[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS82166.1

[Show Plain Result]


## Summary of Sequence Search
    1::536
   13::418     9e-89  39%  568 aa  RS1_RHIME RecName: Full=30S ribosomal protein S1;
    2::424     2e-87  40%  561 aa  RS1_NEIMB RecName: Full=30S ribosomal protein S1;
   17::424     4e-86  38%  566 aa  RS1_BUCBP RecName: Full=30S ribosomal protein S1;
   27::432     5e-85  37%  565 aa  RS1_RHOPA RecName: Full=30S ribosomal protein S1;AltName:
   19::427     5e-82  38%  549 aa  RS1_HAEIN RecName: Full=30S ribosomal protein S1;
    3::420     6e-82  39%  551 aa  RS1_COXBU RecName: Full=30S ribosomal protein S1;
   38::451     2e-80  38%  580 aa  RS1_CHLPN RecName: Full=30S ribosomal protein S1;
   36::436     8e-80  36%  568 aa  RS1_RICCN RecName: Full=30S ribosomal protein S1;
   21::436     2e-79  37%  568 aa  RS1_RICTY RecName: Full=30S ribosomal protein S1;
   21::436     3e-79  37%  568 aa  RS1_RICFE RecName: Full=30S ribosomal protein S1;
   36::436     5e-79  36%  568 aa  RS1_RICPR RecName: Full=30S ribosomal protein S1;
   11::423     2e-77  35%  559 aa  RS1_BUCAP RecName: Full=30S ribosomal protein S1;
   11::423     8e-77  34%  558 aa  RS1_BUCAI RecName: Full=30S ribosomal protein S1;
   36::439     2e-74  35%  572 aa  RS1_RICBR RecName: Full=30S ribosomal protein S1;
   41::451     4e-73  36%  570 aa  RS1_CHLMU RecName: Full=30S ribosomal protein S1;AltName: Full=70
    1::318     3e-72  40%  378 aa  RS1_PROSP RecName: Full=30S ribosomal protein S1;Flags: Fragment;
   41::451     3e-72  36%  569 aa  RS1_CHLTR RecName: Full=30S ribosomal protein S1;
   11::423     1e-70  34%  557 aa  RS1_SHIFL RecName: Full=30S ribosomal protein S1;
   11::423     1e-70  34%  557 aa  RS1_ECOLI RecName: Full=30S ribosomal protein S1;
   11::423     1e-70  34%  557 aa  RS1_ECOL6 RecName: Full=30S ribosomal protein S1;
   11::423     1e-70  34%  557 aa  RS1_ECO57 RecName: Full=30S ribosomal protein S1;
  283::641     2e-66  35%  642 aa  ISPH_CLOAB RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
    1::375     4e-63  37%  481 aa  RS1_MYCTU RecName: Full=30S ribosomal protein S1;
   13::355     3e-62  36%  382 aa  RS1H_BACC1 RecName: Full=30S ribosomal protein S1 homolog;
   41::424     2e-58  31%  559 aa  RS1_PSEAE RecName: Full=30S ribosomal protein S1;
    1::368     2e-57  35%  481 aa  RS1_MYCLE RecName: Full=30S ribosomal protein S1;
  348::705     8e-55  34%  827 aa  ISPH_FUSNN RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
   37::364     1e-53  36%  391 aa  RS1_STAAR RecName: Full=30S ribosomal protein S1;
   37::364     2e-53  36%  391 aa  RS1_STAAW RecName: Full=30S ribosomal protein S1;
   37::364     2e-53  36%  391 aa  RS1_STAAS RecName: Full=30S ribosomal protein S1;
   37::364     2e-53  36%  391 aa  RS1_STAAN RecName: Full=30S ribosomal protein S1;
   37::364     2e-53  36%  391 aa  RS1_STAAM RecName: Full=30S ribosomal protein S1;
   37::364     2e-53  36%  391 aa  RS1_STAAC RecName: Full=30S ribosomal protein S1;
   51::391     5e-49  32%  429 aa  RS1_LEULA RecName: Full=40S ribosomal protein S1;
   37::352     7e-47  33%  392 aa  RS1_STAHJ RecName: Full=30S ribosomal protein S1;
   37::353     1e-46  34%  393 aa  RS1_STAS1 RecName: Full=30S ribosomal protein S1;
   49::399     3e-43  29%  552 aa  RS1_HELPJ RecName: Full=30S ribosomal protein S1;
   37::352     3e-43  33%  392 aa  RS1_STAEQ RecName: Full=30S ribosomal protein S1;
   53::403     3e-43  30%  556 aa  RS1_HELPY RecName: Full=30S ribosomal protein S1;
   16::348     3e-42  31%  382 aa  RS1H_BACSU RecName: Full=30S ribosomal protein S1 homolog;
  298::631     6e-38  30%  635 aa  ISPH_CLOTE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
    7::277     1e-31  28%  328 aa  RS1A_SYNY3 RecName: Full=30S ribosomal protein S1 homolog A;
   31::271     7e-28  30%  307 aa  RS1_SYNP6 RecName: Full=30S ribosomal protein S1;
    1::267     5e-25  28%  295 aa  RS1_SYNE7 RecName: Full=30S ribosomal protein S1;
   96::335     9e-20  27%  411 aa  RR1_SPIOL RecName: Full=30S ribosomal protein S1,
   27::262     6e-19  28%  263 aa  RR1_PORYE RecName: Full=30S ribosomal protein S1, chloroplastic;
   27::262     6e-18  28%  263 aa  RR1_PORPU RecName: Full=30S ribosomal protein S1, chloroplastic;
    2::275     3e-17  26%  305 aa  RS1B_SYNY3 RecName: Full=30S ribosomal protein S1 homolog B;
  836::1296    4e-15  27% 1690 aa  RRP5_SCHPO RecName: Full=rRNA biogenesis protein rrp5;AltName:
 1315::1405    5e-15  30% 1862 aa  RRP5_MOUSE RecName: Full=Protein RRP5 homolog;AltName:
  184::604     5e-15  24% 1874 aa  RRP5_BOVIN RecName: Full=Protein RRP5 homolog;AltName:
 1140::1326    9e-15  30% 1729 aa  RRP5_YEAST RecName: Full=rRNA biogenesis protein RRP5;AltName:
  434::798     1e-13  26% 1871 aa  RRP5_HUMAN RecName: Full=Protein RRP5 homolog;AltName:
  569::703     2e-13  39%  716 aa  PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::703     2e-13  39%  714 aa  PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::703     2e-13  39%  716 aa  PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::703     2e-13  39%  716 aa  PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::689     2e-13  46%  777 aa  PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::687     3e-13  50%  755 aa  PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::687     3e-13  50%  755 aa  PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::687     3e-13  50%  755 aa  PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     5e-13  48%  747 aa  PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     5e-13  48%  746 aa  PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::686     6e-13  42%  710 aa  PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     8e-13  46%  700 aa  PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     8e-13  46%  700 aa  PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     8e-13  46%  700 aa  PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     8e-13  46%  700 aa  PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::705     8e-13  39%  708 aa  PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-12  46%  704 aa  PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-12  47%  757 aa  PNP_SORC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::715     1e-12  48%  762 aa  PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  543::679     1e-12  41%  702 aa  PNP_CLOPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::705     1e-12  40%  708 aa  PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::705     1e-12  40%  708 aa  PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-12  44%  708 aa  PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-12  51%  698 aa  PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-12  51%  698 aa  PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-12  51%  696 aa  PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-12  51%  696 aa  PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     2e-12  47%  700 aa  PNP_CLOTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  543::679     2e-12  41%  702 aa  PNP_CLOPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  543::679     2e-12  41%  702 aa  PNP_CLOP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     2e-12  47%  720 aa  PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     2e-12  47%  720 aa  PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     2e-12  52%  702 aa  PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::742     2e-12  33%  775 aa  PNP_AQUAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::678     3e-12  44%  699 aa  PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::693     3e-12  43%  732 aa  PNP_GEMAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     3e-12  47%  698 aa  PNP_ALHEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     4e-12  46%  692 aa  PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::680     4e-12  43%  721 aa  PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     5e-12  46%  703 aa  PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     5e-12  45%  772 aa  PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     5e-12  45%  695 aa  PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     5e-12  45%  695 aa  PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     5e-12  45%  695 aa  PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::680     5e-12  45%  695 aa  PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::689     5e-12  55%  711 aa  PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::693     7e-12  46%  700 aa  PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::693     7e-12  46%  700 aa  PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     7e-12  43%  700 aa  PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  610::677     7e-12  46%  696 aa  PNP_GEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  610::677     7e-12  46%  696 aa  PNP_GEOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  595::689     7e-12  47%  705 aa  PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::678     7e-12  52%  702 aa  PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  619::678     7e-12  52%  702 aa  PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  650::709     9e-12  50%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;
  614::681     9e-12  44%  708 aa  PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     9e-12  44%  708 aa  PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     9e-12  44%  709 aa  PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     9e-12  44%  709 aa  PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     9e-12  44%  712 aa  PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     9e-12  49%  723 aa  PNP_DESHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     9e-12  45%  693 aa  PNP_CHLMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::688     1e-11  47%  705 aa  PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::703     1e-11  37%  714 aa  PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     1e-11  46%  695 aa  PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::683     1e-11  45%  703 aa  PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     1e-11  45%  701 aa  PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     1e-11  43%  722 aa  PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::699     1e-11  40%  722 aa  PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  610::677     1e-11  46%  696 aa  PNP_GEOUR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     1e-11  46%  697 aa  PNP_GEOMG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     1e-11  50%  705 aa  PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  609::715     1e-11  38%  721 aa  PNP_ANADE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-11  51%  706 aa  PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     2e-11  45%  701 aa  PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     2e-11  45%  701 aa  PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::687     2e-11  47%  