-AFTAIVQIGTLIAVLIYFFRDI
UPPP_COLP3      ---MSTLEIIILALLQGLTEFLPISSSAHLILPSQVLGW---QDQGL-AFDVAVHVGTLLAVMMYFRKEL
UPPP_CARHZ      ---MNSFQALILGLVQGLTEYLPVSSSGHLVLLQKIFG--LKENVLL--FDILVHLGTLVPLLIIFAIIK
UPPP_VIBPA      ---MSYFEAFILALIQGLTEFLPISSSAHLILPSAIFGWADQG----LAFDVAVHVGTLMAVVIIFKGDR
UPPP_RALSO      ------------GIVEGLTEFLPISSTGHLILAGQLLDFNDEKG---KIFEIVIQFGAILAVCWEFRHKI
UPPP_PSYIN      ---MSELQIVVLALIQGLTEFLPISSSAHLILPSQLLGW---QDQGL-AFDLILNIGTLSAVLIYFGKGE
UPPP_CLAM3      ---MSYLEAIILGLVQGLTEFLPISSSAHLRIAGLFMGG----DPGA-TFTAITQLGTELAVVVFFRKRI
UPPP_PSEA7      ----------------------------------------------------------------------
UPPP_GEOSF      ------FQATILGIVQGLTEVLPISSSAHLILIPTFLKWPESGI----TFDVALHLGTFIALCLYFWRDL
UPPP_STRA5      -------KALFLGVVEGVTEWLPVSSTGHLILVQEFMKLN-QSKSFVEMFNIVIQLGAIMAVIVIYAREI
UPPP_STRA3      -------KALFLGVVEGVTEWLPVSSTGHLILVQEFMKLN-QSKSFVEMFNIVIQLGAIMAVIVIYAREI
UPPP_STRA1      -------KALFLGVVEGVTEWLPVSSTGHLILVQEFMKLN-QSKSFVEMFNIVIQLGAIMAVIVIYAREI
UPPP_SHEAM      -------QVIILALIQGLTEFLPISSSAHLILPAQLFGW---EDQGL-SFDVAVHIGSLAAVVIIFRGQQ
UPPP_SACD2      --------AVFLALIQGITEFLPISSSAHLILPKELFGW---EDQGL-AFDVAVHVGTLSAVILYFGSIT
UPPP_PSEAB      ----------------------------------------------------------------------
UPPP_PROAC      ----------------------------------------------------------------------
UPPP_LEUMM      ---------------EGLTEFLPVSSTGHIILAEALMKIPVWTKAFSSVFDYSIQLGAIFAVIQLYDHEK
UPPP_LACLS      ----------------------------------------------------------------------
UPPP_BLOPB      --------SLILGIVEGLTEFLPISSTGHMILVENILNCM---DDSVIAFTVIIQLGAILSITKLYGMSM
UPPP_BACA2      ---MTLWEAAVLGIVEGLTEYAPVSSTGHMI---------IADDIWLKSFKVVIQLGSILAVAIVFKDRI
UPPP_ANATD      ---MTTFQAIFLGILQGLGEFLPISSSAHLIIFPWLFGWKEHS----LVFDVALHLGTLLAVLVYFAKPK
UPPP4_BACHK     -------EAFILGIIQGLTEFLPISSTGHLYLGRHLFQLD-EAGLFLDTML---HIGTLLAVFIYYKKEF
UPPP_STRZT      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRZP      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRZJ      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRR6      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRPS      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRPN      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRPJ      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRPI      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRP7      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRP4      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRP2      -------KSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILAVMVIY----
UPPP_STRMU      -------KAIIFGIVEGITEWLPISSTGHLILVEEFIHXXXXXXXXXXXXXVVIQLGAILAVVVIYFDRL
UPPP_ARTAT      -------EAALLGLVQGLTEFLPISSSAHLRIVGSFL--PNAADPGA-AFTAITQLGTETAVIVYFWRDI
UPPP2_BURS3     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFGGRK
UPPP2_BURCH     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFGGRK
UPPP2_BURCA     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFGGRK
UPPP_SHESR      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIYFRNEL
UPPP_SHESA      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIYFRNEL
UPPP_LACLA      --------AIILGVIEGITEWLPISSTGHLIIADEFIRLN-QSAAFKEMFDVVIQLGAILSVVVLY----
UPPP_ARTCA      ------FEVALLGLVQGLTEFLPISSSAHLRIVGQFL--PNAEDPGA-AFTAITQLGTETAVVVYFWRDI
UPPP1_CORJK     -------QVIVLSVVQGLTEFLPVSSSGHLRIVSQLFWG---EDAGA-SFTAVIQLGTELAVLVFFAKDI
UPPP_SHESM      ---MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGW---EDQGL-SFDVAVNTGSLFAVVIYFRNEL
UPPP_SHEDO      ---METFQIILLALIQGLTEFLPISSSAHLILPSQLLGW--KDQGF--SFDVAVNTGSLLAVVIYFRHDL
UPPP_PSEA8      ----------------------------------------------------------------------
UPPP_CHLTE      ---MNLFQAIILGIIQGLTEFLPISSSAHLRIVPALMGWG---DPGA-AFTAIIQIGTLAAVLIYFAKDI
UPPP_CHLP8      ---MNLFQAIILGIVQGLTEFLPISSSAHLRIVPALAGW---DDPGA-AFTAIVQIGTLAAVLLLKGKPL
UPPP_BORA1      -------KAFFLGIIEGLTEFIPVSSTGHLILFGDWINF---ESGSGKVFEVVIQLGAILAVMWIF----
UPPP2_BURCM     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFGGRK
UPPP_STRSY      -------KAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKN-FLEMFNIVIQLGAILAVMTIY----
UPPP_STRS2      -------KAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKN-FLEMFNIVIQLGAILAVMTIY----
UPPP_PELPB      ---MTLFEAIVLGIVQGLTEFLPISSTAHLRIIPALAGW---EDPGA-AFTAIVQIGTLVAVLLYFWKDI
UPPP_BACSU      ---MTLWEAAILGIVEGLTEYAPVSSTGHMIIVDDIWLKSLMSEEAANSFKVVIQLGSILAVAIVFSDQE
UPPP3_BACC1     -------EAFILGIIQGLTEFLPISSTGHLYLGRHLFQLD-EAGLFLDTML---HIGTLLAVFIYYKKEF
UPPP_VIBVY      ---MSYFEAFVLALIQGLTEFLPISSSAHLILPSAILGW---EDQGL-AFDVAVHVGTLAAVVIIFKGER
UPPP_VIBVU      ---MSYFEAFVLALIQGLTEFLPISSSAHLILPSAILGW---EDQGL-AFDVAVHVGTLAAVVIIFKGER
UPPP_STAES      ----------------------------------------------------------------------
UPPP_STAEQ      ----------------------------------------------------------------------
UPPP_RENSM      -------QAAILGIVQGLTEFLPISSSAHIFIVGKLMGLG---DPGA-AFTAVSQLGTEAAVIVFFWRDI
UPPP_PELPD      --------ALILGALQGVTEVLPISSSAHLILVPWLLGWPESG----LTFDVALHLGTFLALVVYFRRDI
UPPP_MICLC      -------EAIILGLVQGLTEFLPISSSAHIRIVGEFL--PSATDPGA-AFTAITQLGTELAVLIYFWRDI
UPPP_CHLPD      ---MTLFESIVLGVVQGLTEFLPVSSTAHLRIIPALAGW---EDPGA-AFTAVVQLGTLAAVLIYFRPFD
UPPP_SYNJB      ------WQALILGMVQGITEFLPISSTAHLRVFPALVGWPDAG----ASFTAVIQLGSLGAVLIYFASDL
UPPP_SOLUE      -------QVIVLAVVQGLTEFLPISSTAHLYLTSWLLGWQIEG----LDFDIALHIGTLLAVLIFFARDW
UPPP_LACLM      ----------------------------------------------------------------------
UPPP_CLOCE      -------KSIVLGIVEGVTEFLPISSTGHLIIFENIMGFKSASPNYVKMYTYVIQLGAIMAVVLLYWKKI
UPPP_CHLL2      ---MNLFEAVILGIVQGLTEFLPISSTAHLRIIPALAGW---KDPGA-AFTAIVQIGTLAAVLIYFFRDI
UPPP2_PSEPF     MDLLTLFKVLILGAVEGLTEFLPISSTGHQIIVADLLEFGGER---AMAFNIIIQLGAILAVVWEFRPKI
UPPP_VIBSL      ---MSYFEAFMLALVQGFTEFLPISSSAHLILPSAVLGW---EDQGL-AFDVAVHVGTLAAVVIVFKGDR
UPPP_SYNJA      ------WQALVLGMVQGITEFLPISSTAHLRVFPALLGWPDAG----ASFAAVIQLGSLGAVLIYFASDL
UPPP_PSEA6      ----------------------------------------------------------------------
UPPP_CORST      -------QVIVLSIVQGLTEFLPVSSSGHLRIVSQLFWG---EDAGA-SFTAVIQLGTELAVLVFFAKDI
UPPP_COREF      -------QTLVLSVVQGLTEFLPISSSGHLRIISELFWGADAG----ASFTAVVQLGTEAAVLVYFAREI
UPPP_THEYD      ----------------------------------------------------------------------
UPPP_STAAR      ----------------------------------------------------------------------
UPPP_PSEPK      ----TAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERXXXXXXXXVVWEFRSKIFEVVFGLTNQ
UPPP_PSEP1      ----TAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERXXXXXXXXVVWEFRSKIFEVVFGLTHQ
UPPP_PSEAE      ----------------------------------------------------------------------
UPPP_LEPBL      --------AFLRSIIEAVTEFLPVSSTGHXXXXXXXXXXXXXXXXXDDLFDIFIQSGAILSVLFLYREKF
UPPP_LEPBJ      --------AFLRSIIEAVTEFLPVSSTGHXXXXXXXXXXXXXXXXXDDLFDIFIQSGAILSVLFLYREKF
UPPP_GEMAT      ---MTVWQAIVLGIVQGLTEPLPVSSSAHLALTPYFLGW---SDPGL-AFDVALHFGTLLALIWYFRREW
UPPP_CLONN      ---------------------------------------------YIDAFTMIIQLGAILAIVVLYWDKI
UPPP3_FRAAA     ------FEGTVLGLVQGLTEFLPVSSSAHLRITAALAGW---DDPGA-AFTAVTQIGTETAVLIYFRRDI
UPPP_VIBCM      ---MSYFESFILALIQGFTEFLPISSSAHLILPSAILGW---EDQGL-AFDVAVHVGTLAAVVLIFKGDR
UPPP_VIBCH      ---MSYFESFILALIQGFTEFLPISSSAHLILPSAILGW---EDQGL-AFDVAVHVGTLAAVVLIFKGDR
UPPP_VIBC3      ---MSYFESFILALIQGFTEFLPISSSAHLILPSAILGW---EDQGL-AFDVAVHVGTLAAVVLIFKGDR
UPPP_PROM3      ----ACWRNLVLGVVQGLTEFLPISSTAHLKVVPMLVGWG---DPGVSATAV-IQLGSILAVIVYHGQWR
UPPP_MOOTA      -------QAIVLGLVQGVGEFLPISSSAHLILTPWFFRWP---DPGL-TFDVALHLGTLIAVVAYFGQPR
UPPP_HALOH      ------FKVIFLGIIQGLTEFLPISSSGHLVLFQELLGINTDQI----TLDVFLHFGTVIPVLIIFWDDV
UPPP_DESOH      -------QGVVLGIIQGLTEFLPVSSSGHLVLVQHLFGIT---EPAL-FFDVSLHMGTLLAVLIVFRKDL
UPPP_STACT      ------------GIVEGLTEFAPVSSTGHMILVDDMWLKSPEQSAF--TFKIVIQLGSVFAAAWVFGKRV
UPPP_MYCTU      ---MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFF----SGDAGASFTAVSQLGTEAAVVIYFARDI
UPPP_MYCTA      ---MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFF----SGDAGASFTAVSQLGTEAAVVIYFARDI
UPPP_MYCBT      ---MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFF----SGDAGASFTAVSQLGTEAAVVIYFARDI
UPPP_MYCBP      ---MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFF----SGDAGASFTAVSQLGTEAAVVIYFARDI
UPPP_MYCBO      ---MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFF----SGDAGASFTAVSQLGTEAAVVIYFARDI
UPPP_PSEPG      ----TAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERXXXXXXXVVWEFRGKILEVV--FGLTS
UPPP_LEPIN      --------AFLRSIIEAITEFLPVSSTGHLFLFSSFFPFYGENVEFDDLFDIFIQSGAILSVLFLY----
UPPP_LEPIC      --------AFLRSIIEAITEFLPVSSTGHLFLFSSFFPFYGENVEFDDLFDIFIQSGAILSVLFLY----
UPPP_BACV8      ------FEALILGVLQGLTEYLPVSSSGHLAIGSALFGIQGEDN---LTFTIAVHVATVLSTLVLFKFEM
UPPP2_FRASC     ----------------------------------------------------------------------
UPPP_SACEN      -------QAMVLAVVQGLTEFLPISSSGHLSIVSKLFFGSDAG----ASFTAVTQIGTELAVVIYFAGDI
UPPP_PROVI      ---MTLFEAIMLGIVQGLTEFLPISSTAHLKIVPALLGW---SDPGA-AFTAIIQIGTLAAVLILKGKPL
UPPP_MYCUA      ---MSWWQVISLAVVQGLTEFLPVSSSGHLAVVSRVFF----SDDAGASFTAVTQLGTEAAVLVYFARDI
UPPP_CORGL      -------QTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAG----ASFTAVVQLGTEAAVLVFFAKEI
UPPP_CORGB      -------QTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAG----ASFTAVVQLGTEAAVLVFFAKEI
UPPP_MYCMM      ---MSWWQVISLAVVQGLTEFLPVSSSGHLAVVSRVFF----SDDAGASFTAVTQLGTEAAVLVYFARDI
UPPP1_BURPS     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFNGRK
UPPP1_BURP1     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFNGRK
UPPP1_BURP0     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTALALLWYFNGRK
UPPP_SYNR3      ----ACWRTVVLGIVQGLTEFLPISSTAHLKVVPVLAGWG---DPGVAVTAV-IQLGSIAAVILREGDWG
UPPP_METVS      -------ENILLGIVQGLTEFLPVSSSGHLAIFTAIFNKTPDVGYFLATFLAVVIFKEIFEIINGVFKKD
UPPP_PARD8      ---MSWFEALILGIVQGLTEYLPVSSSGHLAIGSALFGIEGEEN---LAFTIVVHVATVFSTLVLFKFQM
UPPP_MARAV      ----------------------------------------------------------------------
UPPP_VIBFM      ------FEAFFLALLQGFTEFLPISSSAHLILPSAILGWPDQG----LAFDVAVHVGTLAAVVIYFRKEV
UPPP_RALPJ      ----------------------------------------------------------------------
UPPP_MYCVP      ----------------------------------------------------------------------
UPPP_GRAFK      ------FDAIVLGIIQGLTEFLPVSSSGHLELGKAILGDTLPEESLL--FTVVLHFATALSTLVVFRKDV
UPPP2_CORJK     -------QTIILSLIQGLTEFLPVSSSGHLRIFSTLLWG---EDAGA-SFTAVIQLGTELAVLVFFAKDI
UPPP_SYNFM      ----------------------------------------------------------------------
UPPP_SORC5      ------FDAVLLGVLEGLTEFLPVSSTGHLILLGAWLGHQSEA---AKTLDIVIQLGAVLAVVVYF----
UPPP_RUBXD      -------QAVLLGAVQGLTEFLPVSSSGHLLLGQYFLG--LDQDRFGLSFDVALHLGTLVAVVVFFRRDL
UPPP_PARUW      ---MTIWEAFFLGLIQGVTEFLPISSSGHLELAQYFLGFEKLQSYVL--FNLICHLGTLGSILYMF-LPQ
UPPP2_PSEU5     -------QIIVLAIVQGLTEFLPVSSSAHLILFPHL----VGWDDQGLAFDVAVHLGTLAAVVWVFGMTR
UPPP1_PSEHT     ---MSIIEIIVLALIQGFTEFLPISSSAHLILPSQILGW---EDQGL-AFDVAVHVGTLIAVVIYFAQGS
UPPP_BIFAA      ------FQAIFLGLVQALTEYLPVSSSAHIRIIGDLM---LGSDPGA-AFTAIIQIGTELAVILLFGKEG
UPPP_BAUCH      --------ALILGIVEGLTEFLPVSSTGHMILVSYMLGFNNDK---TKIFEVLIQLGSILAVIII-----
UPPP_ANOFW      -------KALILGLVEGATEFAPVSSTGHMIIVDDMW---LKSSEFLNTFKVVIQLGSVLAAVLLYLRKG
UPPP1_BACCZ     ----------------------------------------------------------------------
UPPP_STRS7      -------KAIFFGVIEGVTEWLPISSTGHLILVQEFIRLH-QDKAFMEMFNIVIQLGAIIAVIVIY----
UPPP_STREM      -------KAIFFGVIEGVTEWLPISSTGHLILVQEFIRLH-QDKAFMEMFNIVIQLGAIIAVIVIY----
UPPP_STRE4      -------KAIFFGVIEGVTEWLPISSTGHLILVQEFIRLH-QDKAFMEMFNIVIQLGAIIAVIVIY----