702 aa  PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     2e-11  46%  697 aa  PNP_GEOSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  610::677     2e-11  46%  696 aa  PNP_GEOSF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::685     2e-11  44%  769 aa  PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     2e-11  48%  708 aa  PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     2e-11  48%  708 aa  PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  609::715     2e-11  38%  721 aa  PNP_ANASK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  609::715     2e-11  38%  721 aa  PNP_ANAD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-11  41%  697 aa  PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::680     2e-11  47%  705 aa  PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     2e-11  41%  701 aa  PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::703     2e-11  48%  747 aa  PNP_MOOTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::681     2e-11  43%  703 aa  PNP_HAHCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::685     2e-11  44%  698 aa  PNP_ELUMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::691     2e-11  47%  727 aa  PNP_DESHY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     2e-11  48%  703 aa  PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     2e-11  41%  702 aa  PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::678     2e-11  50%  702 aa  PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  614::679     3e-11  44%  698 aa  PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     3e-11  44%  702 aa  PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     3e-11  46%  709 aa  PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::676     3e-11  50%  712 aa  PNP_BRAHW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  609::689     3e-11  43%  722 aa  PNP_ANADF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  602::697     3e-11  41%  734 aa  PNP_PELTS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::715     3e-11  46%  732 aa  PNP_NITSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  609::676     3e-11  44%  709 aa  PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     3e-11  41%  703 aa  PNP_GEOLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     3e-11  54%  705 aa  PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     3e-11  48%  704 aa  PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     3e-11  48%  704 aa  PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  600::687     3e-11  40%  697 aa  PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     4e-11  43%  771 aa  PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::692     4e-11  46%  722 aa  PNP_SACD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     4e-11  39%  701 aa  PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     4e-11  39%  701 aa  PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     4e-11  39%  701 aa  PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     4e-11  39%  701 aa  PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     4e-11  44%  709 aa  PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::677     4e-11  44%  706 aa  PNP_PELPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::686     4e-11  45%  705 aa  PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    1::80      4e-11  41%  130 aa  GS13_BACSU RecName: Full=General stress protein 13;       
  624::682     6e-11  49%  703 aa  PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  586::682     6e-11  36%  697 aa  PNP_BLOFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::682     6e-11  40%  697 aa  PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     8e-11  44%  709 aa  PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-11  43%  716 aa  PNP_IDILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::683     8e-11  41%  696 aa  PNP_COXBU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::683     8e-11  41%  696 aa  PNP_COXBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::683     8e-11  41%  696 aa  PNP_COXBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::683     8e-11  41%  696 aa  PNP_COXB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::683     8e-11  41%  696 aa  PNP_COXB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     8e-11  46%  694 aa  PNP_CHLFF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     8e-11  46%  694 aa  PNP_CHLCV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     8e-11  46%  694 aa  PNP_CHLAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    6::64      1e-10  46%  128 aa  YABR_BACSU RecName: Full=Uncharacterized protein yabR;
  621::679     1e-10  46%  702 aa  PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-10  46%  701 aa  PNP_SHEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     1e-10  46%  704 aa  PNP_SHEPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     1e-10  46%  704 aa  PNP_SHEHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  570::704     1e-10  37%  715 aa  PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     1e-10  46%  740 aa  PNP_DESRM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::709     1e-10  37%  733 aa  PNP_BARBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::708     1e-10  39%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     1e-10  44%  704 aa  PNP_SHESH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  535::687     1e-10  38%  718 aa  PNP_NATTJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::705     1e-10  35%  712 aa  PNP_CAUCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::705     1e-10  35%  712 aa  PNP_CAUCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     1e-10  43%  693 aa  PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     2e-10  46%  711 aa  PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     2e-10  46%  710 aa  PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  698 aa  PNP_TREDE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  574::685     2e-10  38%  690 aa  PNP_PELUB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  706 aa  PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-10  41%  723 aa  PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-10  41%  723 aa  PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-10  41%  723 aa  PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-10  41%  723 aa  PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-10  41%  723 aa  PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-10  41%  723 aa  PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::707     2e-10  35%  714 aa  PNP_FLAJ1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  706 aa  PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::714     2e-10  40%  717 aa  PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::679     2e-10  48%  701 aa  PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::705     2e-10  35%  716 aa  PNP_CAUSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     2e-10  47%  706 aa  PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     2e-10  41%  720 aa  PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  47%  705 aa  PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::685     2e-10  38%  704 aa  PNP_PSYWF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::689     2e-10  45%  746 aa  PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  47%  707 aa  PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     2e-10  49%  711 aa  PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::680     2e-10  47%  694 aa  PNP_CHLPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  657::723     3e-10  39%  736 aa  PNP_WOLSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  710 aa  PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::683     3e-10  47%  711 aa  PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  49%  711 aa  PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-10  47%  711 aa  PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::679     3e-10  47%  712 aa  PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::679     3e-10  51%  715 aa  PNP_ACTPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::679     3e-10  51%  715 aa  PNP_ACTP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::679     3e-10  51%  715 aa  PNP_ACTP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     4e-10  47%  774 aa  PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::709     4e-10  32%  711 aa  PNP_ROSDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     4e-10  43%  714 aa  PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::681     4e-10  44%  697 aa  PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  651::709     5e-10  47%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;
  613::678     5e-10  41%  748 aa  PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     5e-10  47%  705 aa  PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::698     5e-10  38%  743 aa  PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::698     5e-10  38%  743 aa  PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::700     5e-10  49%  730 aa  PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  681::741     5e-10  48%  755 aa  PNP_CORDI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     6e-10  49%  711 aa  PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::678     6e-10  51%  686 aa  PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     6e-10  41%  699 aa  PNP_PELCD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::691     6e-10  41%  710 aa  PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::689     6e-10  46%  806 aa  PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::684     8e-10  45%  701 aa  PNP_SOLUE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  700 aa  PNP_SHEB9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  700 aa  PNP_SHEB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  700 aa  PNP_SHEB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-10  37%  699 aa  PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     1e-09  40%  695 aa  PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::709     1e-09  37%  721 aa  PNP_SULDN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     1e-09  41%  737 aa  PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::704     1e-09  34%  745 aa  PNP_METEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::704     1e-09  34%  745 aa  PNP_METC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  564::694     1e-09  34%  714 aa  PNP_FINM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::692     1e-09  39%  698 aa  PNP_CLOPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     1e-09  40%  707 aa  PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  704 aa  PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  704 aa  PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  44%  705 aa  PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     1e-09  37%  772 aa  PNP_VARPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-09  46%  711 aa  PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     1e-09  35%  706 aa  PNP_RHOFD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     1e-09  35%  695 aa  PNP_NITOC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::723     1e-09  44%  755 aa  PNP_MYCA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::705     1e-09  37%  713 aa  PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-09  46%  709 aa  PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-09  46%  709 aa  PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-09  46%  709 aa  PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-09  46%  709 aa  PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     1e-09  40%  710 aa  PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     2e-09  40%  694 aa  PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::699     2e-09  41%  737 aa  PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::703     2e-09  32%  711 aa  PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     2e-09  37%  699 aa  PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     2e-09  38%  751 aa  PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::704     2e-09  34%  745 aa  PNP_METPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  605::683     2e-09  41%  729 aa  PNP_LEGPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  570::709     2e-09  33%  711 aa  PNP_DINSH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  601::696     2e-09  37%  741 aa  PNP_DESAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::683     2e-09  35%  779 aa  PNP_DEIRA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     2e-09  40%  693 aa  PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     2e-09  41%  707 aa  PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     2e-09  41%  707 aa  PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     2e-09  41%  707 aa  PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::720     2e-09  44%  873 aa  PNP_BIFA0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::677     2e-09  48%  704 aa  PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  624::691     2e-09  40%  713 aa  PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::691     2e-09  40%  713 aa  PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::702     2e-09  37%  710 aa  PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::699     2e-09  42%  728 aa  PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::679     2e-09  47%  709 aa  PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::677     2e-09  45%  695 aa  PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     2e-09  36%  753 aa  PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-09  40%  717 aa  PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  662::722     3e-09  46%  763 aa  PNP_MYCS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  605::683     3e-09  41%  729 aa  PNP_LEGPL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  605::683     3e-09  41%  729 aa  PNP_LEGPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  605::683     3e-09  41%  729 aa  PNP_LEGPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     3e-09  43%  714 aa  PNP_AKKM8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  212::302     4e-09  35% 1168 aa  PRP22_SCHPO RecName: Full=Pre-mRNA-splicing factor ATP-dependent
  576::702     4e-09  36%  707 aa  PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     4e-09  36%  703 aa  PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     4e-09  36%  727 aa  PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  703::763     4e-09  44%  775 aa  PNP_CORK4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::712     4e-09  40%  712 aa  PNP_BURP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::729     4e-09  46%  892 aa  PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::678     4e-09  39%  692 aa  PNP_ACIF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::676     4e-09  39%  690 aa  PNP_ACIF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::680     5e-09  44%  706 aa  PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::680     5e-09  44%  706 aa  PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     5e-09  34%  757 aa  PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  527::691     5e-09  31%  713 aa  PNP_THET8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  599::699     5e-09  38%  741 aa  PNP_STRTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  599::699     5e-09  38%  741 aa  PNP_STRT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  599::699     5e-09  38%  741 aa  PNP_STRT1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     5e-09  41%  698 aa  PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::685     5e-09  39%  700 aa  PNP_PSYA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     5e-09  36%  707 aa  PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::686     5e-09  37%  710 aa  PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::729     5e-09  45%  913 aa  PNP_BIFLO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::729     5e-09  45%  913 aa  PNP_BIFLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  599::679     5e-09  33%  710 aa  PNP_BACSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     5e-09  40%  699 aa  PNP_AZOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  597::690     5e-09  43%  815 aa  PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     7e-09  37%  709 aa  PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     7e-09  37%  709 aa  PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::699     7e-09  37%  709 aa  PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     7e-09  39%  698 aa  PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::685     7e-09  37%  700 aa  PNP_PSYCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     7e-09  44%  722 aa  PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     7e-09  44%  722 aa  PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-09  44%  709 aa  PNP_PERMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::690     7e-09  40%  720 aa  PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     7e-09  37%  708 aa  PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  661::721     7e-09  44%  754 aa  PNP_MYCVP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::723     7e-09  44%  756 aa  PNP_MYCGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     7e-09  40%  712 aa  PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     7e-09  42%  693 aa  PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     7e-09  42%  707 aa  PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     7e-09  38%  697 aa  PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     7e-09  41%  707 aa  PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     7e-09  35%  727 aa  PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::682     7e-09  34%  758 aa  PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     9e-09  39%  753 aa  PNP_RHOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::728     9e-09  43%  773 aa  PNP_MYCLE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::728     9e-09  43%  773 aa  PNP_MYCLB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::720     9e-09  47%  746 aa  PNP_KINRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::714     9e-09  45%  729 aa  PNP_CHLT3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     9e-09  41%  705 aa  PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     9e-09  41%  705 aa  PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::689     1e-08  41%  715 aa  PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::713     1e-08  38%  729 aa  PNP_SULNB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::687     1e-08  46%  733 aa  PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     1e-08  38%  710 aa  PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     1e-08  38%  710 aa  PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     1e-08  38%  710 aa  PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     1e-08  38%  710 aa  PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::688     1e-08  38%  701 aa  PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     1e-08  38%  710 aa  PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     1e-08  38%  710 aa  PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::689     1e-08  47%  712 aa  PNP_SALRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-08  42%  707 aa  PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::725     1e-08  44%  752 aa  PNP_MYCTU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::725     1e-08  44%  752 aa  PNP_MYCTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::718     1e-08  43%  759 aa  PNP_MYCSS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::718     1e-08  43%  759 aa  PNP_MYCSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::718     1e-08  43%  759 aa  PNP_MYCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  667::727     1e-08  44%  757 aa  PNP_MYCPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  667::727     1e-08  44%  762 aa  PNP_MYCMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::725     1e-08  44%  752 aa  PNP_MYCBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::725     1e-08  44%  752 aa  PNP_MYCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::725     1e-08  44%  752 aa  PNP_MYCBO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::718     1e-08  44%  748 aa  PNP_MYCA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::702     1e-08  39%  702 aa  PNP_MARMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::691     1e-08  42%  718 aa  PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  691::751     1e-08  44%  764 aa  PNP_CORJK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  683::743     1e-08  41%  756 aa  PNP_CORA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     1e-08  44%  707 aa  PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::729     1e-08  43%  914 aa  PNP_BIFLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::703     1e-08  34%  733 aa  PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  598::685     1e-08  38%  705 aa  PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     1e-08  38%  699 aa  PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::708     1e-08  36%  719 aa  PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     1e-08  40%  702 aa  PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     2e-08  36%  710 aa  PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     2e-08  36%  710 aa  PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     2e-08  36%  710 aa  PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::684     2e-08  34%  697 aa  PNP_STAS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  677::737     2e-08  44%  764 aa  PNP_NOCFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  667::727     2e-08  44%  762 aa  PNP_MYCUA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  597::684     2e-08  34%  704 aa  PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::681     2e-08  51%  693 aa  PNP_FERNB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::685     2e-08  35%  713 aa  PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     2e-08  35%  715 aa  PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     2e-08  35%  715 aa  PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     2e-08  35%  715 aa  PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     2e-08  39%  712 aa  PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    5::97      2e-08  38%  275 aa  IF2A_THEON RecName: Full=Translation initiation factor 2 subunit