UPPP_STAHJ      -------KGLILGIVEGLTEFAPVSSTGHMILVDDMWLKSTE---FLGTFKVVIQLGSVFAAAWVFRERY
UPPP_PSEPW      ----TAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAMAFNXXXXXXXXXXVVILDVVFGLKS
UPPP_PROMP      ----------------------------------------------------------------------
UPPP_NOCFA      ----------------------------------------------------------------------
UPPP_METMP      -------EELILGIVQGLTEFLPISSSGHLAIFTALFNSTPDVGYFLATFLAVLIFAEVFEIITGITKKE
UPPP2_BURXL     ---------IFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTAFALLWYFGGRR
UPPP2_BURTA     ---MSLWFLVFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHPQLLPFLVALHLGTAFALLWYFNGRK
UPPP_SYMTH      ---VTVLQAVILGIVQGLAEFLPISSSAHLILVPWFLGW----SPSGLAFDLALHVGTLIAVTIYFWRDL
UPPP_METM7      -------EELILGIVQGLTEFLPISSSGHLAIFTAIFNSTPDVGYFLATFLAVLIFSEVFEIINGISKKD
UPPP_SHELP      ------FQVIVLALIQGLTEFLPISSSAHLILPAQLLGW---QDQGL-TFDVAVNTGSLLAVVIYFRREL
UPPP_METM6      -------EELILGVVQGLTEFLPISSSGHLAIFTAIFNATPDVGYFLATFLAVLIFSEVFEIVNGISKKD
UPPP_BACFN      ------FEALILGLIQGLTEYLPVSSSGHLAIGSALFGIEGEEN---LAFTIVVHVATVFSTLVLFKFEM
UPPP_VIBF1      ------FEAFFLALLQGFTEFLPISSSAHLILPSAILGW---SDQGL-AFDVAVHVGTLAAVVIYFRKEV
UPPP_MYCLE      ---MSWWQVIVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAG----ASFTAVSQLGTEVAVLVYFGRDI
UPPP_MYCLB      ---MSWWQVIVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAG----ASFTAVSQLGTEVAVLVYFGRDI
UPPP_MYCGI      ----------------------------------------------------------------------
UPPP_LEPBP      ----------------------------------------------------------------------
UPPP_LEPBA      ----------------------------------------------------------------------
UPPP_CHLT3      -------QAIVLGIIQGLTEFLPISSSAHLRIFPALLGW---DDPGA-AFTAIIQIGTLAAVLIYFYQDI
UPPP_SYNP6      --RLDLWQAIVLGFVQGATEFLPISSTAHLKVVPVVLGW---GDPGV-AFTAVIQLGSIVAVL-------
UPPP_SYNE7      --RLDLWQAIVLGFVQGATEFLPISSTAHLKVVPVVLGW---GDPGV-AFTAVIQLGSIVAVL-------
UPPP_CAMC1      ---------IVLALVQGISEFLPISSSAHLILVPKLLGWPDQG----LAFDVAVHVGTLSAILFYFKDTI
UPPP_BACFR      ------FEALILGLIQGLTEYLPVSSSGHLAIGSALFGIEGEEN---LAFTIVVHVATVFSTLVLFKFEM
UPPP_METM5      -------EELILGIVQGLTEFLPISSSGHLAIFTAIFNSTPDVGYFLATFLAVLIFSEVFEIVNGISKKD
UPPP_SHEFN      ---METFQVILLALIQGLTEFLPISSSAHLILPSQILGWADQG----LSFDVAVNTGSLFAVVIYFSKQQ
UPPP_GLUDA      -------QAIVIAILQGATELFPVSSLGHAVIVPALLGWAFDHGEIFLPFLVMLHLGTAIALLVYFSQRQ
UPPP_GLOVI      --QIGIFEAIVLGFVQGITEYFPISSTAHLRVVPALLGWA---DPGT-AYSAVIQLGSLLAVLTYFGDTQ
UPPP_MYCS2      -------QVIVLSIVQGLTEFLPVSSSGHLAITSQVFF----DDDAGASFTAVTQLGTEFAVLIYFAKDI
UPPP_ALISL      ------FEAFFLALLQGFTEFLPISSSAHLILPSEVLGW---SDQGL-AFDVAVHVGTLAAVVMYFRKEV
UPPP_GEOSL      ----------------------------------------------------------------------
UPPP_CORDI      ----------------------------------------------------------------------
UPPP_FERNB      -----------LGIIQGLTEFLPVSSSGHLALFSKIISFP--SDLALFAFFHIATFFAVFILLILYGLVR
UPPP_BIFLI      ------FQAIILGIVQALTEYLPVSSSAHIRIFGDLM---LGSDPGA-AFTAIIQIGTELAVILLFGRNG
UPPP2_CLOAB     ---------------------------------------------YIHMFEIIIQLGAILAIVVLYGYNT
UPPP_PROM0      ----------------------------------------------------------------------
UPPP_ANAD2      ---MSLVSAALFGLLQALTEFLPVSSTAHLLVFGELLGHSLDDRRF-RAFVTIIQAGTTLAVLVYFXXXX
UPPP_MYCPA      ----------------------------------------------------------------------
UPPP_MYCA1      ----------------------------------------------------------------------
UPPP_MAGSM      ----------------------------------------------------------------------
UPPP_MYCSS      ----------------------------------------------------------------------
UPPP_MYCSK      ----------------------------------------------------------------------
UPPP_MYCSJ      ----------------------------------------------------------------------
UPPP_KINRD      -------EGAFLGLVQGLTEFLPISSSGHLAVVGTL----LGSDPGA-AFTAICQLGTEAAVISLVGRLP
UPPP_BACTN      -------EAMILGLIQGLTEYLPVSSSGHLAIGSALFGIQGEEN---LAFTIVVHVATVCSTLVLFKFQM
UPPP2_BACHD     ----------------------------------------------------------------------
UPPP2_ACIAD     ----------ILAVIQGLAELLPVSSSAHVILAEKLMGFDPSA-PNMTFLLVMLHTGTMFAVIVYYFFDW
UPPP_SYNPW      ----------------------------------------------------------------------
UPPP_PELTS      ---MTVFQALVLGIIQGLGEFLPISSSAHLVLVPWLFGWQYAG----LTFDVALHLGTLISIIVLIGSAL
UPPP_GLUOX      -------QALILAIVQGITEPFPVSSLGHAVLLPALLHWDLDEHPMFLPFLTMLHVGTLVALAGVFSYRQ
UPPP_ELUMP      ----------------------------------------------------------------------
UPPP_DESAA      ----------------------------------------------------------------------
UPPP_ANADE      ---MSLVSAALFGLVQALTEFLPVSSTAHLLVFGELLGHSLDDRRF-RAFVTIIQAGTTLAVLIYFRADI
UPPP_VESOH      ----------------------------------------------------------------------
UPPP_PROM5      ----------------------------------------------------------------------
UPPP_PROM2      ---------ILYGLIQGLTEFLPISSTAHLKIISIFLGI---DDPG-SSLSATIQLGSVLAIVILYYFLH
UPPP_BUCAT      ------------------TEFLPISSTGHMIIASHWLKIDNENTKILEIF---IEFGSALSILLKFNINV
UPPP_BUCAI      ------------------TEFLPISSTGHMIIASHWLKIDNENTKILEIF---IEFGSALSILLKFNINV
UPPP_BUCA5      ------------------TEFLPISSTGHMIIASHWLKIDNENTKILEIF---IEFGSALSILLKFNINV
UPPP_BIFLO      ----------------------------------------------------------------------
UPPP_BIFLD      ----------------------------------------------------------------------
UPPP_SYNS3      ----ACWRDFVLGVVQGLTEFLPISSTAHLKVVPVLAGW---GDPGLSVTAV-IQLGSIVAVIAYF----
UPPP_METST      ----------------------------------------------------------------------
UPPP_HALHL      ---MALWIAVLLGVVQGIFMFLPVSSTAHMVLLEHWLIGPAPESAEMILFNLVVHVGTLVSIVVVFGPPL
UPPP_ANASK      ---MSLVSAALFGLLQALTEFLPVSSTAHLLVFGELLGHSLDDRRF-RAFVTIIQAGTTLAVLVYFRADI
UPPP_STAS1      ----------------------------------------------------------------------
UPPP_SALRD      ------WEALLLGLIQGLTEFIPVSSSGHLVLGQYLLG--LDKEAADVTFEVFVHFGTVLSILTVYRFAE
UPPP_PROMS      ----------------------------------------------------------------------
UPPP_ERYLH      ----------------------------------------------------------------------
UPPP_DESAH      ------YQGVVLGVLQGLTEFLPVSSSGHLVLGQNFFGIT---EPAL-SFDISVHLGTLFAVALVFFKEI
UPPP_BIFA0      ----------------------------------------------------------------------
UPPP_METS3      ----------------------------------------------------------------------
UPPP_METKA      MREIELWTAVLAGVVQGITEWLPISEGQATMTMMKVLGIPPSTAMDLALWLHA---GTLLAVLLRFGLMG
UPPP_BUCAP      ----------------------------------------------------------------------
UPPP_ALHEH      ----------------------------------------------------------------------
UPPP_SYNS9      ---LSLLEALVLGIVQGLTEFLPISSTAHLRVVPALLGW---DDPGV-SVTAAIQLGSVAAVIAYF----
UPPP_PROMM      ----ACWRNLVLGVVQGLTEFLPISSTAHLKVVPMLVGW---GDPGVSATAV-IQLGSILAVIAYF----
UPPP_HYPNA      ----------------------------------------------------------------------
UPPP_THEAB      ---------IVLGLIQGLTEFLPISSSGHLTLFSYLFNIEPNISNF--AFLHLATLAAIIVVEILKGLFT
UPPP_SYNAS      --KIAVWEAAILGVVEGITEYLPISSTGHLILASHALGMTMVKNDAMDSYNIVIQLGAILAVLGLY----
UPPP_IDILO      ----------------------------------------------------------------------
UPPP_BORGA      ----------------------------------------------------------------------
UPPP_KOSOT      ----------------------------------------------------------------------
UPPP2_BACSK     ---MDVWEAAILGLVEGLTEYAPVSSTGHMI---------IVDDLWLKSFKIVIQLGSILAVALLF----
UPPP_TREDE      ----------------------------------------------------------------------
UPPP_MARMM      ----------------------------------------------------------------------
UPPP_THERP      ---MNVWQAAVLGIVQGTTEFLPISSSAHLIVLPWLFDWP---EPGL-AFNVALHLGTLSAVLAYFWRDL
UPPP_BORBZ      ----------------------------------------------------------------------
UPPP_BORBU      ----------------------------------------------------------------------
UPPP_BORAP      ----------------------------------------------------------------------
UPPP_THEM4      ---------IILGIVQGLTEFLPISSSGHLSVFSKLFNLK----PDLSVFAL-LHLATLAAIVIFVGKEL
UPPP_SYNPX      ----ACWRDLVLGIVQGLTEFLPISSTAHLKVVPVLLDW---GDPGV-SVTAAIQLGSIVAVIAYF----
UPPP_GRABC      ----------------------------------------------------------------------
UPPP_DINSH      ----------------------------------------------------------------------
UPPP_CAMC5      ---------IVLSLVQGITEFLPISSSAHLVLVPKLLGWPDQG----LAFDVAVHIGTLTAIVFYFKDSI
UPPP_SYNY3      ---INLFQAFVLGFIQGATEFLPISSTAHLKAVPMALGWG---DPGV-AFTAVIQLGSIGAVFIIKAVQT
UPPP_PROM9      ----------------------------------------------------------------------
UPPP_ANASP      -------QAIVLGFVQGMTEFLPISSTAHLKVVPVALGWG---DPGV-AFTAIIQLGSIAAVLIIKGATR
UPPP_NITOC      ----------------------------------------------------------------------
UPPP_KORCO      ----------------------------------------------------------------------
UPPP_SILST      -------QLILVALIQGVTEFLPVSSSGHLILLPRLTGLEDQG----QAIDVAVHVGTLAAVVLFFGRLD
UPPP_PELCD      ----------------------------------------------------------------------
UPPP_ACICJ      --------AVLFAILQGATELFPVSSLGHVVIVPALLHWPIDQSPSFLPFVVMLHVGTATALLLYFWREW
UPPP_TRIEI      --QLTIFQAVILGMVQGVTECIPVSSTAHLKIIPVALGWG---DPGV-AFTAVIQLGSIVSIVWYYKSII
UPPP_THEMA      ---------LLLGIVQGLTEFLPIXXXXXXXXXXXXXKTD------LNAYQTAVHLGTLVSVVLFAXXXX
UPPP_THESQ      ---------LLLGIIQGLTEFLPVXXXXXXXXXXXXXKTD------LNAYQTAVHLGTLVSVVLFAXXXX
UPPP_THEP1      ---------LLLGIIQGLTEFLPVXXXXXXXXXXXXXKTD------LNAYQTAVHLGTLVSVVLFAXXXX
UPPP1_BACSK     ---MSLLEAVILGLVQGITEFLPISSSAHLILVQALFGMTFAGF----SFEILLHLASVLAVILYYRHDL
UPPP_TROW8      -------EAVLLGIVQGITEFLPISSTAHMYILAKLLNLHVPG----RFFLSSVQLGTSFALILYF----
UPPP_TROWT      -------EAVLLGIVQGITEFLPISSTAHMYILAKLLNLHVPG----RFFLSSVQLGTSFALILYF----
UPPP_GEOLS      --------AALLGLIQGATEVLPISSSGHLILIPRLLGWP---DSGL-TFDVALHFGTFLAIFVFFQPEA
UPPP_BUCBP      ----------------------------------------------------------------------
UPPP2_FRAAA     ----------------------------------------------------------------------
UPPP_ROSDO      ---MTLFHLILVAAIQGLTEFLPVSSSGHLVLLPALTGQPDQG----LAIDVAVHVGSLLAVILYFGKVD
UPPP_RHOBA      ---------VILAIVQGIAEFLPISSSGHLVILGSMLGE-LGESVTLEIILHAGTLGSILVVFWQIWALL
UPPP_PELUB      ----------------------------------------------------------------------
UPPP_PROMA      ----------------------------------------------------------------------
UPPP_METTH      ----------------------------------------------------------------------
UPPP1_MAGSA     ----------------------------------------------------------------------
UPPP_JANSC      ---MSLFTLFLLALVQGITEFLPISSSGHLILLPNLLG--IEDQG--QAIDVAVHVGTLGAVILYFGRID
UPPP2_RHILO     ----------------------------------------------------------------------
UPPP2_CHRVO     ----------------------------------------------------------------------
UPPP_SULIM      ----------------------------------------------------------------------
UPPP_SULIK      ----------------------------------------------------------------------
UPPP_SILPO      ---MSLFHLILVALIQGITEFLPVSSSGHLILLPALTGLEDQG----QVIDVAVHVGTLGAVVLYFGRLD
UPPP_BORRA      ----------------------------------------------------------------------
UPPP_BORDL      ----------------------------------------------------------------------
UPPP_BORHD      ----------------------------------------------------------------------
UPPP_PROMT      ----------------------------------------------------------------------
UPPP_PROM1      ----------------------------------------------------------------------
UPPP_SULSO      ----------------------------------------------------------------------
UPPP1_BACLD     ----------------------------------------------------------------------
UPPP_ACAM1      ----------------------------------------------------------------------
UPPP_METTP      ----------------------------------------------------------------------
UPPP_HALMA      ----------------------------------------------------------------------
UPPP_CHLCH      ---MSLFEALILGIVQGLTEFLPISSTAHLRIIPALAGW---NDPG-AAFTAIVQMGTLAAVLIYF----
UPPP2_OENOB     ----------------------------------------------------------------------
UPPP3_BACAN     ----------------------------------------------------------------------
UPPP_SYNSC      ----ACWRDLVLGVVQGLTEFLPISSTAHLKVVPELLGW---GDPGV-SVTAAIQLGSIAAVIAYF----
UPPP_ANAVT      ----------------------------------------------------------------------
UPPP2_BACHK     ----------------------------------------------------------------------
UPPP2_BACCZ     ----------------------------------------------------------------------
UPPP2_BACAH     ----------------------------------------------------------------------
UPPP1_BACCR     ----------------------------------------------------------------------
UPPP1_BACC1     ----------------------------------------------------------------------
UPPP_OCEIH      ----------------------------------------------------------------------
UPPP1_BACHD     ----------------------------------------------------------------------
UPPP_PELLD      ----------------------------------------------------------------------
UPPP1_FRASC     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXVAFVPTGVIGFFFYPLIKGVILGNDXXXXXXXXXXXXXXXXXDRLAERAQYQDVKALPL
UPPP_THET2      XXXXXXXXXXXVAFVPTGVIGFFFYPLIKGVILGNDXXXXXXXXXXXXXXXXXDRLAERAQYQDVKALPL
UPPP_THET8      XXXXXXXXXXXVAFVPTGVIGFLFYPLIKGVILGNDXXXXXXXXXXXXXXXXXDRLAERAQYQDVKALPL
UPPP_AQUAE      IRDYEIWKRIIAAFIPTGIIGFLLYKLIKGFLIGNDXXXXXXXXXXXXXXXFADTYCEKFCYLDVRELPL
UPPP_WOLSU      FSGVDIWLKLAVAFIPTGALGFLLYKHVKALFAPSTVAYALILGGIVFLVLEWLHKDKEYKINSVESIGY
UPPP_PERMH      THSIDLWKRLIIAFIPTGILGFLLYKIIKGLFSPYIVSIMLIVGGLVFIAVEFFYKKSEHQIDDILKIPY
UPPP_SULSY      FLDTNLMKRILIAFIPTGILGFVLYKIIKSLFNPYXXXXXXXXXXXXXXXXXXYHKNKSYDINSIYEVPY
UPPP_CAMJD      FQGLDIWLKLSVGFFPTGVIGFFVAKYLNALFNGWVVVGMLIFGGVMFILIEFAHKNKQYRINSLEEISF
UPPP_CAMJR      FQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAHKNKQYRINSLEEISF
UPPP_CAMJJ      FQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAHKNKQYRINSLEEISF
UPPP_CAMJE      FQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAHKNKQYRINSLEEISF
UPPP_CAMJ8      FQGLDIWLKLAAGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAHKNKQYRINSLEEISF
UPPP_OCHA4      LKILTDFPRDAVAFLPAAVIGALAHGFIKSVLFETPMLVCIMLIIGGFILLWVDQLNLRPRYHDVMDYPL
UPPP_SPHWW      PAAIRFTRNVLVGFLPSAVIGAVAYGAIKAM-LNTPXXXXXXXXXXXXXXXXXERLVRSPTCDSVEGMSL
UPPP_PHEZH      WSVATHLHTDPLAFLPAGFAGFLLHDYIKAVLFETPAVICVSLILGGFALLAVDRIQREPVYTDAGAFPL
UPPP_RHOPS      WRIALGMFSDPVAFLPAAMIGAVAGSYIK-LYLFNPWVVCFSLIVGGAILLWVDQLDLNPQQHDATAFPL
UPPP_CAMHC      KRDKQLWIKLIIGFLPTAAIGYLLYSHIKSLFSQNVVVYMLIIWGVIFIVVELLRKKNPPENETLDGISY
UPPP_BRUSU      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUSI      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUO2      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUME      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUMB      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUC2      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUAB      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUA2      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_BRUA1      ARIATDFPRDAVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHNVMDYPL
UPPP_MESSB      WKMLIELPHEPIAFLPAAIIGVVAYQIIKTVLFETPLLICTMLILGGIVLLWVDRWAKKPLYRDITQFPL
UPPP_NAUPA      FKEINLWKKVLIAFMPLAVIGFLLRHQIKALFTIQTVAWMXXXXXXXXXXXEKIYSEEKVKIRDVEKVSL
UPPP_CAMFF      KEDFNLWIKLAIGFVPTAIIGFLAYKHIKTFF--EPSTVAYMLIIGGIVFIVVELWHKKINYEDTKTLHE
UPPP_NOVAD      WAVGMGLLRLEAAFIPSAILGLALKKYID-VLLGSPSVVCWXXXXXXXXXXVIEKHAKQGEPSGIGQLPL
UPPP_BDEBA      LPHWGFYRKLFVAFLPTAIIGFVVKDVVEH-LMGSVQVVAWSLIIGGVILIWADKAFAHLTMMGRKTLTY
UPPP_THICR      SLQHLRLWNNVIAFLPIAIIGFIFQDTVKAFFTIETVAWXXXXXXXXXXXMEKLYVDGKHRTQDIEDLTM
UPPP_BRAJA      WDVVIGFFTGDVAFLPAVVVGLVAGKYIKSVLF-NPWVVCFTLIVGGAILLWVDKLDLKPREHDATRFPL
UPPP_NITWN      WRVALGMFSNPAAFLPAVIVGLIAGKYIKELLF-NPWVVCFSLIVGGAVLMWVDQLDHRPREHDATAFPL
UPPP_NITHX      WRIALGMFSNDAAFLPAVVVGLIAGKYIKELLF-NPWVVCFSLIVGGAVLMWVDQLDHKPHEHDATAFPL
UPPP_META3      YNNLELWKKIIISFIPVGIMGLLFHKIVYQLFTVQIVATAFIVGGIIFLIVEKYYKEKEHNIKDLKDISY
UPPP_POLSJ      RDTLVALPTEKVAFVPAVVLGLLFGKAIQAHLF-TPVVVASTFVIGGFIILWAEKRQERARIHEVEAMTV
UPPP_DECAR      PAAQKFILNLFVAFLPLAILGLAFGRAIKAHLF-NPVTVASTFILGAFVILWAERREHKIRIQTVDEMSM
UPPP_CAUCR      TLPTEPGSRRFVAFLPAVFVGVAAHDFIKTVLYETPALVCSTLIIGGFILLALDRMKLEPRYTDVAEYPL
UPPP_CAUCN      TLPTEPGSRRFVAFLPAVFVGVAAHDFIKTVLYETPALVCSTLIIGGFILLALDRMKLEPRYTDVAEYPL
UPPP_THETN      LSSLKALKPGEIAFLPAAIIGILTHHYIEEHLFSPFTVAIALIVGAIMMIVIEDIFGKKYKIDNMDKVST
UPPP3_ACIAD     IDLVQGFFSGDMAFFPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESRDFKPSTTEATKITFK
UPPP_NITMU      RHVVTDIGSRQIAFLPAAILGLLFIKTIKQYLF-HPVPVALAFIVGGLLILWAERRPHVVDVERVEDMDW
UPPP_NITEC      RRANRFVLNLCVAFLPAAILGLLFIKTIK-YYLFHPLPVAIALVTGGVLILWAERREHRIEVENVDDMNW
UPPP_DESHD      NPFTFDRGVSVVSCIPAGVIGLLWDDVFNALFYNYQTVAVMLIIFGILFIVIENNKGKRPRVNHLSQITY
UPPP_CYTH3      FKSCDFYFKLFVAFIPTAIVGLLLKKHID-TWLENVWVVASTLLVGGIVLLFVDKWFQKNETEGEEEVSY
UPPP3_BACHK     DGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTARTLDEITY
UPPP2_MAGSA     WGVATTITQPRVAFLPAAVIGATLYKYIKQM-LESPXXXXXXXXXXXXXXXXXERLVKRARIHDIEDMSP
UPPP2_BACC1     DGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTARTLDEITY
UPPP_YERPY      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPS      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPP      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPN      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPG      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPE      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPB      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERPA      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP_YERP3      FGLIGIHFGAVLAMIPAVILGLAFHDVIKALF------DPKSVMYXXXXXXXXXXXXEWLKPKNPKAVGL
UPPP2_BACCR     DGPSLNLLHIIIGMIPAGVLGVLFHSTIKEGLFG-PGPVVISLVAGGILMIVAEKFSKPSTARTLDEITY
UPPP_AZOSE      ARVAAGVGSEPAAFLPAAVLGLMFHSTIKSLLF-NPLTVATALVVGGVLILWLERRAYHPRINAVDEMRW
UPPP_AERS4      FGLIGIHFGQKLGMLPAVIIGLGIHSWIKANLFGPETVMYALVAGGILLIIA-EKFRPTVRSETLDDISY
UPPP_SERP5      FGLIGIHFGGKLAMIPAVVLGLLFHDVIKSLFAPKNVMYXXXXXXXXXXXXEWLK-PKKPSAEGLDDITY
UPPP_PSEMY      PRAQRFTFNLLLAFIPAVVFGLAFADLIEHWLF-NPITVATALIVGGIIMLWAEKREHAIQAESVDDMTW
UPPP3_BACCZ     DGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTARTLDEITY
UPPP3_BACAH     DGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTARTLDEITY
UPPP2_BACAN     DGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTARTLDEITY
UPPP_DESDG      FSGLRGWYLLALTSAPASVLGLLTHSFIKEHLFG-PVTVAWALAAGALYILAVEHKGEGTRYETLDDVSP
UPPP1_CLOAB     IPFSLNGGFYLISCIPATIVGIPFDDKIDALFYNYQTVSITLISFGILFIMIENHKGKHPRITSISEITY
UPPP_ERWT9      FGLIGIHFGEVLGMVPAVVIGLLLHDQIK--TLFNPVNVMYALVVGGVLLIAAELLKKRPKSPGVDDITY
UPPP_VEREI      RATLHALPSERIGFFPAVLLGLLFGKAIKAHLFTPVVVASTFIIGGLVILWAERRAPAATRIHTLDAMTA
UPPP_RHIE6      PENRDYAAKLIVAFLITAILGLVVKKL--GFELPETATPIAWALIIGGIWMIF------AEWAAARKAPH
UPPP_FLAJ1      FQTLDFYFKLLVAFIPAVVLGLLLSDFIDG-LLENPVTVAVSLLIGGLILLKVDEWFNNPNAAETQKITY
UPPP_THIDA      RHVVSTVHTEPASFLPAAVLGFLFYKEIKGYLF-NPIVVASALVIGGVLILWAERRKHVVSTPTVDDLGW
UPPP_RHOS4      VSVIRAAPHDPXXXXPAVVIGVLAHGFIKAVLFETPILIATMLILGGIVLLFVDRMAPEPRYDDAMDLPL
UPPP_RHOS1      VSVIRAAPHDPXXXXPAVVIGVLAHGFIKAVLFETPILIATMLILGGIVLLFVDRMAPEPRYDDAMDLPL
UPPP_RHILW      PANRDYAAKLIVAFLITAVLGL----VVKKVLHFELPETATPIAWALIIGGFWMIFAEWAA---ARKAPH
UPPP_RHIEC      PENRDYAAKLIVAFLITAILGLVVKKL--GFELPETATPIAWALIIGGIWMIF------AEWAAARRPPH
UPPP_RALEJ      DPKAQRFAINVVATVPAIVLALVFGKWIKAHLFNPITVALAFIIGGVVILLAERRDARRGMVTNPRGNAL
UPPP_PORGI      MSRFDLYWKLLIALVPAVILGFLFEDWVDRM-LGSVWVVAVVLFLGGIFMLFVDKLFASSDRGEI-TYPK
UPPP_ACIAC      RETLVALPTQPIGFLPAVVLALIFGKAIKAHLFTPVVVASTFILGGFVILWAERRAPGAVRVDSVDDMTP
UPPP_THEPX      FASLKNLKPGSIAFIPAAVIGLLTHKYIEEHLFSPFTXXXXXXXXXXXXXXXEDTFGKRYKIDNMDKVDT
UPPP_THEP3      FASLKNLKPGSIAFIPAAVIGLLTHKYIEEHLFSPFTXXXXXXXXXXXXXXXEDTFGKRYKIDNMDKVDT
UPPP_RHOFD      RDTLVALPTEKIAFVPAVVLGLLFGKAIKAVVVASTFIIGGFIILWAERRQEKNPAAVRIH--DVESMTP
UPPP1_CLOD6     NPFDSAKNIKQIAVIPSGVIGILFEDDIDRLFF-NSTVVAIALIVYGIIMIGLEKRNKRPKYKDFSQVTY
UPPP_YERE8      FGLIGIHFGKVLAMIPAVGLGLAFHDVIKSLF------NPQSVMYXXXXXXXXXXXXEWFKPKNPKATGL
UPPP_RALEH      GNVVRGLRAEPIASVPAIVLAFIFGKWIKAHLFNPISVALAFIVGGVVILLAEWRDARRGTVSHPQGNAL
UPPP_AERHH      FGLIGIHFGQKPAMLPAVIIGLAIHSWIKAHLFGPQTVMYALVAGGILLIIA-EKFRPAVRSETLDDISY
UPPP_RHOP5      WNIARGMFSDPVAFLPAAVIGAASGGLIKEYLF-NPWVVCFTLILGGGILLWVDQLELKPVHHEATEFPL
UPPP_PORG3      MSRFDLYWKLLIALVPAVILGFLFEDWVDRM-LGSVWVVAVVLFLGGIFMLFVDKLFASSDRGEI-TYPK
UPPP_PARL1      TRVLRDAPRDAVALIPAGLLGVLYHDFILEVLF-TPYVVCAALITGGIAIVVVERLHLEPRITSVEAFSM
UPPP_LACCB      NATWQLWAKVIIAVLPSAVVGLPLNSWMDEHLHTPIVVATTLIVYGILFIILENYLKNKSAHITTLAITY
UPPP_DESMR      FSGIRGLWMLFLTSLPAGLIGLVARKSIKAYLF-NPWSVALALSVGAVMIFLVEQRKTRDRYYSLDEMTP
UPPP_CAUSK      WAVVVGLPTQPIGCIPAFAAGLALHGVIKHFFENPPQXXXXXXXXXXXXXXXXDKKAPPPREMDGMALSL
UPPP2_RHORT     TDVVAGLGSDPIAFLPAVVLGLTFGKAIKAHLFSPVPVATAFIVGGLVILW-----AERRRHP-IRVREV
UPPP_RHOS5      ISVIRAAPRDPXXXXXXXXXGVMAHGFIKTVLFETPXXXXXXXXXXXXXXXFVDRMAPAPRYNDVTEVPL
UPPP1_BURXL     GSVVSGLPSRPIATIPAIVLGLLFEKTIKAALFSPVPVAFALVAGGVVILWAESRQRTRARVQNVDDLGA
UPPP_LACC3      NATWQLWAKVIIAVLPSVVVGLLHTPLVVATTL-------------IIYGVLFIILENYLKNKNAHITTL
UPPP_BRASB      ADDRRFIIGVLIAFLPAVIIGLIAGKYIKALLF-DPWVVCFSLIVGGAILLWVDQIDLKPREHDATRYPL
UPPP_RHOPT      WRIALGMFTDAVAFLPAAVIGAAFGGYIKHYLF-NPWVVCFSLIVGGAILLWVDQLDLKPRYHDATAFPL
UPPP_RHOPA      WRIALGMFTDAVAFLPAAVIGAAFGGYIKHYLF-NPWVVCFSLIVGGAILLWVDQLDLKPRYHDATAFPL
UPPP_RHOP2      PAAQRFIIGVLVAFLPAAVIGAAAGSYIK-LFLFNPWVVCFSLIVGGAVLLWVDQLDLKPRHHDATTFPV
UPPP_RALME      GTVISGLASDVVATIPAIVLALVFGKWIKAHLFNPITVATAFIIGGVVILLAEWREARRGTVSAPQGNAL
UPPP_RHIL3      PVNRDYAAKLIVAFLITAILGLVVKKL--GFELPETATPIAWALIIGGIWMIF------AEWAAARRPPH
UPPP_DEIGD      AGQARVIGHDRVGVIPAVVLGVLFGDVIKAHLFRPSVVAWALIVGGVLMWVIENRKAPPVVH-DLKQIGL
UPPP_BRASO      PDDRRFIIGVLIAFLPAVIIGLIAGKYIKALLF-DPWVVCFSLIVGGAILLWVDQIDLKPREHDATRYPL
UPPP_OLICO      WRVATHMFTDPVAFLPAVILGLIFGTFIKEVLF-NPWVVCFSLIAGGAVLLWVDQQDVNPRHHDAMAFPL
UPPP_HERAR      AAVLGGLFTERVAFLPAALLGLVFAGAIKEKLFAPVPVAIAFIVGGFVILWVERRNKQQVRVQSVDEMTL
UPPP1_BURCH     VSVVSGLPSRPIATIPAIALGLLFEKKIKAVLFSPVPVAFALVVGGAIILWAEARQRERSEVMSVDALTP
UPPP1_BURCA     VSVVSGLPSRPIATIPAIALGLLFEKKIKAVLFSPVPVAFALVVGGAIILWAEARQRERSEVMSVDALTP
UPPP_PHOLL      FGLIGIHFGEVLAMLPAVTLGLMFHDVIKSLF--NPQSVMYALVIGGVLLITAEILKPKTKAEGLDDITY
UPPP_ERWCT      FGLIGIHFGKVLAMIPAVVLGLIFHDVIKSLFYPQNVMYSLVIGGFLLLA------AEWFKPKEPRAVGL
UPPP_DESAD      WGLLFPKPGQQFSGIPASVLGLLAHDFIKQHLFNPYTVAWALGVGAIMILIVEKKETTPSCFTLDEVTPK
UPPP_NEIMB      SNVLHGLGKDRIAFIPAAVMGLLFGKQIKEYLF-NPLSVAVMLVLGGFFILWVEKRQSRAEPKDVDALRP
UPPP_NEIG2      SNVLHGVGKDRIAFIPAAVMGLLFDKQIKEYLF-NPLSVAVMLVLGGFFILWVEKRQSRAEPKDVDALRP
UPPP_NEIG1      SNVLHGVGKDRIAFIPAAVMGLLFDKQIKEYLF-NPLSVAVMLVLGGFFILWVEKRQSRAEPKDVDALRP
UPPP1_CHRVO     GGERNLLLGIVIAFIPAAVAGLLFSKQIKAVLF-NPVCVAIAFIVGGLIILWAEKREHKVAVETVDDLSL
UPPP_ZYMMO      LNIAKGLFQHSTSFIPTVIVGAIAYHAVKA-LLEKPMVVAIALFVGGIAMLIIDRESSHPENTSVQSIPA
UPPP_NEIMF      SNVLHGVGKDRIAFIPAAVMGLLFGKQIKEYLF-NPLSVAVMLVLGGFFILWVEKRQSRAEPKDVDALRP
UPPP_NEIMA      SNVLHGVGKDRIAFIPAAVMGLLFGKQIKEYLF-NPLSVAVMLVLGGFFILWVEKRQSRAEPKDVDALRP