  612::679     2e-08  34%  706 aa  PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::682     2e-08  36%  767 aa  PNP_LEPCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::686     2e-08  34%  711 aa  PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  601::704     2e-08  39%  711 aa  PNP_FLAPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::689     2e-08  42%  715 aa  PNP_CYAP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  678::738     2e-08  43%  752 aa  PNP_COREF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    5::97      2e-08  36%  275 aa  IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit
  623::690     3e-08  41%  717 aa  PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::686     3e-08  40%  697 aa  PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-08  44%  707 aa  PNP_SULAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::697     3e-08  40%  724 aa  PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  598::685     3e-08  40%  722 aa  PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::691     3e-08  41%  718 aa  PNP_CYAP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::725     3e-08  41%  746 aa  PNP_ARTS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::725     3e-08  44%  752 aa  PNP_ARTCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::725     3e-08  44%  750 aa  PNP_ARTAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    4::97      3e-08  36%  275 aa  IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit
  914::989     3e-08  41%  995 aa  SRBD1_PONAB RecName: Full=S1 RNA-binding domain-containing protein
  625::693     3e-08  35%  790 aa  PNP_THERP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     3e-08  37%  705 aa  PNP_NITEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  659::729     3e-08  44%  753 aa  PNP_MICLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::690     3e-08  41%  717 aa  PNP_MICAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::679     3e-08  48%  712 aa  PNP_HAEDU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::692     3e-08  40%  703 aa  PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::656     3e-08  56%  720 aa  PNP_DEHE1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::697     3e-08  42%  734 aa  PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::704     3e-08  31%  731 aa  PNP_BART1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::661     5e-08  51%  702 aa  PNP_STRMK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::661     5e-08  51%  702 aa  PNP_STRM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::684     5e-08  34%  701 aa  PNP_STACT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::728     5e-08  43%  756 aa  PNP_RHOE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     5e-08  40%  717 aa  PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::664     5e-08  55%  701 aa  PNP_MAGSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  664::734     5e-08  44%  751 aa  PNP_KOCRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::680     5e-08  37%  716 aa  PNP_HAMD5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  598::685     5e-08  41%  723 aa  PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::681     5e-08  41%  703 aa  PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::716     5e-08  42%  716 aa  PNP_BURXL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::690     5e-08  41%  718 aa  PNP_ANAVT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::690     5e-08  41%  718 aa  PNP_ANASP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    5::97      5e-08  38%  273 aa  IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit
    4::97      5e-08  37%  275 aa  IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit
  613::669     6e-08  39%  693 aa  PNP_THISH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::686     6e-08  44%  760 aa  PNP_DESVV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::686     6e-08  44%  756 aa  PNP_DESVM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::686     6e-08  44%  760 aa  PNP_DESVH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::688     6e-08  41%  743 aa  PNP_DESDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     6e-08  34%  715 aa  PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     6e-08  34%  713 aa  PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     6e-08  34%  715 aa  PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     6e-08  34%  715 aa  PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::685     6e-08  36%  719 aa  PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::685     6e-08  36%  718 aa  PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  651::715     6e-08  44%  744 aa  PNP_BEUC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::692     6e-08  36%  733 aa  PNP_BARHE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     6e-08  41%  709 aa  PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  919::989     8e-08  42%  995 aa  SRBD1_HUMAN RecName: Full=S1 RNA-binding domain-containing protein
  623::681     8e-08  41%  709 aa  PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     8e-08  41%  709 aa  PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::713     8e-08  43%  740 aa  PNP_STRAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::684     8e-08  32%  701 aa  PNP_STAES RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::684     8e-08  32%  701 aa  PNP_STAEQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::712     8e-08  41%  786 aa  PNP_SALAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::728     8e-08  43%  757 aa  PNP_RHOSR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::728     8e-08  43%  757 aa  PNP_RHOOB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::692     8e-08  43%  725 aa  PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::692     8e-08  43%  723 aa  PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::690     8e-08  38%  718 aa  PNP_NOSP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::679     8e-08  35%  701 aa  PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::669     8e-08  43%  696 aa  PNP_LEPBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::669     8e-08  43%  696 aa  PNP_LEPBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::688     8e-08  45%  704 aa  PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::692     8e-08  43%  723 aa  PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURP0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  713 aa  PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  714 aa  PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     8e-08  34%  714 aa  PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     8e-08  37%  712 aa  PNP_BACCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::704     8e-08  35%  710 aa  PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::713     8e-08  43%  782 aa  PNP_ACIC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    4::100     8e-08  35%  275 aa  IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit
  659::719     1e-07  43%  750 aa  PNP_SACEN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  651::721     1e-07  40%  746 aa  PNP_RENSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  652::730     1e-07  39%  733 aa  PNP_PROAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::687     1e-07  34%  718 aa  PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  603::685     1e-07  37%  712 aa  PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  652::712     1e-07  39%  785 aa  PNP_SALTO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::692     1e-07  41%  728 aa  PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-07  41%  716 aa  PNP_GLUOX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::697     1e-07  37%  733 aa  PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  641::722     1e-07  43%  736 aa  PNP_CHLL2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  651::721     2e-07  43%  742 aa  PNP_NOCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::708     2e-07  39%  729 aa  PNP_FRASC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  646::709     2e-07  39%  729 aa  PNP_FRAAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::691     2e-07  45%  693 aa  PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  692::752     2e-07  36%  765 aa  PNP_CORU7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  534::711     2e-07  32%  722 aa  PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::660     2e-07  52%  701 aa  PNP_CALS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::685     2e-07  34%  719 aa  PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::685     2e-07  34%  719 aa  PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::685     2e-07  34%  719 aa  PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     2e-07  42%  704 aa  PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  939::1014    2e-07  41% 1015 aa  SRBD1_MOUSE RecName: Full=S1 RNA-binding domain-containing protein 1;
  611::678     2e-07  38%  707 aa  PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     2e-07  41%  708 aa  PNP_THESQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     2e-07  41%  708 aa  PNP_THEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::682     2e-07  41%  708 aa  PNP_THEMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  592::678     2e-07  41%  710 aa  PNP_THELT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::689     2e-07  39%  716 aa  PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::689     2e-07  39%  716 aa  PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::682     2e-07  35%  706 aa  PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::683     2e-07  35%  707 aa  PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::682     2e-07  35%  706 aa  PNP_NEIMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::682     2e-07  35%  706 aa  PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::697     2e-07  32%  709 aa  PNP_HELHP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::708     2e-07  38%  729 aa  PNP_FRASN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::696     2e-07  37%  732 aa  PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::660     2e-07  52%  701 aa  PNP_ANATD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  271::349     2e-07  47% 1244 aa  DHX8_MOUSE RecName: Full=ATP-dependent RNA helicase DHX8;       
  247::325     2e-07  47% 1220 aa  DHX8_HUMAN RecName: Full=ATP-dependent RNA helicase DHX8;       
  632::697     3e-07  42%  732 aa  PNP_PELLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::688     3e-07  38%  773 aa  PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::719     3e-07  39%  732 aa  PNP_CHLPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::680     3e-07  40%  710 aa  PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   12::84      3e-07  46%  266 aa  IF2A_METJA RecName: Full=Translation initiation factor 2 subunit
  616::682     4e-07  38%  707 aa  PNP_THENN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::684     4e-07  46%  703 aa  PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::713     4e-07  43%  737 aa  PNP_STRGG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::701     4e-07  34%  712 aa  PNP_RHIEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::704     4e-07  31%  715 aa  PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::682     4e-07  34%  701 aa  PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::683     4e-07  33%  721 aa  PNP_DEIGD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::713     5e-07  43%  739 aa  PNP_STRCO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::713     5e-07  43%  738 aa  PNP_STRAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::701     5e-07  34%  712 aa  PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::692     5e-07  39%  715 aa  PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::701     5e-07  34%  712 aa  PNP_RHIL3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::682     5e-07  34%  706 aa  PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::683     5e-07  34%  707 aa  PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::685     5e-07  39%  707 aa  PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::678     5e-07  47%  691 aa  PNP_METCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::707     5e-07  40%  750 aa  PNP_GRAFK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     5e-07  37%  715 aa  PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  647::715     7e-07  35%  728 aa  PNP_SULMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     7e-07  36%  717 aa  PNP_RHISN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::691     7e-07  36%  712 aa  PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::668     7e-07  43%  701 aa  PNP_PSESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  605::685     7e-07  37%  705 aa  PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::659     7e-07  46%  704 aa  PNP_MANSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::658     7e-07  54%  712 aa  PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::697     7e-07  39%  728 aa  PNP_CHLCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::691     7e-07  41%  713 aa  PNP_AGRT5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::715     9e-07  41%  767 aa  PNP_THEFY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::704     9e-07  36%  718 aa  PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     9e-07  42%  738 aa  PNP_EXISA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     9e-07  34%  796 aa  PNP_EHRCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::662     9e-07  50%  713 aa  PNP_AERS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     1e-06  31%  747 aa  PNP_RICCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  568::692     1e-06  34%  717 aa  PNP_RHIME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::718     1e-06  31%  732 aa  PNP_CAMC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   12::84      1e-06  41%  267 aa  IF2A_METKA RecName: Full=Translation initiation factor 2 subunit
  669::710     1e-06  52%  791 aa  TEX_BORPE RecName: Full=Protein tex;
  623::692     1e-06  40%  714 aa  PNP_SINMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::697     1e-06  40%  732 aa  PNP_PROVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     1e-06  36%  715 aa  PNP_MESSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::686     1e-06  40%  750 aa  PNP_DESDG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::702     1e-06  41%  715 aa  PNP_ACHLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::678     2e-06  37%  725 aa  RNR_MYCPU RecName: Full=Ribonuclease R;         Short=RNase R;     
  624::667     2e-06  48%  714 aa  PNP_SYNP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     2e-06  32%  745 aa  PNP_RICM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     2e-06  32%  747 aa  PNP_RICFE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::667     2e-06  45%  721 aa  PNP_PROM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::689     2e-06  38%  757 aa  PNP_NEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     2e-06  32%  796 aa  PNP_EHRCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     2e-06  42%  693 aa  PNP_DICT6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  661::731     2e-06  40%  757 aa  PNP_CLAMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  661::731     2e-06  40%  757 aa  PNP_CLAM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  106::218     2e-06  36%  495 aa  NUSA_HAEIN RecName: Full=Transcription elongation protein nusA;
    9::82      2e-06  39%  254 aa  IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit
   15::91      2e-06  38%  262 aa  IF2A_METTH RecName: Full=Translation initiation factor 2 subunit
  623::681     3e-06  32%  748 aa  PNP_RICRS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     3e-06  32%  748 aa  PNP_RICRO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     3e-06  32%  748 aa  PNP_RICPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     3e-06  32%  749 aa  PNP_RICCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     3e-06  34%  744 aa  PNP_RICBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     3e-06  34%  744 aa  PNP_RICB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     3e-06  32%  748 aa  PNP_RICAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::669     3e-06  45%  723 aa  PNP_PROMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::686     3e-06  36%  739 aa  PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  234::295     3e-06  36% 1200 aa  MOG5_CAEEL RecName: Full=Probable pre-mRNA-splicing factor
   35::81      3e-06  40%  254 aa  IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit
   43::88      3e-06  46%  267 aa  IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit
  587::729     3e-06  35%  782 aa  ZAM_SYNY3 RecName: Full=Acetazolamide conferring resistance protein
  621::686     3e-06  35%  702 aa  PNP_SPICI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     3e-06  32%  736 aa  PNP_ORITI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::686     3e-06  32%  740 aa  PNP_ORITB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::680     3e-06  37%  703 aa  PNP_MACCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  587::694     3e-06  41%  713 aa  PNP_GLOVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  567::691     3e-06  34%  714 aa  PNP_AGRVS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  216::273     3e-06  45% 1168 aa  DHX8_ARATH RecName: Full=Probable pre-mRNA-splicing factor
  624::663     4e-06  48%  721 aa  PNP_SYNSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     4e-06  48%  721 aa  PNP_SYNPX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::684     4e-06  28%  700 aa  PNP_STAHJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::688     4e-06  32%  789 aa  PNP_EHRRW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::688     4e-06  32%  789 aa  PNP_EHRRG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::701     6e-06  43%  779 aa  RNR_BACSU RecName: Full=Ribonuclease R;         Short=RNase R;     
  611::653     6e-06  44%  689 aa  PNP_UNCTG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  48%  721 aa  PNP_SYNS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  50%  719 aa  PNP_SYNR3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  48%  721 aa  PNP_SYNPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::666     6e-06  43%  712 aa  PNP_SYNJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  50%  721 aa  PNP_PROMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  48%  722 aa  PNP_PROMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  50%  721 aa  PNP_PROM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  50%  721 aa  PNP_PROM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  668::738     6e-06  40%  761 aa  PNP_LEIXX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::661     6e-06  42%  699 aa  PNP_BLOPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     6e-06  48%  716 aa  PNP_ACAM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  226::274     6e-06  51% 1160 aa  DHX8_DICDI RecName: Full=ATP-dependent RNA helicase dhx8;       
  626::684     7e-06  32%  698 aa  PNP_STAAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::684     7e-06  32%  698 aa  PNP_STAA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     7e-06  31%  745 aa  PNP_RICTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     7e-06  32%  747 aa  PNP_RICAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     7e-06  45%  722 aa  PNP_PROMT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     7e-06  50%  721 aa  PNP_PROMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     7e-06  50%  721 aa  PNP_PROM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     7e-06  45%  722 aa  PNP_PROM4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     7e-06  45%  722 aa  PNP_PROM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     7e-06  50%  721 aa  PNP_PROM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  634::689     7e-06  44%  734 aa  PNP_PROA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::665     1e-05  45%  718 aa  PNP_SYNY3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::663     1e-05  45%  721 aa  PNP_SYNS9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  608::659     1e-05  42%  703 aa  PNP_SULSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::681     1e-05  31%  745 aa  PNP_RICPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::679     1e-05  43%  713 aa  PNP_HAES2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::679     1e-05  43%  713 aa  PNP_HAES1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::665     1e-05  45%  715 aa  PNP_CYAA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::696     1e-05  32%  838 aa  PNP_ANAPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::680     1e-05  46%  757 aa  YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;
  640::680     1e-05  46%  757 aa  YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;
  579::692     1e-05  35%  713 aa  PNP_OCHA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    5::72      1e-05  36%  241 aa  NO40_MOUSE RecName: Full=Nucleolar protein of 40 kDa;       