UPPP_POLNS      IKVTSSFASSPIASIPAMGLGFLFGKHIKAVLFSPIPVASAFIVGTLIIFWAERRLVDVSSYDDLRPLDA
UPPP_PECCP      FGLIGIHFGEVLAMIPAVVLGLVFHDVIKSLFYPQNVMYXXXXXXXXXXXXEWLK-PKKPRAVGLDDITH
UPPP_JANMA      AAVLGGLLTERIAFLPAALLGLVFASKIKEKLFAPVPVAIAFIVGGFIILWIEKRNRNTARVETVDDMTM
UPPP_XANC5      RANRDYVLKVGVAFLVTAVVGLILQPVAWALLIGG------------VWMLVAEHFAGKLPERDVVTWKV
UPPP_XANAC      RANRDYVLKVGVAFLVTAVVGLILQPVAWALLIGG------------VWMLVAEHFAGKLPERDVVTWKV
UPPP_METPP      RATVAGITHEAVAFVPAVISGLALGGLIKEHLFHPVPVATAFVVGGLIILWVERRHRALFGDRDLEGGRV
UPPP_METFK      NTSQRFILNLFVAFLPAAIFGLLLHGFIKEHLFSSITVACALIVGGFAILLVENLYAHAAKASNLNEITP
UPPP_GEOKA      XXXXLNLIHVIIGLLPAGVLGVLFEDYIDEHLFSTKTVLIGLVLGALLMIAADKFAKKAARTQTVDQITY
UPPP_BURMS      REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP_BURMA      REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP_BURM9      REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP_BURM7      REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP2_BURPS     REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP2_BURP1     REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP2_BURP0     REARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERARVQSIDALTP
UPPP_XANOR      RDNRDYVLKVSVAFLVTAVVGLILQPVAWALLIGG------------VWMLVAEHVAGKLPERDVVTWKV
UPPP_XANOP      RDNRDYVLKVSVAFLVTAVVGLILQPVAWALLIGG------------VWMLVAEHVAGKLPERDVVTWKV
UPPP_XANOM      RDNRDYVLKVSVAFLVTAVVGLILQPVAWALLIGG------------VWMLVAEHVAGKLPERDVVTWKV
UPPP_DESVV      XXXXXXXXXXXXXAAHSTIKAHLFTPSTVAIALA----------VGAIFMLLVERRTERPRYMTLDEMSP
UPPP_DESVH      XXXXXXXXXXXXXAAHSTIKAHLFTPSTVAIALA----------VGAIFMLLVERRTERPRYMTLDEMSP
UPPP1_RHILO     -----------IAFLPAAIIGALAHDFIKTVLFESPRLICTMLIIGGVILLAVDRMNLKPVYRDVERFPT
UPPP_SODGM      FGLIGIHFGQVLGMIPAVVLGLVFHEQIKAIFIYVMYXXXXXXXXXXXXEWLKPKVPRAAGIDDLTYL--
UPPP_NITEU      RQANRFVINLFIAFLPAAILGLLFIKTIKHYLF-HPMPVAIALVTGGILILWAERREHRIEAETVDDMSW
UPPP_NEIM0      SNVLHGVGKDRIAFIPAAVMGLLFGKQIKEHLFNPLSVAVMLVLGGLFILWVEKRQSAEPKIADVDALRP
UPPP_CELJU      GIERNLFINVAIAFFPAALVGFLFSDFIRTVLF-SPYXXXXXXXXXXXXXMWVEKYAYAPRLDDMDRISY
UPPP3_FRASC     HPDYRFGWAVILGSIPIGLVGVAFKDQIETTLVGGALILWSGVMGYADHVGTQKRHEEDVTWKDTLV---
UPPP_SULNB      TFKKIDLWMKLLAFLPLAIVGFIFKDQVKALFNVQVVAWMFIIGGIIFLIVEYYYKEQAWHVKDVEKVSW
UPPP1_FRAAA     NHDYTFTWWVIYATIPVVLVGLAAKPLIDGPXXXXXXXXXXXXXXXXXMWFA-DQYGRHKRGEDDLSLPD
UPPP_LAWIP      FTGLYGIWLLFLTTLPPGIIGFLFHSYIK--TLFTIPSVIAALTTGSIFMLISEQLCRNISQRIVTLDEL
UPPP_ACIBT      INLIKGFFSGDVAFFPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESKQFEH-KTDDATKITF
UPPP_ACIBS      INLIKGFFSGDVAFFPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESKQFEH-KTDDATKITF
UPPP_ACIBC      INLIKGFFSGDVAFFPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESKQFEH-KTDDATKITF
UPPP_ACIBY      INLIKGFFSGDVAFSPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESKQFEH-KTDDATKITF
UPPP_ACIB5      INLIKGFFSGDVAFSPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESKQFEH-KTDDATKITF
UPPP_ACIB3      INLIKGFFSGDVAFSPAVIIGVLAVDFIKSVLFSPXXXXXXXXXXXXXXFWVESKQFEH-KTDDATKITF
UPPP1_BURCM     VSIVTGLPSRPIATIPAIALGLLFEKKIKAVLFSPAFALVVGGAIILWXXXXXXXXXXXXXVQSIDALTP
UPPP_XANCP      RANRDYVLKIGVAFLVTAVVGLIIQPVAWALLIGG------------VWMLVAEHFAGKLPERDVVTWKV
UPPP_XANC8      RANRDYVLKIGVAFLVTAVVGLIIQPVAWALLIGG------------VWMLVAEHFAGKLPERDVVTWKV
UPPP_CLOTH      FPFSFEDRIQIAATLPAALIGVPFDDKIDELFYNYITVAITLIVYGVLFIIMENRNKSKIPISTFEELGY
UPPP_CLOPH      KDTFTLWFKIVVACIP-GIVMIPFDSKIEDLFFNPQTIATTLILYGILFIIIENRNAKQPKVAKLSDITY
UPPP_XYLFT      YSNRDYVMKLATAFLITAVVGLAVRKALPETIQPXXXXXXXXXXXXXXAESVAKHLPERENVTWSVAIA-
UPPP_XYLFA      YSNRDYVMKLATAFLITAVVGLAVRKALPETIQPXXXXXXXXXXXXXXAESVAKHLPERENVTWSVAIA-
UPPP2_SHEON     INLINGVLKSDISFLPSAIIGALFIHDIKNVLFNTTVVATALIVGGLIILWVENRKSEKFKIENIEKIGF
UPPP2_ENTFA     KDTFSLWFKVAVACVPSAIMGILFDDYLDAHLHTPVVIAIMLILYGVLFIVIENRNKKRTATTSTLAISY
UPPP_RHOPB      PAAQRFVIGVLVAFLPAAVIGALAGGYIKSYLF-NPWVVCFSLIVGGAILLWVDQLDLQPTQDEATAFPL
UPPP_ACIBL      TALTHPLTLTIIAFLCTAIPAFLFTKIIGKHLESVIIMGSALLIGGIVMWIVDVMFADKGATDDMDKMSV
UPPP_SULDN      IKKIDLWMKVFIAFLPLAIIGFIFSTQIKELFSLHXXXXXXXXXXXXXLIVEKFFINEDEKIYEVEAISL
UPPP_METI4      SSFLFLWKDREVAFIITSILGLWVKKM--GWELPKDLGPVIIAIFGGAFWIYFTEKVSSQRQSFVEEISW
UPPP1_ACIAD     WGAATGMVTGEXXXXXXXXXGLSFGQTVKDLLF-NDXXXXXXXXXXXXXXMWIEKNPPKVNAVEVENIGL
UPPP_METCA      SRQARRFVLNLIAFLPAGIVGFLAGKAIKAHLF-NSTTVTTTFILGGLIILWVERRQRPPRVESIDDVDW
UPPP1_STRCO     MRIVSAWGRGLYATIPIVLVGLAAKPLIKGP-LASLWVVAGSLIVGSGVMWWADRTGRHKRGEDDTSFKD
UPPP1_BURS3     ASIVSGLPSRPIATIPAIALGLLFEKKIKAVLFSPVPVAFALVVGGAIILWXXXXXXXXXXXXXVMSVPL
UPPP_LACPL      RNTWVLWSKVLLAVIPSVIVGLPLNDWMDEHLMNVSATLIIYGVLFIVIENHNKRLTPR--FANLQTLPY
UPPP_GEOTN      LELLGIRGRHPIGLLPAGVLGVLFEDYIKTVLIG--------LVLGALLMIVADRFAKKARAQTVDQITY
UPPP_STRTD      QLTWQLWLKVVIACIPSAFFGLFFVVAIMLVVYGIAFIW----------------IEDRNRRVEPKVTDL
UPPP_STRT2      QLTWKLWLKVVIACIPSAFFGLFFVVAIMLVVYGIAFIW----------------IEDRNRRVDPKVTDL
UPPP_POLNA      RSTLIALPNEKVAFVPAVVLGLLFGKAIKAVVVAS--AFIVGGFIILWAEKRQQRNPATIRIHDVESMST
UPPP_LACF3      SQTWTLWKKVIIAVIPSVIIGLPLNDWMDAHLMNWLVVSIALIVYGVLFIVIENHNQNRPRFDSLNTLPY
UPPP_PSYA2      SNPRQLGLSLIVATIPVMIVGFTFADEIKAYLFDPIVVAIMLIIGGLLIFYVENR-PKPIIAQEAEDVGL
UPPP_LACDB      GQTWQIWFKVIAAVLPSIIIGLPLNDWLEENMTSWQVISATLIIYGILFIVLENYYAKRQSLTDLNKMSN
UPPP_LACDA      GQTWQIWFKVIAAVLPSIIIGLPLNDWLEENMTSWQVISATLIIYGILFIVLENYYAKRQSLTDLNKMSN
UPPP_SPHAL      WGVGMGLLRADVAFTRNILIGFLPAMLVGAVLLESPATVAVALLVGGIAILAIERMVKVVKVESVEAMPL
UPPP2_PSEHT     PKHLNLWIKVAIAFIPLGIIAFIFSDVIKALFNXXXXXXXXXXXXXXXLLLERNYKEQNCTTTDVTQVTY
UPPP_PSYWF      WHALMGLITGKVATIPVMLVGFTLADQIKEYLF-NPYTVAIMLILGGLLIFYVERKQIPVIAEEAEDVSL
UPPP1_ENTFA     KDTWILWSKVLVACLPAAVIGLKFDDYLDAHFYNFLTVSIMLIVYGIAFIIIEKRNKNVAKCTNLKDFTY
UPPP_SINMW      -----------------------------------------------------DRLPLTPRYTDVFDYPP
UPPP_STRGC      NPFKPDKTPRQVQKLWAKVVVASLPAVIIGIPLDNNFHNFVSVAIMLIIYGIAFILIERRNQENLEKLPY
UPPP_SHISS      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_FLAPJ      FQTLDFYFKLLVAFIPAVVLGLLFSKKI-DALLESPVTVAVSLLVGGIILLKVDDWFNNSSETEITYLKA
UPPP1_AGRT5     -----------------------------------------------------DRMPLKPKYTDIMDYPP
UPPP_VARPS      HSTVVALPRQAIGFLPAVVLGLLFGKMIKAHLFIPVVVASTFIIGGFIILWAEKRPPGSVRIEHVDDMTM
UPPP_PSYCK      SNPRQLGLSLIVATIPVMIVGFTFADEIKAYLF-NPIVVAIMLIIGGLLIFYVENRPKAIIAEEAEDVSL
UPPP_LACSS      KQTWTLWFKVILAVIPSVIIGFPLNDWMDEHLMQNWVVASMLILYGILFIVIENRNKQRTKFADLNTLPW
UPPP_ENTS8      FGLIGIHFGHPLGMVPAVVLGLVFHDFIKSLFNPINVMYALVVGGVLLI------IAEVLKPKEPKAMTY
UPPP_STRT1      QLTWKLWLKVVIACIPSAFFGLFFVVAIMLVVYGIAFIW----------------IEDRNRRVDPKVTDL
UPPP_RHISN      -----------------------------------------------------DRLPLQPRYTDVFDYPP
UPPP_ENT38      FGLIGIHFGRPLGMVPAVVLGLIFHDAIKSLFNPINVMYALVVGGVLLIA------AELLKPKEPKAPGL
UPPP_FUSNN      SPFVKTKKEFVLKFLPAMVIGLLLDDIIDKYFLDNVLIVAITLIAYGVIFIGIEVVYKKPKVKRFAGLKY
UPPP_ESCF3      FGLIGIHFGRPLGMIPAVVLGLLFHDAIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOLI      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOLC      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOHS      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECODH      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOBW      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO7I      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO5E      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO57      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SHIFL      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SHIF8      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SHIBS      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SHIB3      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_RHIME      -----------------------------------------------------DRLPLTPRYTDVFDYPP
UPPP_ECOUT      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOSE      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOLU      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOL6      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOL5      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECOK1      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO8A      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO81      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO55      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO45      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO27      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_ECO24      FGLIGIHFGRPLGMIPAVVLGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP2_STRCO     DPDARMGWLVIVGSIPIGVLGLTLKDQIEGPFR-DLRITATMLIVVGVIIGIADRMAARDEKGGRHRAPQ
UPPP_SHEWM      SDDSKLAWWIILATLPAVILGFALKDMIE-VYLRGPGVIAITTVLFGLLLWWADRMSELTEYQT----GW
UPPP_MACCJ      EGPRLNLLHIFIGLIPAGIMGLLFDDFIDKHLFSVPTVXXXXXXXXXXXXXXXXFNKKVTHTTTVDEMTY
UPPP_DEIDV      LKIRHLGHDRSVATIPAVVLGLAFGDQIQAVLFKPSVVAWALIVGGVLMWLIESRRVQ-PQVHAIETIGV
UPPP1_BURTA     VDVVTGLPAQREAXXXXXXXXXXFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERSRVQSIDALTP
UPPP_SALDC      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERASGLDDMTY
UPPP_SALTY      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALTI      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALSV      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALPK      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALPC      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYTLVVGGLLLIAAECLKPKERAPGLDDMTY
UPPP_SALPA      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALNS      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALHS      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALCH      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALAR      FGLIGIHFGRPLGMIPAMVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_SALA4      FGLIGIHFGRPLGMIPAVVLGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP_PSEE4      APARRFTANLLIAFFPAVVLGVLFADLIHEYLF-NPITVAAALVVGGVIMLWAERRQHRIEVDHVDEMSW
UPPP_CITK8      FGLIGIHFGKQLGMIPAVVLGLVFHDTIKSLF--NPVNVMYAXXXXXXXXIAAECLKPKERAPGLDDMTY
UPPP1_STRAW     HHDYKFAWWVIYATIPIVIVGLAAKSLIEGP-LASLWVVAASLIVGSGVMWAADQMGRHKRGEDDTSFKD
UPPP_STRP6      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIVYGIAFIW---------------IEKRNAQQEPAVTEL
UPPP_STRPM      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIVYGIAFIW---------------IEKRNAQQEPAVTEL
UPPP_STRP8      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIVYGIAFIW---------------IEKRNAQQEPAVTEL
UPPP_STRP3      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIVYGIAFIW---------------IEKRNAQQEPAVTEL
UPPP_STRP1      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIVYGIAFIW---------------IEKRNAQQEPAVTEL
UPPP_PARDP      WRIFSSAPQDPRAXXXXXXIGVLAHRIIKEVLFETPTLIAVMLIVGGVVLLFVDRMANRPRHFSAEDFPL
UPPP_THEFY      GNILATWFRSLIGSIPIGVAGLLFEEQISGVLLG-----------------MVDRYSRK--HRELTDLNA
UPPP_GEOSW      IDLLGLRGRHRVGLIPAGVLGVLFEDYIDEHLFST-ATVLIGLVLGALLMIAADVFAKKAKAQTVDQITY
UPPP_EXIS2      FSLIGLYKIEGIGLLPAAVLGLLFEDFIDENLFSIDTVXXXXXXXXXXXXXXDKLGPKEPKTTSLDQISY
UPPP_ALKOO      RETMRIWYKVVVGIIPAGVMGLLFDDWLNEHLYNYWTVAAMLIVYGVLFIIIENRNKHRAKINSFSELSY
UPPP_THISH      TPDAKLAWAVGLGTIPAGLAGLLFHDII-ATHLRSAQVIAMATIGFAVLLLFADVSGKRT--RDEHSITW
UPPP_STRM5      ----------------------------------------------------------------------
UPPP_DEIRA      LKIRHIGHDRGLACIPAVILGVLFGDTIKAYLFRPSVVAWALIVGGVLMWLLESRKATPDTH-DIENISA
UPPP_STRPF      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIV----------YGIAFIWIEKQNAQQEPAVTDLARMSY
UPPP_STRPD      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIV----------YGIAFIWIEKQNAQQEPAVTDLARMSY
UPPP_STRPC      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIV----------YGIAFIWIEKQNAQQEPAVTDLARMSY
UPPP_STRPB      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIV----------YGIAFIWIEKQNAQQEPAVTDLARMSY
UPPP2_CLOD6     KIGFRFGMNVIIGCIPFAIIGVLFYDNIKSLF--NLQSXXXXXXXXXXXXXXXETLFRKKNHSNIDKITP
UPPP_STRPZ      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIV----------YGIAFIWIEKQNAQQEPAVTDLARMSY
UPPP_STRPG      QLTWQLWLKVVIACIPSILIAYFMVPIAIALIVYGIAFIW---------------IEKRNAQQEPAVTEL
UPPP_KLEP7      FGLIGIHFGKPPAMIPAVVMGLIFHDTIKSLF--NPVNVMYALIVGGVLLIAAEVLKKQPRAVGIDDMTY
UPPP_KLEP3      FGLIGIHFGRPLGMIPAVVLGLIFHDTIKSLF--NPVNVMYALIVGGVLLIAAEVLKKQPRAVGIDDMTY
UPPP_STRMK      ----------------------------------------------------------------------
UPPP_ALTMD      STDSKLAWYVIVGTIPAVIIGF----LMKGWIEENARTALVIAGTTIIFGLLLDATAKREQ--ELEGLTL
UPPP_BORPD      WQLIRGTLTGVLAFLPAAVVGAIFIKTIKQVFYHPXXXXXXXXXXXXIMLWVERKTXERASAHTLEQISW
UPPP2_AGRT5     KADARLGWLIIVGSVPIVFLGLFFKDAIEHS-LRNLYITAVMLIVFGIVLGLADRIGE-------KRYKL
UPPP_DIAST      ----------------------------------------------------------------------
UPPP_ACISJ      ----------------------------------------------------------------------
UPPP_CHRSD      TPESRLGWAVIVGTLPAVVIGFLLENVIESYLRASLVIAITTLLFGLLLWWADVRGSRR---HALTAMTL
UPPP_BORPE      WQLIRGTLTGVLAFLPAAVIGAIFIKSIKQVFYHPGVVAVTLVVGGFIMLWVERRXXERASAHTLEQISA
UPPP_AZOSB      IKVAVGVPSDRSAXXXXXXXXXXXHSTIKNVLF-NPXXXXXXXXXXXXIILYVEKRAYHPRVTSVDEMRW
UPPP_TERTT      DESGRLGWYLIAATIPAALFGLIFDDLIETHLRSTDVIATTTLVFGVLLWVADRKPAETKQLRDI-ALST
UPPP_STRSV      NPFKPGKSARQVQXXXXXXIGLFLDDWFEAHFYNLVSVSVMLIVYGAAFIYLERREHEEPAVTDLASLPY
UPPP_STRGG      DHDAQMGWLVIVGSIPIGVLGITLKDQIEGPFR-DLRLIATTLIVMGIVLGVADRLAARDETGGKHRVVK
UPPP_BORPA      WQLIRGTLTGVLAFLPAAVIGAIFIKSIKQVFYHPGVVAVTLVVGGFIMLWVERRXXERATAHTLEQISA
UPPP_BORBR      WQLIRGTLTGVLAFLPAAVIGAIFIKSIKQVFYHPGVVAVTLVVGGFIMLWVERRXXERATAHTLEQISA
UPPP_DESDA      WGLVRPQPYARFASLPACILGLLLHAYIKEYLFRPATVLIALVVGAICMILVEKRKFKPTCISLDDMTPR
UPPP_AZOBR      WKVVTGLKDDPLAFLPAMVLGAALHGVIKAVLF-NPTVVSIALILGGVAILMAERLVPAPRYHQIERFPA
UPPP_PSEU2      QQAQRFTLNLLIAFMPAVVLGVIFADTIHHYLF-NAITVATALVIGGVIMLWAERREHTVRTETVDDMSW
UPPP_NOCSJ      WRIGRAWLLSLFKFIIVGSVPIVLLGIALKDVIEEDFRSLWXXXXXXXXXXXXXXXADRLGGTDIKQISL
UPPP_CLOTE      LNSVKDIFAPDVACIPAVIFGFSLDDYIDKYLFNPXXXXXXXXXXXXXXXXXENKYRRRSKTKNIYDMKL
UPPP_CLOPE      SSSVVEFLSYIFSFIPAAILGLLFHDEIKEYLFSTKTVAXXXXXXXXXXXXXENNFRKRAKVKDIDKMTY
UPPP_CLOP1      SSSVVEFLCYIFSFIPAAILGLLFHDEIKEYLFSTKTVAXXXXXXXXXXXXXENNFRKRAKVKDIDKMTY
UPPP_ANADF      TPQSRLAWFIVLGTVPAAVLGKLFEERIEA--LGNWVIXXXXXXXXXXXXXXERYARHLRTVEDVGARD-
UPPP_ALKMQ      FMICKEFILMIVATIPTGIIGLFFKDLFTSLIIGISLLVTGTLLWTAEKVNTGKR--------DIKDMNW
UPPP_PSE14      LDVVTGLPKQQIAFMPAVVLGVIFADTIHHYLF-NAITVATALVVGGVIMLWAERREHTVRTETVDDMTW
UPPP_CHLPB      ETQESRMGWMIAATMPIVILGLLFKTEIE-TSLRSLYWISVALIVLALMLTLAEWLMKRRADKGLKAKTM
UPPP1_PSEU5     RQAQKFTVNLLIAFMPAVVLGVAFADLIHEYLF-NPITVAAALVIGGIVMLWAERRDHAIRAETVDDMTW
UPPP_SYNWW      KPFCRLTYLLIVGCIPAGLAGFLLAPYFEKAFESLLVVGIALIFTGILLSLSENLSKKHFGLKEADETGF
UPPP_PSESM      QEAQRFTLNLLIAFMPAVVLGVIFADTIHHYLF-NAITVATALVVGGVIMLWAERRVHTVRTETVDDMTW
UPPP_DESPS      -----------LAFIPIGAIGLLFHKEIKTLFTVPMVGTMFIVGGIVFLVLEHFYQERSSHVQEVEAISY
UPPP_VIBHB      SKEAKLAWMIVIATIPACVFGLLMKDIIE-VYLRSAYVIATTTIIFGLLLWWVDRNAELVA--DEYQTGW
UPPP_STAAT      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISY
UPPP_STAAE      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISY
UPPP_STAA8      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISY
UPPP_STAA3      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISY
UPPP2_STRAW     ARIISAWFRSLVGSIPIGVLGVTLKDQIEGIVMGVILGIADRLAARDETGGKHRAAKERKKLQD---LNI
UPPP_PSEF5      PKAQRFTINLLIAFLPAVVLGVIFADLIHAYLFNPITVATALVVGGLIMLW-----AERRQHQ-VHAETV
UPPP_LEUCK      FQTWRLWIKVIVGVLPAMVFGLLLNNFMDAHLLNPWVVSATLIIYGIAFIVIENRQKNIAPVTEVNRITF
UPPP_HAHCH      SQESRLAWAVILGTIPACVAGL----LLDSWIEENLRSALVIALTTIGFGVLLGMADRKEGTRDIDQFTL
UPPP_GEOMG      SSATRLPWYIIAGCVPAAIVGKTLEEPIEAIFRANPXXXXXXXXXXXXXXXXXDTLGSKKSRMD--QIDL
UPPP_SHEPA      LSMFTAWTGSVVSRKQTDLAWWIILATIPAVIIGFSAKDFIETHFRSIEVIAATTIADKMQRQGLNEF--
UPPP_RHOSR      GRIIAGWFRGLIGTIPVGVLGFLFKDQIR--------TGARNLWLIATMLIVFALVIAAAEYYGRKVRPV
UPPP_STAAW      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQINY
UPPP_STAAS      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQINY
UPPP_STAAC      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISY
UPPP_SHESH      WSMFKAWTDSIIATIPAVIVGFTAKDFIE-TYLRNTAVIATTTIVFGLLLWWADRMFRPGFTEFQVGWKK
UPPP_SHEB9      SEDSKLAWWIILATLPAVFFGFLAKDFI-ATHLRNAEVIAVTTVVFGLLLWWADKMSRRD-------LTV
UPPP_SHEB8      SEDSKLAWWIILATLPAVFFGFLAKDFI-ATHLRNAEVIAVTTVVFGLLLWWADKMSRRD-------LTV
UPPP_SHEB5      SEDSKLAWWIILATLPAVFFGFLAKDFI-ATHLRNAEVIAVTTVVFGLLLWWADKMSRRD-------LTV
UPPP_SHEB2      SEDSKLAWWIILATLPAVFFGFLAKDFI-ATHLRNAEVIAVTTVVFGLLLWWADKMSRRD-------LTV
UPPP_LARHH      WQVAIDLPTSTIAFLPAAIVGVLLIKTIKSYLF-NPXXXXXXXXXXXXXILWAERRECTARVHRIDDMSH
UPPP_AZOVD      PQAQRFTVNLLIAFLPAVVLGVAFADLIEHWLF-NPITVASALVVGGLVMLWAERRQHVIEVHAVDEMNW
UPPP_SHESW      SDDSKLAWWIILATLPAVFFGFMAKDFIETHLRSAEVIAVTTIVFGLLLWW-----ADKMSHQD---LTV
UPPP_SHEPW      TQESKLSWWIILATIPAVIVGFTAKGFIE-TYLRNIEVIAATTIIFGLLLWWADRM-QRQGFNEFQ----
UPPP_SHEPC      SDDSKLAWWIILATLPAVFFGFMAKDFIETHLRSAEVIAVTTIVFGLLLWW-----ADKMSHQD---LTV
UPPP_DICNV      ----------------------------------------------------------------------
UPPP1_OENOB     ----------------------------------------------------------RPRVRTINHLTL
UPPP1_BACHK     ----------------------------------------------------------------------
UPPP1_BACAN     ----------------------------------------------------------------------
UPPP1_BACAH     ----------------------------------------------------------------------
UPPP_STAAN      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_STAAM      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_STAAB      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_STAA9      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_STAA2      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_STAA1      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_ARTS2      VRIVKAWAGTLTRRVPTDVLGLIFQDQIESVIVATMLIVFGLILAVADAVGRQERELTRLTYKH------
UPPP_PHOPR      TAESKLTWMIALATIPACIFGLFMKDFIE-LYLRSXXXXXXXXXXXXXXXXXVDKHSEHKEYQT----GW
UPPP2_BACLD     LNLLGMKKNITVGLVPAAVLGFLFEDYIDQYLF-SVRTVAVGLIAGAVLMLAADWINRRKDTTDVDRMTY
UPPP_DESAP      LRLVQAGSRGVVATIPGVVVGYFLEDIVETTLRAPXXXXXXXXXXXXXXY-----LADRGQVKRLLDIRF
UPPP4_BACAH     IYLIKNPFSKLVGTIPAVVIGLLFKDFFEGITIGWEFLVTGFFLYMADKQKNGRKKMDDITYKDAFI---
UPPP3_BACCR     IYLIKNPFSKLVGTIPAVVIGLLFKDFFEGITIGWEFLVSGFFLYMADKQKNGRKKMDDITYKDALI---
UPPP1_PSEPF     PSARRFTANLLIAFLPAVVLGVIFADLIHHYLF-NPITVAAALVVGGIVMLWAEQRQHEVHAETVDEIRW
UPPP_ACIC1      RTVVTAWFRGLVGTIPIGLAGYLGRNVIK-----HDLRSLWYVVAGLVLWSIAIVYAERAQRRDLRDMRL
UPPP4_BACCZ     IYLIKNPFSKLVGTIPAVVIGLLFKDFFEGITIGWEFLVTGFFLYMADKQKNGRKKMDDITYKDAFI---
UPPP_SHEHH      LSMFTAWTSSIVATIPAVIVGFSAKGFIETHFRSIEVIAATTIIFGLLLWW-----ADKMQREGFNEF--
UPPP_CLOPS      SSSVVEFLSYIFSFIPAAILGLLFHDEIKEYLFSTKTVAXXXXXXXXXXXXXENNFRKRAKVKDIDKMTY
UPPP_ALCBS      IAMVGGAGLAVLATIPAVVFGFLGDDFIERE-LRSALVIAITTLVFGALLWASDAFGKREF--SLARLGV
UPPP1_SHEON     WAMFKAWIASIVATLPAVFFGFMAKDFI-ATHLRNTGVIAVTTVVFGLLLWWADKMSRHD-------LTI
UPPP_STAAU      LEILHIGKHKHVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQINY
UPPP_PROA2      VTISGAVIKGLMNASPLGVFGLLFKTEIE-TSLRSLYWXXXXXXXXXXXXXXXEWLIKKRIAKGIEPKSM
UPPP_COLP3      GVMAVAWLGTVLATIPAGLFGLLGKDFIEEHLRSALVIAMTTXXXXXXXXXADIKAGKRTEHKPMEKLGL
UPPP_CARHZ      KPWGRLPLLIIAGTVPTALIGFFERLFVSGSTLGIEFIITGLILWLAERQKSGRKNLEKTTFLDA-----
UPPP_VIBPA      SKEAKLAWMIVIATIPACVFGLLMKDVIE-VYLRSAYVIATTTIVFGLLLWWVDKNAKLVA--DEYQTGW
UPPP_RALSO      IDVIKGLPNDPVATIPAITLALIFGKAIKAHLFNPIVVASAFIIGGLVILWAEWRERHRGQTHDPRGNAL
UPPP_PSYIN      TQDSRLAWWILWSTIPAALIGFFGKSLVE-TYLRSGYVIAVTTTVFGLLLWWADANAKQVKTEYQTGLKG
UPPP_CLAM3      GKVLSAWSRSLIGTIPIGIAGYLFQDTIRSTFRSL-WXXXXXXXXXXXXXXXXDRYSRSDRLE--KDMTY
UPPP_PSEA7      --------------------------------------------------------AERRQHV-IRAEHV
UPPP_GEOSF      IELASDFFTGMADWFPAAIVGKLFETTIEELFRKSPSXXXXXXXXXXXXXXXXDTSGSKKW--KIEAITL
UPPP_STRA5      RLTWQLWLKVVIACIPSILIALPFDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNAHKPQVTELASMSY
UPPP_STRA3      RLTWQLWLKVVIACIPSILIALPFDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNAHKPQVTELASMSY
UPPP_STRA1      RLTWQLWLKVVIACIPSILIALPFDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNAHKPQVTELASMSY
UPPP_SHEAM      SDDSKLAWWIILATIPAIGVGFTAKDMVETHLRG-PGVIAITTVIFGLLLWFADRIAEMTEYQT----GW
UPPP_SACD2      GKQSENGSLAWCIIVATVPAGLF------GLLLGNFIEEHLRSVSVIATTTVVFGLAKHSETKQLAQMTL
UPPP_PSEAB      -----------IAFFPAVVLGVLFADLIHEWLF-NPITXXXXXXXXXXXMLWAERRKHVIHAEHVDDMTW
UPPP_PROAC      ----------------------------------------------------------------MKEIGI
UPPP_LEUMM      FQTWRLWIRVIVGVLPAIVFGFALNDFMDAHLMNFWVVSATLIIYGIAFIVIENRQKSIVPVTNVNQITF
UPPP_LACLS      ---------------------------------------------------------------DIDRLPY
UPPP_BLOPB      ICIKKIFFKQHLGTFPGIMLGMIFYEKI-GLIFELTYXXXXXXXXXXXXXXXXXCASKEPRVSRINNITY
UPPP_BACA2      LHLLGLKKNVTVGLVPAAVLGFLFEDFIDRYLF-SVRTVAYGLIAGAVLMLIADWINKRKETIDVDRITY
UPPP_ANATD      SEKGKLFWFIIVATIPGALFGYLFENIVEEVFRKQYLLIAIVLAVFGFILYYVDSIAKNKI--ELSKMNV
UPPP4_BACHK     IYLIKNPFSKLVGTIPAVVIGLLFKDFFEGITIGWEFLVTGFFLYVADKQKNGRKKMGDITYKDAFI---
UPPP_STRZT      ---------------------------------------------------------------ELDKLPY
UPPP_STRZP      ---------------------------------------------------------------ELDKLPY
UPPP_STRZJ      ---------------------------------------------------------------ELDKLPY
UPPP_STRR6      ---------------------------------------------------------------ELDKLPY
UPPP_STRPS      ---------------------------------------------------------------ELDKLPY
UPPP_STRPN      ---------------------------------------------------------------ELDKLPY
UPPP_STRPJ      ---------------------------------------------------------------ELDKLPY
UPPP_STRPI      ---------------------------------------------------------------ELDKLPY
UPPP_STRP7      ---------------------------------------------------------------ELDKLPY
UPPP_STRP4      ---------------------------------------------------------------ELDKLPY
UPPP_STRP2      ---------------------------------------------------------------ELDKLPY
UPPP_STRMU      NPFKSGKTAREVQILPAAVIGLIFDDWLDAHFQ-NFFSVALMLILYGIAFIYVERRHQGVEPQHLVSLPY
UPPP_ARTAT      VRIVQAWFGSLTGKVPIIVLGLLFQDQIESV-LRSMWIVATMLIVFGMILAVADAVGR--QERDLTQLSY
UPPP2_BURS3     NDDGHLMWALIIGTIPTGIVGLLLEKRIERVF-HDLRIVAIALIVNGVLLWLGDRIQRSRAHQAPEKMTF
UPPP2_BURCH     NDDGHLMWALIIGTIPTGIVGLLLEKRIERVF-HDLRIVAIALIVNGVLLWLGDRIQRSRAHQAPEKMTF
UPPP2_BURCA     NDDGHLMWALIIGTIPTGIVGLLLEKRIERVF-HDLRIVAIALIVNGVLLWLGDRIQRSRAHQAPEKMTF
UPPP_SHESR      WAMFKAWIASMVATLPAVFFGFIAKDFIE-THLRSAGVIAVTTIVFGLLLWWADKMSRRD-------LTV
UPPP_SHESA      WAMFKAWIASMVATLPAVFFGFMAKDFIE-THLRSAGVIAVTTVVFGLLLWWADKMSRRD-------LTV
UPPP_LACLA      ---------------------------------------------------------------NIDRLPY
UPPP_ARTCA      VRIVKAWAGSLAGKVPIIVLGLLFQDQIESV-LRSMWIVATMLIVFGLILAVADAVGK--QERDLTQLTY
UPPP1_CORJK     WRILTAWFAGLAGTIPVGLAGVLLKDLIR-----ENFRNLWITATVLILFSLVFILAERRKTRGFEELTM
UPPP_SHESM      WAMFKAWIASMVATLPAVFFGFIAKDFIE-THLRSAGVIAVTTIVFGLLLWWADKMSRRD-------LTV
UPPP_SHEDO      WTMAKAWVLSLVATIPAVIFGFAAKDFI-ATHLRNTTVIASTTIIFGLLLWWADRMSR-------SELTV
UPPP_PSEA8      -----------IAFFPAVVLGVLFADLIHEWLF-NPITXXXXXXXXXXXMLWAERRKHVIHAEHVDDMTW