    5::72      1e-05  36%  241 aa  NO40_HUMAN RecName: Full=Nucleolar protein of 40 kDa;       
    9::74      1e-05  34%  266 aa  IF2A_HALMA RecName: Full=Translation initiation factor 2 subunit
  180::239     2e-05  39% 1145 aa  PRP22_YEAST RecName: Full=Pre-mRNA-splicing factor ATP-dependent
  613::680     2e-05  29%  705 aa  PNP_WIGBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::659     2e-05  38%  714 aa  PNP_METFK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::702     2e-05  29%  706 aa  PNP_JANSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::712     2e-05  59%  753 aa  PNP_CORGL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::712     2e-05  59%  753 aa  PNP_CORGB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  604::684     2e-05  38%  697 aa  PNP_COPPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUSI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUO2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  579::692     2e-05  35%  714 aa  PNP_BRUA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::704     2e-05  39%  725 aa  PNP_ARCB4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   12::88      2e-05  37%  260 aa  IF2A_METST RecName: Full=Translation initiation factor 2 subunit
  620::661     2e-05  43%  712 aa  PNP_SYNJB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::664     2e-05  48%  720 aa  PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::683     2e-05  29%  721 aa  PNP_DEIDV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  664::738     3e-05  33%  738 aa  PNP_TROWT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  661::735     3e-05  33%  735 aa  PNP_TROW8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::661     3e-05  39%  732 aa  PNP_STRU0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::688     3e-05  40%  728 aa  PNP_PELPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   12::88      3e-05  36%  265 aa  IF2A_METS3 RecName: Full=Translation initiation factor 2 subunit
  641::719     4e-05  28%  719 aa  PNP_CAMJE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  611::660     4e-05  42%  717 aa  PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::742     4e-05  34%  783 aa  PNPT1_MOUSE RecName: Full=Polyribonucleotide nucleotidyltransferase
  629::686     5e-05  31%  736 aa  PNP_LAWIP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::692     5e-05  41%  702 aa  PNP_CAMLR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  644::716     6e-05  46%  813 aa  RNR_SHIFL RecName: Full=Ribonuclease R;         Short=RNase R;     
  644::716     6e-05  46%  813 aa  RNR_ECOLI RecName: Full=Ribonuclease R;         Short=RNase R;     
  625::666     6e-05  43%  730 aa  PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  565::654     6e-05  38%  712 aa  PNP_GLUDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::697     6e-05  34%  731 aa  PNP_CARHZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::678     8e-05  35%  702 aa  PNP_TREPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  613::678     8e-05  35%  702 aa  PNP_TREPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::707     8e-05  28%  735 aa  PNP_CAMC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::742     8e-05  32%  783 aa  PNPT1_HUMAN RecName: Full=Polyribonucleotide nucleotidyltransferase
   10::81      8e-05  40%  267 aa  IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit
   10::81      8e-05  40%  267 aa  IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit
  625::696     1e-04  43%  710 aa  RNR_THEMA RecName: Full=Ribonuclease R;         Short=RNase R;     
  623::668     1e-04  39%  699 aa  PNP_THEM4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::670     1e-04  43%  739 aa  PNP_STRSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::670     1e-04  43%  739 aa  PNP_STRS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  566::655     1e-04  39%  708 aa  PNP_RHORT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::676     1e-04  43%  703 aa  PNP_HYDS0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::658     1e-04  44%  724 aa  PNP_AZOC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  679::742     1e-04  32%  783 aa  PNPT1_PONAB RecName: Full=Polyribonucleotide nucleotidyltransferase
  637::706     1e-04  41%  817 aa  RNR1_LACLA RecName: Full=Ribonuclease R 1;         Short=RNase R 1;
  619::663     1e-04  40%  695 aa  PNP_PETMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  107::203     1e-04  34%  496 aa  NUSA_BUCAI RecName: Full=Transcription elongation protein nusA;
  624::664     2e-04  41%  730 aa  PNP_STRMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::659     2e-04  47%  720 aa  PNP_GRABC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  657::718     2e-04  31%  718 aa  PNP_CAMJD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  107::203     2e-04  33%  495 aa  NUSA_SHIFL RecName: Full=Transcription elongation protein
  107::203     2e-04  33%  495 aa  NUSA_ECOLI RecName: Full=Transcription elongation protein
  107::203     2e-04  33%  495 aa  NUSA_ECOL6 RecName: Full=Transcription elongation protein
  107::203     2e-04  33%  495 aa  NUSA_ECO57 RecName: Full=Transcription elongation protein
  107::203     2e-04  34%  495 aa  NUSA_BUCAP RecName: Full=Transcription elongation protein nusA;
  624::661     3e-04  42%  714 aa  PNP_STRS7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::661     3e-04  42%  714 aa  PNP_STREM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::661     3e-04  42%  714 aa  PNP_STRE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  669::714     3e-04  37%  728 aa  PNP_PHYMT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::683     3e-04  38%  711 aa  PNP_CAMHC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   85::168     4e-04  41%  187 aa  RPOE1_METJA RecName: Full=DNA-directed RNA polymerase subunit E';  
  666::715     4e-04  34%  728 aa  PNP_CAMFF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::664     4e-04  38%  715 aa  PNP_BREBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  652::722     5e-04  42%  821 aa  RNR_VIBCH RecName: Full=Ribonuclease R;         Short=RNase R;     
  578::656     5e-04  36%  739 aa  PNP_METRJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::673     5e-04  39%  769 aa  PNP_LACLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::673     5e-04  39%  766 aa  PNP_LACLM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::656     5e-04  42%  719 aa  PNP_BRASO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::656     5e-04  36%  720 aa  PNP_BRAJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  100::156     7e-04  48%  183 aa  RPOE_SULAC RecName: Full=DNA-directed RNA polymerase subunit E;    
  618::679     7e-04  32%  688 aa  PNP_HELPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::679     7e-04  32%  688 aa  PNP_HELP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  578::656     7e-04  41%  720 aa  PNP_BRASB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  134::190     9e-04  32%  761 aa  Y1198_METJA RecName: Full=Uncharacterized protein MJ1198;
  579::636     9e-04  38%  665 aa  RNR2_LACLA RecName: Full=Ribonuclease R 2;         Short=RNase R 2;
  578::656     9e-04  37%  725 aa  PNP_METS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::679     9e-04  32%  688 aa  PNP_HELPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::679     9e-04  32%  688 aa  PNP_HELPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRATF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::681     9e-04  35%  693 aa  PNP_FRAT1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  187::318     9e-12  32%  411 aa  RR1_SPIOL RecName: Full=30S ribosomal protein S1,(query 297->439)
  158::251     5e-09  35%  305 aa  RS1B_SYNY3 RecName: Full=30S ribosomal protein S1 homolog B;(query 342->439)
  625::683     2e-08  41%  716 aa  PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::715     9e-07  40%  716 aa  PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->123)
  625::683     2e-08  41%  714 aa  PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::713     5e-07  43%  714 aa  PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  625::683     2e-08  41%  716 aa  PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::704     1e-06  39%  716 aa  PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->116)
  625::683     2e-08  41%  716 aa  PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::704     1e-06  39%  716 aa  PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->116)
  629::696     1e-10  46%  777 aa  PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  623::701     6e-08  34%  777 aa  PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  644::712     4e-05  34%  777 aa  PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 135->201)
  628::695     3e-10  43%  755 aa  PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::700     2e-07  34%  755 aa  PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  643::704     1e-05  40%  755 aa  PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 135->194)
  628::695     2e-10  43%  755 aa  PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::700     1e-07  34%  755 aa  PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  643::704     7e-06  40%  755 aa  PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 135->194)
  628::695     3e-10  43%  755 aa  PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::700     2e-07  34%  755 aa  PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  643::704     1e-05  40%  755 aa  PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 135->194)
  628::695     3e-10  41%  747 aa  PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::700     3e-07  29%  747 aa  PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  647::701     7e-06  39%  747 aa  PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 227->280)
  628::695     3e-10  41%  746 aa  PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::700     3e-07  29%  746 aa  PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  647::701     7e-06  39%  746 aa  PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 227->280)
  621::697     2e-10  40%  710 aa  PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->365)
  628::697     1e-05  33%  710 aa  PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->105)
  623::696     4e-09  38%  700 aa  PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->369)
  604::696     3e-07  37%  700 aa  PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 17->109)
  623::696     4e-09  38%  700 aa  PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->369)
  604::696     3e-07  37%  700 aa  PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 17->109)
  623::696     4e-09  38%  700 aa  PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->369)
  604::696     2e-07  37%  700 aa  PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 17->109)
  623::696     4e-09  38%  700 aa  PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->369)