UPPP_CHLTE      VSISGAVISGLVKGKPLGVFGLTFKHEIETVLRSLYIVSASMIGLALVLVVAEKHTANRARDKSINELSW
UPPP_CHLP8      ASDESRTGWMIAATIPIVVFGLAFKDDIETTLRSLYWXXXXXXXXXXXXXXXEKHTSNRAR-QGRRGKAI
UPPP_BORA1      ---------------------------------------------------------------------L
UPPP2_BURCM     NDDGHLMWALIIGTIPTGIVGLLLEKRLERVF-HDLRIVAVALIINGVLLWVGDRIQRSRAHQAPEKMTF
UPPP_STRSY      ------------------------------------------------------------QVTDLAKMSY
UPPP_STRS2      ------------------------------------------------------------QVTDLAKMSY
UPPP_PELPB      FIIVAAVIEGIVGTIPIVIFGKLFETQIDTTLRSLYWXXXXXXXXXXXXXXXEGKIKNRIK----KELPL
UPPP_BACSU      QGHKLSIAQIAVGLVPAAVLGFLFEDYIDEYLFSVKTVAIGLIAGAILMLFADWVNKRKTATDTLDRISY
UPPP3_BACC1     IYLIKNPFSKLVGTIPAVVIGLLFKDFFEGITIGWEFLVTGFFLYMADKXKNGRKKMDDITYKDAFI---
UPPP_VIBVY      SKEAKLAWMIVIATIPACIFGLVMKDVIE-VYLRSAYVIATTTIIFGLLLWWVDKNA--SLLDDEYQAGW
UPPP_VIBVU      SKEAKLAWMIVIATIPACIFGLVMKDVIE-VYLRSAYVIATTTIIFGLLLWWVDKNA--SLLDDEYQAGW
UPPP_STAES      -----------VGMVPAGILGFLFDDLIEKYLF-SVPTVLIGLFIGAIYMIIADKYSKTVQHQTVDQINY
UPPP_STAEQ      -----------VGMVPAGILGFLFDDLIEKYLF-SVPTVLIGLFIGAIYMIIADKYSKTVQHQTVDQINY
UPPP_RENSM      VRIIKHWGLSIAGKIPRNVVGLFFQNAIE-VTFRNLWIVATTLIVFGVILAVADAVGKHER--KLEELTV
UPPP_PELPD      VDMAVSTIDAVASAVPAALVGKLFETQIEELFRSRPXXXXXXXXXXXXXXXXADLFGRKRRFMAQVTVSH
UPPP_MICLC      TRIIGRWSAAVTGRIPVGSIPIAVLGLLLEDWIDTEFRSLWITATMLIVFGVLLALADRLGRQ---TKPL
UPPP_CHLPD      THEAAMGWMIAVGTLPIVICGLLFKTEIE-TSLRSLYWVSGALIGFALLLLVAEWSVKKRLKQNMSMTSM
UPPP_SYNJB      RQLILGSWKAWVGTVPIVVAGW----AIKA-IWGSPPRQLWVIATAAIGLAVLLGWAEQTRQRDLHSLGI
UPPP_SOLUE      LQIIAQGFGIRIGTVPVGIAGLLFNKQAEGA-----WRNPFVMGFMLIVVGVLMWIAENAQQRXXXXXXX
UPPP_LACLM      ---------------------------------------------------------------DIDRLPY
UPPP_CLOCE      KETVINFFPGKVGYEKSGFKFWFFIACIPGAYLMTPVSVAIVLILGGLWMIYAEKKFRNNNLGKQKLSVT
UPPP_CHLL2      TAIVREVVAGILKGRPLGTMGWMIAAVIFGLLFKNEIETSLRSLYWISXXXXXEKRMKNQLRQGVTMKSM
UPPP2_PSEPF     FEIVKGLPTQSIAFFPAVILGVLFADTIHEYLF-NPITVAVALVVGGIVMLWAEQRXXXXXXXXXXXMKW
UPPP_VIBSL      SKEAKLAWMIILATIPACIFGLLMKDIVE-LYLRSAWVIATTTIIFGLLLWWVDK--NSSLRDDEYQAGW
UPPP_SYNJA      RQLLLGSWKAWLMGILVGTLPIVIAGWAVKAIWGSPPRQXXXXXXXXXXXXXXXXXXERVRRRDLHSLGI
UPPP_PSEA6      ----------------------------------------------------------------------
UPPP_CORST      WRILTAWFAGLAGTIPVGLAGVLLKDLIR-----ENFRNLWITATVLILFSLVFILAERRKTRGFEELTM
UPPP_COREF      WQILTGWFAGVVATIPVVVLGVLGKDLIRDA-LRNMWITATVLVLFSFVFILAEKVGKKDRGYDELNM--
UPPP_THEYD      --------------------------------------------------------AEKVGKKLIRSITL
UPPP_STAAR      -----------VGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQISY
UPPP_PSEPK      PKARRFTGNLLLAFMPAVVLGVLFADLIHEYLF-NPXXXXXXXXXXXXIMLWAERREHRVEVDHVDDMRW
UPPP_PSEP1      PKARRFTGNLLLAFMPAVVLGVLFADLIHEYLF-NPXXXXXXXXXXXXIMLWAERRKHRVEVDHVDDMRW
UPPP_PSEAE      -----------IAFFPAVVLGVLFADLIHEWLF-NPITXXXXXXXXXXXMLWAERRKHVIRAEHVDDMTW
UPPP_LEPBL      GSQMLSSFQYLIGAFPILVVGFIFLDTIKARPDLLDILASAWIFGGVLILIAEWFFQKRQGTEEKKTVGF
UPPP_LEPBJ      GSQMLSSFQYLIGAFPILVVGFIFLDTIKARPDLLDILASAWIFGGVLILIAEWFFQKRQGTEEKKTVGF
UPPP_GEMAT      LEMIASAWRIAAATIPGGIGGLLLNDLAE-TTFRSPVVIATSLIVMGILLWAVDRWSARARVLEEVTLRD
UPPP_CLONN      KRSFENFAPSKVSAVPAGVLGLKFHSKINEKLFNPGSVTAALIVGAIWMIFAEKRYRGKFTTKDIDNVTI
UPPP3_FRAAA     ARIVRAWALSWLGTIPIGLLGVTLQDAIEGPFR-DLRXXXXXXXXXXXXXXXXDWYASKGRPRGRHSLPR
UPPP_VIBCM      SKEAKLAWLIVLATIPACLFGFVMKDIVE-LYLRSAWVIATTTIVFGLLLWYVDKHAELKA--DEYQADW
UPPP_VIBCH      SKEAKLAWLIVLATIPACLFGFVMKDIVE-LYLRSAWVIATTTIVFGLLLWYVDKHAELKA--DEYQADW
UPPP_VIBC3      SKEAKLAWLIVLATIPACLFGFVMKDIVE-LYLRSAWVIATTTIVFGLLLWYVDKHAELKA--DEYQADW
UPPP_PROM3      EPKARLGLAIAIGTMPILLAGMLFWPGYEASSIRSLPSIAVVSIVMALLLALAERIGPRLKQMH---LVK
UPPP_MOOTA      SQDGRLFWYLIVASIPGAIFGVLFEKQAE-TIFRSPXXXXXXXXXXXXXXXXXDRVGKRRQLDDVN---L
UPPP_HALOH      RDIIFFKKEKRVGIIPTGIIGILFEDFFAN-LFSSVKTVGFMLLVTGFLLYLSEKLSN--YNKELKEMQY
UPPP_DESOH      GMMAVSVGRGIVAMVPTAILGFFSLPLVGAMLLVTGTLLWLTRDRDTGGVG-------------VSGFSK
UPPP_STACT      KPKRLTLWHVLVGMIPAGILGLLFDDVIEKYLFSVPTVMIGLLLGAFYMIFAQKFSERYAHRENIDQITF
UPPP_MYCTU      VRILSAWLHGLVVTIPICILGLFFKDDIRSGVRN--------LWVVVTALVVFSGVIALAEYVGRQSRHI
UPPP_MYCTA      VRILSAWLHGLVVTIPICILGLFFKDDIRSGVRN--------LWVVVTALVVFSGVIALAEYVGRQSRHI
UPPP_MYCBT      VRILSAWLHGLVVTIPICILGLFFKDDIRSGVRN--------LWVVVTALVVFSGVIALAEYVGRQSRHI
UPPP_MYCBP      VRILSAWLHGLVVTIPICILGLFFKDDIRSGVRN--------LWVVVTALVVFSGVIALAEYVGRQSRHI
UPPP_MYCBO      VRILSAWVHGLVVTIPICILGLFFKDDIRSGVRN--------LWVVVTALVVFSGVIALAEYVGRQSRHI
UPPP_PSEPG      QPKARRFTGNLLAFMPAVVLGVLFADLIHEYLF-NPITVATALVVGGVIMLWAERREHRVQVDHVDDMRW
UPPP_LEPIN      ----------------------------------------------------------------------
UPPP_LEPIC      ----------------------------------------------------------------------
UPPP_BACV8      NAETKYVINILVSMIPIGIVGVFFKDYVEEILLIVGCMXXXXXXXXXFSYYAKPRLKENISMKDAFIIGL
UPPP2_FRASC     ----------------------------------------------------------------------
UPPP_SACEN      VRLVVTWFRGLVGSLPIGVLGFLFQDYIRGALRS-----LWITGAMLILFGILMGLAERAQRRGHDKLTM
UPPP_PROVI      ESNEARMGWMIAATIPIVVFGLLFKDQIETTLRSXXXXXXXXXXXXXAEWNIKKHLSGGRPLKTMEQIGW
UPPP_MYCUA      VRILRAWFDGLVVTIPICVLGLLFKDEIRSGVRN--------LWVVATALVVFSGVIALAEYLGRQSRHV
UPPP_CORGL      WQIITGWFAGVVATIPVVILGVLGKDLIREA-LRNMWITASVLILFSLVFILAEKMGKKER--DYDKLTM
UPPP_CORGB      WQIITGWFAGVVATIPVVILGVLGKDLIREA-LRNMWITASVLILFSLVFILAEKMGKKER--DYDKLTM
UPPP_MYCMM      VRILRAWFDGLVVTIPICVMGLLFKDEIRSGVRN--------LWVVATALVVFSGVIALAEYLGRQSRHV
UPPP1_BURPS     NDEGHLMWALIIGTIPTGLVGLLLEKRIERVF-HDLRIVAAALIINGVLLWLGDRIQRARAHRPPEKLTF
UPPP1_BURP1     NDEGHLMWALIIGTIPTGLVGLLLEKRIERVF-HDLRIVAAALIINGVLLWLGDRIQRARAHRPPEKLTF
UPPP1_BURP0     NDEGHLMWALIIGTIPTGLVGLLLEKRIERVF-HDLRIVAAALIINGVLLWLGDRIQRARAHRPPEKLTF
UPPP_SYNR3      SPDARLGIAIAVGTLPVVVAGLLFWPGYETSPLRSVASIGIVSIVMALLLALAERLGQRR-----KQLPS
UPPP_METVS      EKYITLSLKLFVSMIPAAIVGIFFEDFIKS-IFSETFFIGVFLAITGVFMLLSDKMDKNLK--TITKIPY
UPPP_PARD8      NAETKYVINILISMIPIGIVGVFFKDTVEQ-IFGSGLLVVGCMLLLTAALLAFSYYAKPRQKESIS---M
UPPP_MARAV      -----------------GASVIFFTTLVFGILLG-----------------IADWLPKRQRTMD--SLNW
UPPP_VIBFM      VTLLTAWVGSIVATIPAALFGLLFKDFIE-IYLRSAWVIAATTIVFGLLLWWVDKNATLAK--DEYQMTW
UPPP_RALPJ      ----------------------------------------------------------------------
UPPP_MYCVP      -----------------------------------------------------------AEYYGRQARRV
UPPP_GRAFK      FEIFSGLLKFKISMLPAVIVGLLFEEQLEALFGGNILFVGFMXXXXXXXXXXXXXXXXTG-----KKVSY
UPPP2_CORJK     WNIASAWCKGVVGTLPVAVLGYLGKDLIRDN-LRNLWITATMLVLFSFVFILAERMGRRERSFDELTM--
UPPP_SYNFM      ---------------------------------------------------------------------I
UPPP_SORC5      ----------------------------------------------------------------VEDVTF
UPPP_RUBXD      LRMAGAFVRSLTATVPAALIGYFFETAVRSVVVFN-LAFVGLLFLVAEAVGRKSRRAEKMGFAEAVGIGL
UPPP_PARUW      IKQSLITERNHIFHIILGTLPLFPLVLIKPIKATFDQPQYXXXXXXXXXXXXXXXVYFRLQMQ--KKHSL
UPPP2_PSEU5     DWFASLARRERVGTIPAGIAGLLFKGFIEEQ-MRSPLVIAWATIGFGLLLWWSDVVSRRTQPRDEHSLSW
UPPP1_PSEHT     TDDSKLGWWIILGTIPAAILGLLLKDMIE-LYLRSAWVIAVTTIIFGLLLWYAD--AKGKQIKTIYQLNW
UPPP_BIFAA      KDFKSRMGAHNIGTLPILIAGLLFKDAIEST-LRNLWITVTVLIIFGILLWVVDARAKQVKTMDEMTWKD
UPPP_BAUCH      ----------------------------------------------------------------------
UPPP_ANOFW      EVRKGPRLTLMHIFXXXXXXXFSTKTVLIGLVLG------------ALLMIAADRFGKRTVAQTVDDITY
UPPP1_BACCZ     ----------------------------------------------------------------------
UPPP_STRS7      -------------------------------------------------------IEKRHQTLEPRVVKL
UPPP_STREM      -------------------------------------------------------IEKRNQTLEPRVVKL
UPPP_STRE4      -------------------------------------------------------IEKRNQTLEPRVVKL
UPPP_STAHJ      FEMLHIGKYRNVGMIPAGILGVLFDDFIEAHLF-SVPTVMIGLFLGAIYMIIADKYSKKVQNKSVDQINY
UPPP_PSEPW      QPAARRFTANLLAFMPAVVLGVLFADLIHEYLF-NPITVATALVIGGVIMLWAERRTHSVAVDHVDDMRW
UPPP_PROMP      ----------------------------------------------------------------------
UPPP_NOCFA      -----------IATIPIGVLGFLFKDEIR--------TGARNLWLVSFMLIAFALVIAAAEHYGAKRRPI
UPPP_METMP      TEYINLASKLVLSTIPAVIVGLCFGDFIESVF-SSTLLIGVFLSITGILMLLSDNLNKNLK--TIKSIPY
UPPP2_BURXL     NDDAHMMWALIIGTIPAGLVGLLLEKRLER-IFHDLRIVAIALIVNGVLLWFGDRLQRTRAHQAPEKLTF
UPPP2_BURTA     NDEGHLMWALIIGTIPAGLVGLLLEKRIERVF-HDLRIVAVALIVNGILLWLGDRIQRARAHRPPEKLTF
UPPP_SYMTH      LNLAVEGLTKGMGTVPGAIFGLLMEDVVEAVFRQSXXXXXXXXXXXXXXXXXXDRFGPKRR--SLEEIRV
UPPP_METM7      KEYINLASKLVLSTIPAVFVGLFFGDFIESVF-SSTYLIGIFLSITGILMLLSDKLNKNLK--TIKSIPY
UPPP_SHELP      FSMFTAWTSSLVATIPAVIFGFTAKDFIS-THLRNIEVIATTTIVFGLLLWWADKL-NREGFSEFQ-VGW
UPPP_METM6      KEYINLASKLVLSTIPAVIVGLCFGDFIESVF-SSTFLIGVFLSITGILMLLSDKLNKNLK--TIKSIPY
UPPP_BACFN      NSETRYVINILISMIPIGIVGVFFKDEVEA-IFGSGLLIVGCMLLLTAALLSFSYYAKPRQKENIS---M
UPPP_VIBF1      VTLLTAWVGSIVATIPAALFGLLFKDFIE-IYLRSAWVIAATTIVFGLLLWWVDKNATLAK--DEYQMTW
UPPP_MYCLE      VRILHAWCRGLIGTIPICILGLVCKDEIRSGIVATALVAFSGVIAFAEYVGRQNRCIEQLNWRDALV---
UPPP_MYCLB      VRILHAWCRGLIGTIPICILGLVCKDEIRSGIVATALVAFSGVIAFAEYVGRQNRCIEQLNWRDALV---
UPPP_MYCGI      -----------------------------------------------------------AEYAGRQTRRV
UPPP_LEPBP      ----------------------------------------------------------------------
UPPP_LEPBA      ----------------------------------------------------------------------
UPPP_CHLT3      LRITSATISGLVGTIPIVVLGLLFKKNIE-TTFRXXXXXXXXXXXXXXXXMYAEYLVKKREARGEKMLSL
UPPP_SYNP6      --------------------------------------------------------------RDLSQLRL
UPPP_SYNE7      --------------------------------------------------------------RDLSQLRL
UPPP_CAMC1      FKLLRDFFASIAATIPVGIFGLLFNNVIEEYARSGVVIAVTTIIFGIALYFADLRSTNKSEYEMTIKFAL
UPPP_BACFR      NSETRYVINILISMLPIGIVGVFFKDEVEA-IFGSGLLIVGCMLLLTAALLSFSYYAKPRQKENIS---M
UPPP_METM5      NEYINLASKLVLSTIPAVIVGLCFGDFIESVF-SSTFLIGVFLSITGILMLLSDKLNQNLK--TIKSIPY
UPPP_SHEFN      TQESKLAWWIILATIPAVIVGFTAKDFIE-THFRNTLVIAITTIVFGLLLWAADRMS-KAQLTEFQ-MGW
UPPP_GLUDA      AESIHILALLVVATIPAVIIGGLLEHWLRA-LFGTARYAAIXXXXXXXXXXXTERMKSRQPVQGIASLTY
UPPP_GLOVI      SREVRLFWGIILGTIPIVIAGLALKSTLEGSPLRXXXXXXXXXXXXXXXXWLSESLGKRTR--TMKGIRV
UPPP_MYCS2      GRIIKSWFLGLVGTIPIGVFGLLFKDEIR--------TGARNLWLVATALIVFSVVIAAAEYYGRQVRQV
UPPP_ALISL      VTLLSAWTFSIVSTIPAAVCGLMFKDFIE-VYLRSAWVIAITTIVFGLLLWWVDK--NSTLVKDEYEMTW
UPPP_GEOSL      ----------------------------------------------------------------------
UPPP_CORDI      ----------------------------------------------------------------------
UPPP_FERNB      SDKNMWNLALKIIIIPAGIVGLFFESKVEAAF-SSQKLIGVFFLVTAAALWLSDKYSGNKTLNDITYLDA
UPPP_BIFLI      KDWKARMGRGDVGSIPIVILGFTLQDVIE-TSLRNLWITXXXXXXXXXXXXXXD--AKARQNKTMDDMTY
UPPP2_CLOAB     MPGFKFWTNIVVACIPAIVIGLPFQKKIDKXXXXXXXXXXXXMVGAVWMIFAENKYRKRAKIKSVDEITI
UPPP_PROM0      ----------------------------------------------------------------------
UPPP_ANAD2      XXXXXXXXXXXXXXXPFGTLGWY---IVLGTVLGNWVIXXXXXXXXXXXXXXXXXXSHRRRVEDVGA---
UPPP_MYCPA      -------------------------------------------------------------------LPL
UPPP_MYCA1      -------------------------------------------------------------------LPL
UPPP_MAGSM      ---------------------------------------------------------------DGSALSW
UPPP_MYCSS      -----------------------------------------------------------AEYFGRQVRHV
UPPP_MYCSK      -----------------------------------------------------------AEYFGRQVRHV
UPPP_MYCSJ      -----------------------------------------------------------AEYFGRQVRHV
UPPP_KINRD      RNDPDARMGWLVTLIPIGVLGLLFQDSIETVLRGF-VVIGTTLWLFALVLGAADRFGRKERTLD------
UPPP_BACTN      NDETRYVINIVISMIPIGIVGVFFKDYVE-AIFGSGLMIVGCMLLLTAALLSFSYYYKPRQKDKIS---M
UPPP2_BACHD     -------------------------------------------------------------YKDVKDMTL
UPPP2_ACIAD     QSFKQRAWYVLLATAITGVLGLLLQSLIKHVFFGNSKLMXXXXXXXXXXXXXSSRL-DRGQQGDIR-LPS
UPPP_SYNPW      ----------------------------------------------------------------------
UPPP_PELTS      RRRGTHEARMFLATVPGAVMGYLLEEQAETVFRTPXXXXXXXXXXXXXXYWAD---AKKPAVKGMREISM
UPPP_GLUOX      MEAIRIFGLLVIATIPAVLVGWLLEHRLRAVF-GTPLAVAGFLILNGFLLMVTEWLRRQKGHRDHK--PI
UPPP_ELUMP      ---------------------------------------------------------KRAGQKDV-ALNV
UPPP_DESAA      ---------------------------------------------------------------------L
UPPP_ANADE      ARLVAASTRGLVRGKPLGTLGWYILKLLERRILGNWXXXXXXXXXXXXXXXXERLASHRRRVEDVGP---
UPPP_VESOH      --------------------------------------------------------------------PK
UPPP_PROM5      ----------------------------------------------------------------------
UPPP_PROM2      ERLLRSIFIGTIPIVLLGGSVKLFVPNFIDNVLRSNLSIALVSIVMAFFMYLAD--SSKRGSIDIKNHNY
UPPP_BUCAT      KKTNTKNLHIILAILPTIFFGLLFYKKIK--LLFNTYNVMYALILGGIFLLISE-IFKPKKYKSINDISL
UPPP_BUCAI      KKTNTKNLHILLAILPTIFFGLLFYKKIK--LLFNTYNVMYALILGGIFLLISE-IFKPKKYKSINDISL
UPPP_BUCA5      KKTNTKNLHILLAILPTIFFGLLFYKKIK--LLFNTYNVMYALILGGIFLLISE-IFKPKKYKSINDISL
UPPP_BIFLO      ----------------------------------------------------------------------
UPPP_BIFLD      ----------------------------------------------------------------------
UPPP_SYNS3      ----------------------------------------------------------------------
UPPP_METST      -----------VGTIPTGIMGILLKDAIETIFRGTLFVGIFLLVTAAVLYYSERHSSGQITQKDMS---F
UPPP_HALHL      YARLFLLGMLSVLF--TGVVGLTLKATFEQVF-ANPWMIAFTLILTGALLFWTDKLPPRRR--GLRQTGV
UPPP_ANASK      ARLVAASARGLARGRPFGTLGWY---IVLGTLLGNWVIXXXXXXXXXXXXXXXXXXSHRRRVEDVGA---
UPPP_STAS1      -----------VGMIPAGVLGLLFDDVIQEYLFSVPTVMIGLFIGAIYMIIADIYSKKVTNPRNVDQINY
UPPP_SALRD      NDTFRLGVFILVTLVPTGVAYVLFREPLEQAF--GSPRFTSAMXXXXXXXXXXXRIGPRGDLSGVKAFVV
UPPP_PROMS      ----------------------------------------------------------------------
UPPP_ERYLH      ----------------------------------------------------------------------
UPPP_DESAH      KAMVVSLGRLVVGSIPTAVIGLILKNYVHAVIVGSMLMVTGTFLWLTRHSTPGGKKVEQIGF--------
UPPP_BIFA0      ----------------------------------------------------------------------
UPPP_METS3      -----------IATIPVGLVGVLFESQVESLFAGALYVPAFFLFVTGTILYLSQRM--NSGEVDLSNLSL
UPPP_METKA      GPWRRLGLFAIVATVCTAVVGLPVYKVLKGIFSAATGDAVQMAIGGALIVTGLLLRISPEGLRDRREVNV
UPPP_BUCAP      -----------ISILPTMFLGLIFYNKIKSLF--NPTNVMYALILGGFFLIIAEKFKKKPKTNSIKEINL
UPPP_ALHEH      -----------------------------------------------------DRLAPRRR--GLKGINL
UPPP_SYNS9      ----------------------------------------------------------------------
UPPP_PROMM      ----------------------------------------------------------------------
UPPP_HYPNA      ----------------------------------------------------------------------
UPPP_THEAB      LKKEYYSLVLKIIIIPAAIFGFLFNSTIENSF-SNLKIISFFFLVTAASLFVSDKLKGKKDFFNISYID-
UPPP_SYNAS      ----------------------------------------------------------RLRISDVNSMFY
UPPP_IDILO      ----------------------------------------------------------------------
UPPP_BORGA      ----------------------------------------------------------------------
UPPP_KOSOT      ----------------------------------------------------------------------
UPPP2_BACSK     --------------------------------------------------------------QQVDDISY
UPPP_TREDE      --------------------------------------------------------------KQAKNVTL
UPPP_MARMM      ----------------------------------------------------------------IETMSF
UPPP_THERP      IQIGRAWFAGLIRLLPAGLAGFFLNDVIDHFFHGGGDTAIVFTSXXXXXXXXXXXXAERTRWRSLGELGL
UPPP_BORBZ      ---------------------------------------------------------------DFKGNIL
UPPP_BORBU      ---------------------------------------------------------------DFKGNIL
UPPP_BORAP      ----------------------------------------------------------------------
UPPP_THEM4      TEIIKGLIKLEVSTIPAAIFGVLLESKIEAS-LSNLKIISFFFLVTSAALLISDKIKGN---KDLSTLTY
UPPP_SYNPX      ----------------------------------------------------------------------
UPPP_GRABC      ----------------------------------------------------------------------
UPPP_DINSH      ------------------------------------------------------------------AWTL
UPPP_CAMC5      FGLLRDFFVSIVATIPAGIFGLAFNSLIEEYTRSGIVIAVTTIIFGVVLYLADKRVGTKSEY-DVTXXXX
UPPP_SYNY3      RQYDSLEFKXXXXXXXXXXXXVFFGLLMKLLVQDLDNSFFRSLSTIAIASIVMALLLALAEKLGTHRRPF
UPPP_PROM9      ----------------------------------------------------------------------
UPPP_ANASP      AIALKDYADYDLRLSLGIVLGVFFGLLIKTFIPDYDSSPIRSLGAIAVASIVMEKLGKRER--DFEHLTM
UPPP_NITOC      ------------------------------------------------------------QQRNEHTLTW
UPPP_KORCO      -----------------------------------------------------------------RPLDL
UPPP_SILST      TKGARLALGLIVATIPTVIFGTFLYSLRSVAVIGWTMLVFGVVLYIADQRGPIDKSASDWGVRDAVIM--
UPPP_PELCD      ----------------------------------------------------------------------
UPPP_ACICJ      WAMLAGLLGRGVATLPAVLIGFALKKPIQH-LFASPEIAAAFLIANGAVLIIGERLRRRRAGNGIGQLTL
UPPP_TRIEI      TSDYQSPDLKMLVSIGLGTIPIVFFGLLIKVFLRSTVXXXXXXXXXXXXXXXXERIGSRKR--NFEKLDI
UPPP_THEMA      XXXXXXXXXXXVSTIPAGVFGVLFEKQIDQXXXXXXXXXXXXXATALILMFTRYSSSGEKRMENMSFLDA
UPPP_THESQ      XXXXXXXXXXXVSTIPAGVFGVLFEKQIDQXXXXXXXXXXXXXVTALILMFTRYSSSGEKRMENMSFLDA
UPPP_THEP1      XXXXXXXXXXXVSTIPAGVFGVLFEKQIDQXXXXXXXXXXXXXVTALILMFTRYSSSGEKRMENMSFLDA
UPPP1_BACSK     IEIIRGFFAYFTKRTPQNKAMFWFYLVVATGITG------------VAGILFEDYISETFKAPIFIALAL
UPPP_TROW8      ----------------------------------------------------------------------
UPPP_TROWT      ----------------------------------------------------------------------
UPPP_GEOLS      PRRLRLPWMIVLASIPAAIAGKTLEQPIEELFRSSPXXXXXXXXXXXXXXXXTDRYGKKLH--DVASITL
UPPP_BUCBP      -----------------------------------------------------------------KNIET
UPPP2_FRAAA     -----------------------------------------------------------SEHRSLDTLAY
UPPP_ROSDO      TQGAFLALCLIIATIPVMIAGLIIKEMMRSVVIGWTMLGFGLVLYWADRTGASTRTASGWTLKDAFLMGL
UPPP_RHOBA      LKDRRVIGLLVIGTLPAVVIGLTIKPLLAGAML----------IVTGVMLIVLGRLTPKSGTYD--RLGL
UPPP_PELUB      ----------------------------------------------------------------------
UPPP_PROMA      ----------------------------------------------------------------------
UPPP_METTH      ----------------------------------------------------------------------
UPPP1_MAGSA     ----------------------------------------------------------------------
UPPP_JANSC      TPGAKLAFLLIIATIPVIIFGLFLYDSLRSIVIGWTMLIFGLVLYWADQRGGTEKQSDDWSLRDAVTMGL
UPPP2_RHILO     ---------------------------------------------------------------------L
UPPP2_CHRVO     ---------------------------------------------------------------ELSELSF
UPPP_SULIM      -------------------------------------------------------------------LRL
UPPP_SULIK      -------------------------------------------------------------------LRL
UPPP_SILPO      TPGARLAMGLIVATIPTVLAGAALHFTGLSDALRSITVIGWTMLLFGLLLWWADRTG--AQVKEATDWSL
UPPP_BORRA      ----------------------------------------------------------------------
UPPP_BORDL      ----------------------------------------------------------------------
UPPP_BORHD      -------------------------------------------------------LESRIVIFDLKRNIL
UPPP_PROMT      ----------------------------------------------------------------------
UPPP_PROM1      ----------------------------------------------------------------------
UPPP_SULSO      -------------------------------------------------------------------LKL
UPPP1_BACLD     -----------IATIPAGVIGVLFDDEISAFFKDGVRITAVTLLITGLALFLIRNLRGRKSDGEIRL---
UPPP_ACAM1      ----------------------------------------------------------------------
UPPP_METTP      --------------------------------------------------------------KDMEEIST
UPPP_HALMA      ----------------------------------------------------------------------
UPPP_CHLCH      ----------------------------------------------------------------------
UPPP2_OENOB     ----------------------------------------------------------------------
UPPP3_BACAN     -----------IATIPAGVIGVLFKDYIDQYLKGVKMVGISLLITAVGLWIIRNLRGRRNDGD----LSM
UPPP_SYNSC      ----------------------------------------------------------------------
UPPP_ANAVT      ----------------------------------------------------------------------
UPPP2_BACHK     ----------------------------------------------------------------------
UPPP2_BACCZ     ----------------------------------------------------------------------
UPPP2_BACAH     ----------------------------------------------------------------------
UPPP1_BACCR     ----------------------------------------------------------------------
UPPP1_BACC1     ----------------------------------------------------------------------
UPPP_OCEIH      ----------------------------------------------------------------------
UPPP1_BACHD     ----------------------------------------------------------------------
UPPP_PELLD      ----------------------------------------------------------------------
UPPP1_FRASC     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARVAWIGVFQGLAALFPGTSRSGATIXXXXXXXXNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGG
UPPP_THET2      ARVAWIGVFQGLAALFPGTSRSGATIXXXXXXXXNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGG
UPPP_THET8      ARVAWIGVFQGLAALFPGTSRSGATIXXXXXXXXNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGG
UPPP_AQUAE      RKAFMIGVFQSIAVI-PGVSRSGSTIIGGMLMGLNRKVAAEFSFLLAIPTMFAATTYDLIKSGGSFNAQE
UPPP_WOLSU      KEALAIGFFQALA-MIPGTSRSGSTIVGGLILGLNRKVAAEFSFLLALPTMFIATGYDLYKNSHTLSIEN
UPPP_PERMH      YKAFFIGVFQSIA-MIPGTSRSGATIIXXXXXXXDRKTAAEFSFLLAVPTMFAATSYDIMKNYHHFHIEN
UPPP_SULSY      QKAFLIGVFQSLA-MVPGTSRSGATIVGGLLLGLDRKTAAEFSFMLAVPTMFMATFYDVYKNRSNFNLSD
UPPP_CAMJD      KQAFCIGIFQSLA-MIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKE-PELLSNA
UPPP_CAMJR      KQAFCIGIFQSLA-MIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKE-PELLSNA
UPPP_CAMJJ      KQAFCIGIFQSLA-MIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKE-PELLSNA
UPPP_CAMJE      KQAFCIGIFQSLA-MIPGTSRSGASIIGGLLLEFNRKVAAEFSFLLAIPTMIIATAYSIYKE-PELLGNA
UPPP_CAMJ8      KQAFCIGIFQSLA-MIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKE-PELLSNA
UPPP_OCHA4      PMCLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLYKSRNILSLND
UPPP_SPHWW      RTSFGVGLVQCLS-MIPGVSRSGATIMGALTLGVERRTAAEYSFFLAIPTMLGATTLALWKARHELGDAQ
UPPP_PHEZH      KTAFIIGLFQCLA-LIPGVSRSGATVAGALLMRCDKRSAAEFSFFLAMPTMAGAFTVDLAKNYKLLSADD
UPPP_RHOPS      PMYFYIGCAQCLA-MIPGVSRSGASIVAAMLFGADKRSAAEFSFFLAIPTMVGAFVYDFYKNRGEMTTDH
UPPP_CAMHC      KQAFFIGLSQ-CFAMVPGTSRSGATIIAGLLSGLNRQTAAAFSFLLAVPTMFAATFYDTYKNREAANMDN
UPPP_BRUSU      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUSI      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUO2      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUME      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUMB      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUC2      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUAB      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUA2      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_BRUA1      PICLAIGFIQCLA-MIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFND
UPPP_MESSB      SVYLKIGLFQCLS-MIPGTSRSGSTIVGALLLGVDKRAAAEFSFFLAMPTMAGAFAYDLYKNYHLLTAAD
UPPP_NAUPA      REALIIGFFQ-VFALIPGTSRSGATIVGGMLSGLSRKTAADFSFLLAIPTMFAASGYELLKNIDSFTNQN
UPPP_CAMFF      VKQAFIIGLSQCFAMIPGTSRSGSTIITGLLCGLSREVAARFSFLLAIPTMFAATAYDSYKNADQNKEAL