  604::696     3e-07  37%  700 aa  PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 17->109)
  629::689     7e-12  50%  708 aa  PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->440)
  629::699     2e-05  30%  708 aa  PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  623::690     9e-09  43%  704 aa  PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  623::690     9e-09  43%  704 aa  PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  620::697     3e-06  37%  704 aa  PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->110)
  622::683     1e-10  48%  757 aa  PNP_SORC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->355)
  634::701     3e-11  47%  762 aa  PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  627::711     7e-06  39%  762 aa  PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->104)
  614::698     5e-08  37%  702 aa  PNP_CLOPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->111)
  629::689     5e-12  52%  708 aa  PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->440)
  653::705     4e-06  38%  708 aa  PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  629::699     2e-05  31%  708 aa  PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  629::689     5e-12  52%  708 aa  PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->440)
  653::705     4e-06  38%  708 aa  PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  629::699     2e-05  31%  708 aa  PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  623::691     6e-11  49%  708 aa  PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  616::693     2e-05  36%  708 aa  PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 25->105)
  648::692     2e-05  51%  708 aa  PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  621::680     1e-09  48%  698 aa  PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  619::697     2e-05  34%  698 aa  PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->111)
  621::680     1e-09  48%  698 aa  PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  619::697     2e-05  34%  698 aa  PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->111)
  621::680     1e-09  48%  696 aa  PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  619::690     4e-05  36%  696 aa  PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->104)
  621::680     1e-09  48%  696 aa  PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  619::690     4e-05  36%  696 aa  PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->104)
  616::700     3e-08  32%  700 aa  PNP_CLOTH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->114)
  614::698     6e-08  37%  702 aa  PNP_CLOPE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->111)
  614::698     6e-08  37%  702 aa  PNP_CLOP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->111)
  620::682     2e-09  43%  720 aa  PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->357)
  613::690     2e-05  31%  720 aa  PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  620::682     2e-09  43%  720 aa  PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->357)
  613::690     2e-05  31%  720 aa  PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  627::684     1e-08  48%  702 aa  PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  627::684     1e-08  48%  702 aa  PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  627::684     1e-08  48%  702 aa  PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  627::684     1e-08  48%  702 aa  PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  627::684     1e-08  48%  702 aa  PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  627::684     1e-08  48%  702 aa  PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  627::684     1e-08  48%  702 aa  PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  615::689     1e-04  36%  702 aa  PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->103)
  564::695     2e-11  38%  699 aa  PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 249->369)
  552::695     4e-07  31%  699 aa  PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->195)
  619::677     5e-10  49%  732 aa  PNP_GEMAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::695     1e-10  45%  698 aa  PNP_ALHEH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  612::686     4e-11  47%  692 aa  PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->360)
  601::690     2e-06  31%  692 aa  PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  644::691     2e-04  42%  692 aa  PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->280)
  601::695     5e-10  42%  721 aa  PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 269->370)
  597::691     2e-06  37%  721 aa  PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 17->106)
  621::695     3e-08  36%  703 aa  PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->370)
  645::695     2e-04  39%  703 aa  PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  615::689     8e-11  43%  772 aa  PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  642::692     8e-05  39%  772 aa  PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->279)
  621::695     1e-09  45%  695 aa  PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  615::690     5e-04  28%  695 aa  PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->104)
  621::695     1e-09  45%  695 aa  PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  615::690     5e-04  28%  695 aa  PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->104)
  621::695     1e-09  45%  695 aa  PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  615::690     5e-04  28%  695 aa  PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->104)
  621::695     1e-09  45%  695 aa  PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  615::690     5e-04  28%  695 aa  PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->104)
  628::708     1e-11  40%  711 aa  PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->373)
  629::710     2e-06  37%  711 aa  PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->111)
  653::705     6e-06  38%  711 aa  PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  611::678     2e-11  46%  700 aa  PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  602::688     3e-06  34%  700 aa  PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->104)
  611::678     2e-11  46%  700 aa  PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  602::688     3e-06  34%  700 aa  PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->104)
  614::693     8e-11  39%  700 aa  PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->368)
  611::696     4e-05  37%  700 aa  PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 19->111)
  645::693     5e-04  43%  700 aa  PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  543::688     3e-11  37%  696 aa  PNP_GEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->365)
  543::696     9e-12  38%  696 aa  PNP_GEOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->367)
  615::680     7e-12  42%  705 aa  PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  606::688     2e-05  39%  705 aa  PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->102)
  594::679     2e-10  41%  702 aa  PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 262->355)
  597::686     1e-04  31%  702 aa  PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 9->103)
  594::700     2e-11  38%  702 aa  PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 262->377)
  597::689     2e-05  31%  702 aa  PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 9->106)
  651::720     4e-09  41%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;(query 294->364)
  648::720     7e-07  37%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;(query 30->104)
  616::690     5e-10  43%  708 aa  PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  613::689     8e-05  36%  708 aa  PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 19->102)
  616::690     5e-10  43%  708 aa  PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  613::689     8e-05  36%  708 aa  PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 19->102)
  616::690     5e-10  43%  709 aa  PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  613::692     2e-05  36%  709 aa  PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 19->105)
  616::690     5e-10  43%  709 aa  PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  613::692     2e-05  36%  709 aa  PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 19->105)
  616::690     5e-10  43%  712 aa  PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  613::692     2e-05  36%  712 aa  PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 19->105)
  620::707     5e-09  41%  723 aa  PNP_DESHD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->370)
  620::691     2e-09  46%  693 aa  PNP_CHLMU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->366)
  613::696     1e-10  46%  705 aa  PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 275->360)
  630::699     1e-05  40%  705 aa  PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->105)
  625::683     3e-09  41%  714 aa  PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::712     1e-06  32%  714 aa  PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->123)
  622::688     2e-09  42%  695 aa  PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->360)
  622::691     2e-09  44%  701 aa  PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  624::693     2e-09  44%  703 aa  PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  649::693     9e-04  42%  703 aa  PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     2e-09  44%  701 aa  PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  621::680     2e-10  53%  722 aa  PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  604::691     3e-07  35%  722 aa  PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->105)
  634::712     2e-08  35%  722 aa  PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  629::716     2e-04  40%  722 aa  PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 113->195)
  665::709     9e-04  44%  722 aa  PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  591::688     1e-09  42%  696 aa  PNP_GEOUR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 259->365)
  557::689     2e-09  41%  697 aa  PNP_GEOMG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 242->365)
  626::683     3e-09  50%  705 aa  PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  614::689     6e-05  36%  705 aa  PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->104)
  624::719     1e-06  34%  721 aa  PNP_ANADE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->124)
  620::689     5e-10  43%  706 aa  PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  621::691     2e-05  34%  706 aa  PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->106)