UPPP_NOVAD      RQAIGVGLAQCLA-MVPGVSRSGATIMGALAMGIERRTAAEFSFFLAIPTMLGATTLELLDNRDALLGGG
UPPP_BDEBA      KDSVKLGLFQAIA-MIPGVSRSGATIMGGLTLGMNKKEAAEFSFFLAVPTMAAATLYKLLKIYKTIEPAQ
UPPP_THICR      RQAFWIGIIQ-VFALIPGTSRAGASIVGGVMMGLDRKTAAEFSFLLALPVLMAASGLDLLKHYEDFNNTS
UPPP_BRAJA      LMYLYIGIAQ-CVAMIPGVSRSGASIVAAMLLGADKRAAAEFSFFLAIPTMIGAFAYDFYKNRSEMTMDH
UPPP_NITWN      PMYVWIGIAQ-CVAMIPGVSRSGATIVSAMLLGADKRAAAEFSFFLAIPTMTGAFAYDFYKNHADMTTDD
UPPP_NITHX      PMYIWIGIAQCLA-MIPGVSRSGATIVSAMLLGADKRAAAEFSFFLAIPTMIGAFAYDFYKNRADMTTDH
UPPP_META3      KQSLLIGIAQAFS-LIPGTSRSGATIVGGMLCNLNRKTATEFSFLGALPVMLAASLFDIVKHHSELGSGD
UPPP_POLSJ      MDALKVGLVQCLA-MIPGTSRSGATIIGGMLLGLSRKAATDFSFYLAIPTLIGAGVYSLYKERALLSVAD
UPPP_DECAR      LDALKLGIAQAFA-LIPGTSRSGATIIGGLLFGLSRKAATEFSFFLAIPTLIVATFYQLYKERALLNADD
UPPP_CAUCR      KTAFIIGLFQCLA-LVPGVSRSGATIAGALLLKCDKRSAAEFSFFLAMPTMAGAFAYDLYKNIDKLSTND
UPPP_CAUCN      KTAFIIGLFQCLA-LVPGVSRSGATIAGALLLKCDKRSAAEFSFFLAMPTMAGAFAYDLYKNIDKLSTND
UPPP_THETN      SKAFWIGVAQ-VMSLFPGMSRSASTIMGGMLVGLSVRAAAEFSFFLAIPTMLAATGFELVKNITSMSLLE
UPPP3_ACIAD     QAIA-VGFIQCLA-MIPGTSRSGATIIGGMLSGLSRKAATEFSFFLAMPTMLGAATYDLLRNADVLTSDN
UPPP_NITMU      KHALKVGLAQCLA-LIPGTSRSGATIIGGLFFGLSRKAATEFSFFLAIPVMFAATFYDLYKNRDILHLDD
UPPP_NITEC      KHALKIGCAQCLA-LIPGTSRSGATIIGGLLSGLSRKAAAEFSFFLAIPIMFAATFYDVYKHREFLHSDD
UPPP_DESHD      TTAFMIGIFQLIAAIFPGTSRSGATIVGGLLLGVSRTVAAEFTFFLAIPVMFGASALKLLKFGFNFTGPE
UPPP_CYTH3      QTGFLIGCFQCLA-MIPGVSRSAATIIGGLTQKLTRKAAAEFSFFLAVPTMFAATAKSLYESTDKIP---
UPPP3_BACHK     KQAFTIGMFQCLA-LWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDILSTAD
UPPP2_MAGSA     ALALGVGFCQVLA-MVPGVSRAGATIMGSMLLGLDRRAAAEFSFFLAIPTMCGASAYSLYKNWATLSFDG
UPPP2_BACC1     KQAFTIGMFQCLA-LWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDILSAAD
UPPP_YERPY      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPS      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPP      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPN      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPG      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPE      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPB      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERPA      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP_YERP3      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
UPPP2_BACCR     KQAFTIGMFQCLA-LWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDVLSSAD
UPPP_AZOSE      ADALKVGFAQA-AAMIPGTSRSGATILGGLVFGLSRKAAAEFSFFLSIPTMFAATVYDLYKNRDLLHMGD
UPPP_AERS4      KQAFGIGLFQCLA-LWPGFSRSGATISGGMLMGISRQAAAEFSFILAVPMMVAASGLDLYKSRDLLSMAD
UPPP_SERP5      RQAFMIGCFQCLA-LWPGFSRSGSTIAGGMLVGVNRYAAAEFSFILAVPMMIGASGLDLYKSLHFLTMGD
UPPP_PSEMY      KLALKVGFAQCLA-LIPGTSRSGATIIGGLVFGLSRKAATEFSFFLAMPTMIAATVYSLFKYRDILQWSD
UPPP3_BACCZ     KQAFTIGMFQCLA-LWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDILSTAD
UPPP3_BACAH     KQAFTIGMFQCLA-LWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDILSTAD
UPPP2_BACAN     KQAFTIGMFQCLA-LWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDILSTAD
UPPP_DESDG      ALALGIGMFQCLA-LWPGFSRSAATIMXXXXXXXXXXXXXEYSFVAAVPIMFAATGYDMYKSYSLFSPAD
UPPP1_CLOAB     TTAVLIGIFQLIAAVFPGTSRSGATIVGALLIGVSRTVAAEYTFFLAIPVMFGASLLKLFKFGLHFTSTE
UPPP_ERWT9      RQAFMIGCFQCLA-LWPGFSRSGATISGGMLVGVSRYAASEFSFLLAVPMMIGATGLDLYKSMGFLSMAD
UPPP_VEREI      PDALKVGLVQCLA-MVPGTSRSGATIIGGMLLGLSRQAATDFSFFLAIPTLIGAGVYSLYQERALLTVAD
UPPP_RHIE6      KEITWVGIAQIVAGVFPGTSRSGATIFVAMLAGTNRAAATEFAFLVGIPTMYAASGYELLKTFKDGGAAG
UPPP_FLAJ1      LQALKIGLFQCIA-MIPGVSRSGASIVGGMSQKLSRTTAAEFSFFLAVPTMLGATCYDYYKAGFELSHDQ
UPPP_THIDA      RRALAVGFAQALA-MVPGTSRSGATIIGGLFLGLSRKAAAEFSFLLAIPTMFAATAYDLYKNWQLFDAGD
UPPP_RHOS4      NVALKIGFIQCLA-MVPGVSRSGATIVGGLMLGAGKRAAAEFSFFLSMPTMAGAFAFDLFKNRDVLDASA
UPPP_RHOS1      NVALKIGFIQCLA-MVPGVSRSGATIVGGLMLGAGKRAAAEFSFFLSMPTMAGAFAFDLFKNRDVLDASA
UPPP_RHILW      KEITWVGIAQIVAGIFPGTSRSGATIVAMLAGTGNRAAATEFAFLVGIPTMYAASGYELLKTFKDAANED
UPPP_RHIEC      KQITWVGIAQIVAGVFPGTSRSGATIFVALLAGTNRAAATEFAFLVGIPTMYAASGYELLKTFKDGGAAG
UPPP_RALEJ      LQAAKAGAPRGLAALVPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARALLSVDD
UPPP_PORGI      AFV--IGLFQCLAIFLPGLSRSMATIVGGQQQKLSRKAAAEFSFFLAVPTMLGATAYKLYKEGGEIFREH
UPPP_ACIAC      LDALKVGLVQCLA-MVPGTSRSGATIIGGMLLGLSRKAATDFSFFLAIPTLIGAGVYSLYKERHLLSMAD
UPPP_THEPX      KKSLLIGIAQ-VMSLFPGMSRSASTIMGGMLAGLSVKAAAEFSFFLAIPTMFAATTLSLLKGFSAMSLLE
UPPP_THEP3      KKSLLIGIAQ-VMSLFPGMSRSASTIMGGMLAGLSVKAAAEFSFFLAIPTMFAATTLSLLKGFSAMSLLE
UPPP_RHOFD      MDALKVGLAQCLA-MIPGTSRSGATIIGGMLLGLSRKAATDFSFYLAIPTLIGAGVYSLFKERALLSMAD
UPPP1_CLOD6     KLALCIGLFQCLA-LIPGTSRSGSTIIGAVLLGTSRYVAAEFSFFLAIPTMXXXXXXXXXXXXFGFTGFE
UPPP_YERE8      DDITYIGCFQCLA-LWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMLGASGLDLYKSLHFLSWGD
UPPP_RALEH      LEAAKAGAPRGLAALVPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARALLNGDD
UPPP_AERHH      KQALGIGLFQCLA-LWPGFSRSGATISGGMLMGISRQAAAEFSFILAVPMMVAASGLDLYKSRDLLSMAD
UPPP_RHOP5      PMYLIIGFAQCIA-MFPGVSRSGATIVGAMLLGADRRAAAEFSFFLAIPTMLGAFVYDLYKSRADMTMDH
UPPP_PORG3      AFV--IGLFQCLAIFLPGLSRSMATIVGGQQQKLSRKAAAEFSFFLAVPTMLGATAYKLYKEGGEIFREH
UPPP_PARL1      RTALKIGLFQCIA-LVPGVSRSGATILGALLVGVERKTAAEFSFFLAIPVMLGASVVSLRDTWQLISMDD
UPPP_LACCB      QTALLIGLFQVLS-IVPGTSRSGATILGALLIGTSRYVATEFSFFLAIPTMVGVIGKYLWQGNGFSGE-Q
UPPP_DESMR      GLALGIGCFQCL-SLWPGFSRSAATIMGGMLLGAKRSLAAEYSFIGAVPLMFAATLYDFYKSAHLFSADD
UPPP_CAUSK      KTAALIGLFQCLS-LLPGVSRSGSTIVGSMLIGVDRKAAAEFSFFMAIPIMVGAFALDLLKSYKDIDASH
UPPP2_RHORT     DEMTWVDALKGLAALIPGTSRSGATIIGGLFFGLSRKAATEFSFFLAIPTLTAASLYDLYKNRALLDGDM
UPPP_RHOS5      GVALKIGFFQCLA-MVPGVSRSGATIVGALLLGTGKRAAAEFSFFLSMPTMAGAFAFDLYKNRDVLDAGA
UPPP1_BURXL     LDALKVGLAQCFA-LIPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATAYELHKDWHLLSVDA
UPPP_LACC3      ADITYIGLFQVLS-IVPGTSRSGATILGALLIGTSRYVATEFSFFLAIPTMVGVIGKYLWQGNGFSGE-Q
UPPP_BRASB      LMYLWIGVAQCLA-MIPGVSRSGATIVAAMLLGGDKRSAAEFSFFLAIPTMVGAFVYDFYKSRAEMTSDH
UPPP_RHOPT      LTYFYIGCAQ-CTAMIPGVSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKNHADMTADN
UPPP_RHOPA      LTYFYIGCAQ-CTAMIPGVSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKNHADMTADN
UPPP_RHOP2      LMYFYIGCAQ-CVAMIPGVSRSGASIVAAMLFGADKRAAAEFSFFLAIPTMVGAFVYDLYKSRADLTTDH
UPPP_RALME      LEAAKAGAPRGLAALVPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARALLSADD
UPPP_RHIL3      KEITWVGIAQIVAGVFPGTSRSGATIFVAMLAGTNRASATEFAFLVGIPTMYAASAYELLKTFRDGGAAG
UPPP_DEIGD      GRAFLIGAAQCLALLWPGFSRSASSILGGMVMGLDRPTATRFSFYLGIPTLGGAALLDFIKSRHLLAEIG
UPPP_BRASO      MMYLWIGVAQCLA-MIPGVSRSGSTIVAAMLLGGDKRSAAEFSFFLAIPTMVGAFVYDFYKSRAEMTSDH
UPPP_OLICO      PMYLGIGIAQ-CAAMVPGVSRSGASIVAAMLFGADKRAAAEFSFFLAIPTMLGAFVYDVYKSRGDMTMDH
UPPP_HERAR      LDAFKVGCAQAFA-LIPGTSRSGASIIGGMMFGLSRKAATEFSFFLAIPTLMGATVYSVYKDRALLSMAD
UPPP1_BURCH     LDALKVGIAQCFA-LVPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQAFTVDX
UPPP1_BURCA     LDALKVGIAQCFA-LVPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQAFTVDX
UPPP_PHOLL      RQAFMIGCFQCLA-LWPGFSRSGATISGGMLMGVNRYTASEFSFILAVPMMMGASGLDLYKSLHFLSASD
UPPP_ERWCT      DDITMIGCFQCLA-LWPGFSRSGATISGGMLMGVSRYAASEFSFILAVPMMMGATVLDLYKSWHFLSLAD
UPPP_DESAD      LALG-IGCFQCLA-LWPGFSRSAATIMGGMLLGAKRKIAAEYSFIAAVPIMFAATGYDMLKSYKLFTMAD
UPPP_NEIMB      IDALMIGVAQ-VFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHD
UPPP_NEIG2      IDALMIGVAQ-VFALVPGTSRSGSTVMGGMFWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHD
UPPP_NEIG1      IDALMIGVAQ-VFALVPGTSRSGSTVMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHD
UPPP1_CHRVO     KDALKVGLCQCLA-LIPGTSRSGATIIGGLFLGLSRKAATEFSFFLGIPTLGAASLYSLIKHRDALSADD
UPPP_ZYMMO      HKAVLVGLAQCLA-MIPGVSRSGATIMGALCLGIDRKTATEYSFFLAIPVMLAATVKELWEQRHNLHIAD
UPPP_NEIMF      IDALMIGVAQ-VFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHD
UPPP_NEIMA      IDALMIGVAQ-VFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHD
UPPP_POLNS      LKV---GLAQ-CAALIPGTSRSGATIIGGMLFGLPRAVATEFSFFLAIPVIGGATAYELLKKAPVAFSGE
UPPP_PECCP      RQAFMIGCFQCLA-LWPGFSRSGATISGGMLVGVSRYAASEFSFILAVPMMMGATVLDLYKSWHFLSLSD
UPPP_JANMA      LDALKVGCAQAFA-LIPGTSRSGASIIGGMFFGLSRKAATEFSFFLAIPTLMGATVYSVYKDRALLSMAD
UPPP_XANC5      AIA--VGLAQVVAGVFPGTSRSASTIFIAMLLGLSRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGN
UPPP_XANAC      AIA--VGLAQVVAGVFPGTSRSASTIFIAMLLGLSRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGN
UPPP_METPP      ARVETIDDMSALAALIPGTSRSGATIIGAMLFGFSRKAATEFSFFLGIPTLMGAGAYSLIKQRDLLSWGD
UPPP_METFK      WQALKVGCAQSL-AIMPGVSRSGATILGGMIFGLNRKTATEFSFFLAIPVMLAATFYDVYKNFSLFVFED
UPPP_GEOKA      KQAFFVGLMQCLS-LWPGFSRSGSTISGGVLVGMSHRAAADFTFIMAVPIMAGASGLSLLKNWQYVTAAD
UPPP_BURMS      FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP_BURMA      FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP_BURM9      FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP_BURM7      FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP2_BURPS     FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP2_BURP1     FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP2_BURP0     FDALKVGLAQ-CCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRAFNVDS
UPPP_XANOR      AIA--VGLAQVVAGVFPGTSRSASTIFIAMLLGLSRRAAADFVFMVGIPTMFAASGYALLEMYKEGGFGH
UPPP_XANOP      AIA--VGLAQVVAGVFPGTSRSASTIFIAMLLGLSRRAAADFVFMVGIPTMFAASGYALLEMYKEGGFGH
UPPP_XANOM      AIA--VGLAQVVAGVFPGTSRSASTIFIAMLLGLSRRAAADFVFMVGIPTMFAASGYALLEMYKEGGFGH
UPPP_DESVV      ALALGIGCFQCLA-LWPGFSRSAATIXXXXXXXXXXXXXXEYSFIAAVPIMFAATGYDLLKSWTLFTPAD
UPPP_DESVH      ALALGIGCFQCLA-LWPGFSRSAATIXXXXXXXXXXXXXXEYSFIAAVPIMFAATGYDLLKSWTLFTPAD
UPPP1_RHILO     RLYLQIGLFQCLS-LIPGTSRSGSTIVGALLLGVDKRAAAEFSFFLAIPTMVGAFAFDLFKNRNVLTSAD
UPPP_SODGM      -QAFLIGCFQCLA-LWPGFSRSGATISGGLLVGVSRYAASEFSFILAVPMMLGATVLDLYKSLPFLSWQD
UPPP_NITEU      KQALQVGCAQCLA-LIPGTSRSGATIIGGLLFGLSRKAAAEFSFFLAIPVMFAATFYDVYKHREFLYIDD
UPPP_NEIM0      IDALMIGVAQ-VFALIPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHD
UPPP_CELJU      ADAFNVGLCQCLA-LIPGTSRSGATIIGGMYFGLSRRASTEFSFFLAIPMIGAASLYALWEAREQMEIED
UPPP3_FRASC     -----IGIVQCMA-LIPGISRSGATMSAGLLRGLDRVAVTRLSFFLSIPALMAAAALQVLTKSDDIADGG
UPPP_SULNB      TQAWWVG-FAQIFSLIPGTSRXXXXXXXXXXXXXDRKTSAEFSFLLAIPVMAVVSGYDLLKHYQDFADAN
UPPP1_FRAAA     AMI--VGTSQILALLFPGFSRSGATISTGLIRDLDRVAATRLSFFLSIPALTGAGLYEL----KDAVGGG
UPPP_LAWIP      TPKTALGIFFECLALWPGFSRSAATIMGGMLLGAKRHLAAEYSFIAAVPVMFAATGYDLLKNWDLFTAND
UPPP_ACIBT      KQALLVGLAQ-CVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDN
UPPP_ACIBS      KQALLVGLAQ-CVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDN
UPPP_ACIBC      KQALLVGLAQ-CVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDN
UPPP_ACIBY      KQALLVGLAQ-CVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDN
UPPP_ACIB5      KQALLVGLAQ-CVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDN
UPPP_ACIB3      KQALLVGLAQ-CVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADVLTSDN
UPPP1_BURCM     LDALKVGLAQCFA-LVPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQAFTVDX
UPPP_XANCP      AIA--VGLAQVVAGVFPGTSRSASAIFLAMLLGLSRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGN
UPPP_XANC8      AIA--VGLAQVVAGVFPGTSRSASAIFLAMLLGLSRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGN
UPPP_CLOTH      KAVLLIGAFQVLA-LIPGTSRSGATILGAIMIGCSREIAAEFSFYLAIPVMFGASLLKLVKFGFAFSQTE
UPPP_CLOPH      QMAFMIGLFQ-ILAMIPGTSRSGATIIGAMLFGASRYVAAEFTFFLAIPTMFGASXXXXXXXXXXXXXAE
UPPP_XYLFT      -----VGLAQVVAGVFPGTSRSASTIFLAMLLGLSRSAAAEFSFLVGIPTMFSASSYELFKRG-ELLHEN
UPPP_XYLFA      -----VGLAQVVAGVFPGTSRSASTIFLAMLLGLSRSAAAEFSFLVGIPTMFSASSYELFKRG-ELLHEN
UPPP2_SHEON     KQXXXXXXXXXXXXX-PGTSRSGATIVGGMLSGVSRKAATEYSFFL<