  622::691     2e-09  44%  701 aa  PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     9e-04  42%  701 aa  PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::691     1e-09  46%  701 aa  PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     7e-04  44%  701 aa  PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  628::702     2e-09  40%  702 aa  PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  626::702     1e-05  35%  702 aa  PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->109)
  557::689     2e-09  41%  697 aa  PNP_GEOSL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 242->365)
  591::688     1e-09  42%  696 aa  PNP_GEOSF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 259->365)
  647::697     1e-05  41%  769 aa  PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->279)
  610::707     4e-05  30%  769 aa  PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 15->117)
  620::694     6e-10  43%  708 aa  PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  614::707     4e-06  32%  708 aa  PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->121)
  620::694     6e-10  43%  708 aa  PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  614::707     4e-06  32%  708 aa  PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->121)
  624::719     1e-06  34%  721 aa  PNP_ANASK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->124)
  624::719     1e-06  34%  721 aa  PNP_ANAD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->124)
  623::697     2e-09  39%  697 aa  PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  609::696     1e-04  39%  697 aa  PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->110)
  626::696     6e-10  39%  705 aa  PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 298->370)
  646::699     7e-06  39%  705 aa  PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->286)
  615::691     1e-09  39%  701 aa  PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->364)
  623::697     3e-05  37%  701 aa  PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  647::691     6e-05  49%  701 aa  PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  630::713     2e-08  42%  747 aa  PNP_MOOTA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->365)
  614::696     1e-10  39%  703 aa  PNP_HAHCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 285->369)
  631::685     3e-09  51%  698 aa  PNP_ELUMP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 298->353)
  620::702     4e-07  40%  727 aa  PNP_DESHY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->365)
  620::683     3e-09  50%  703 aa  PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  614::702     1e-06  30%  703 aa  PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->117)
  616::692     1e-09  39%  702 aa  PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->364)
  624::698     3e-05  37%  702 aa  PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  648::692     6e-05  49%  702 aa  PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  594::693     3e-10  38%  702 aa  PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 262->370)
  619::689     3e-05  31%  702 aa  PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 33->106)
  620::688     1e-10  50%  698 aa  PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  614::694     7e-06  40%  698 aa  PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->111)
  645::689     3e-04  49%  698 aa  PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  623::692     2e-09  44%  702 aa  PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  608::698     5e-05  36%  702 aa  PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->110)
  648::692     4e-04  47%  702 aa  PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  615::689     2e-07  38%  709 aa  PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  619::694     2e-05  34%  709 aa  PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->108)
  618::692     9e-09  45%  712 aa  PNP_BRAHW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->370)
  622::689     1e-10  38%  722 aa  PNP_ANADF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  655::727     3e-10  45%  732 aa  PNP_NITSB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 290->365)
  562::687     6e-11  41%  709 aa  PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 249->365)
  615::688     1e-06  36%  709 aa  PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->106)
  624::703     9e-09  41%  703 aa  PNP_GEOLS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->369)
  626::679     1e-08  50%  705 aa  PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->353)
  616::689     3e-06  34%  705 aa  PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  635::696     9e-04  35%  705 aa  PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 135->195)
  626::683     3e-08  47%  704 aa  PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  614::691     7e-07  36%  704 aa  PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  626::683     3e-08  47%  704 aa  PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  614::691     7e-07  36%  704 aa  PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->106)
  625::683     1e-09  39%  697 aa  PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  601::695     8e-05  28%  697 aa  PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 5->106)
  616::690     8e-10  42%  771 aa  PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  614::696     2e-05  29%  771 aa  PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 24->109)
  643::693     3e-05  43%  771 aa  PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->279)
  638::702     2e-08  40%  722 aa  PNP_SACD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 298->364)
  622::691     3e-09  43%  701 aa  PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     2e-05  51%  701 aa  PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  623::697     2e-05  37%  701 aa  PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  622::691     3e-09  43%  701 aa  PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     2e-05  51%  701 aa  PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  623::697     2e-05  37%  701 aa  PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  622::691     3e-09  43%  701 aa  PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  647::691     2e-05  51%  701 aa  PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  623::697     2e-05  37%  701 aa  PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  622::691     3e-09  43%  701 aa  PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  607::697     1e-05  36%  701 aa  PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->110)
  647::691     2e-05  51%  701 aa  PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  615::689     5e-08  41%  709 aa  PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  598::690     9e-07  37%  709 aa  PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 5->104)
  619::692     7e-09  48%  706 aa  PNP_PELPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->363)
  621::697     6e-10  42%  705 aa  PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->365)
  620::703     4e-06  32%  705 aa  PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 25->111)
    1::66      3e-09  39%  130 aa  GS13_BACSU RecName: Full=General stress protein 13;       (query 374->439)
    8::75      1e-06  38%  130 aa  GS13_BACSU RecName: Full=General stress protein 13;       (query 33->102)
   33::78      1e-05  46%  130 aa  GS13_BACSU RecName: Full=General stress protein 13;       (query 233->278)
  623::698     2e-10  45%  703 aa  PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->370)
  648::698     6e-05  43%  703 aa  PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  624::694     2e-04  35%  697 aa  PNP_BLOFL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->106)
  629::695     3e-09  42%  697 aa  PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     2e-04  34%  697 aa  PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  629::695     3e-09  42%  697 aa  PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     2e-04  34%  697 aa  PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  629::695     3e-09  42%  697 aa  PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     1e-04  34%  697 aa  PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  629::695     3e-09  42%  697 aa  PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     2e-04  34%  697 aa  PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  629::695     3e-09  42%  697 aa  PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     2e-04  34%  697 aa  PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  629::695     3e-09  42%  697 aa  PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     2e-04  34%  697 aa  PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  629::695     1e-09  42%  697 aa  PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->367)
  621::695     4e-07  39%  697 aa  PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->107)
  621::692     1e-04  35%  697 aa  PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 206->277)
  627::689     2e-07  44%  709 aa  PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  619::691     1e-05  36%  709 aa  PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->105)
  620::688     9e-09  46%  716 aa  PNP_IDILO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  624::694     8e-08  35%  696 aa  PNP_COXBU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  624::694     8e-08  35%  696 aa  PNP_COXBR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  624::694     8e-08  35%  696 aa  PNP_COXBN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  624::694     8e-08  35%  696 aa  PNP_COXB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  624::694     8e-08  35%  696 aa  PNP_COXB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  620::691     6e-08  42%  694 aa  PNP_CHLFF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->366)
  620::691     6e-08  42%  694 aa  PNP_CHLCV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->366)
  620::691     8e-08  42%  694 aa  PNP_CHLAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->366)
    5::90      2e-10  35%  128 aa  YABR_BACSU RecName: Full=Uncharacterized protein yabR;(query 293->380)
  621::688     7e-09  43%  702 aa  PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  621::688     7e-09  43%  701 aa  PNP_SHEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  624::691     7e-09  43%  704 aa  PNP_SHEPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  624::691     7e-09  43%  704 aa  PNP_SHEHH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  626::684     5e-08  41%  715 aa  PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  626::714     6e-05  38%  715 aa  PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  607::711     2e-09  38%  740 aa  PNP_DESRM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->369)
  633::692     1e-09  43%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->440)
  657::713     2e-07  35%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->288)
  613::702     2e-04  31%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->104)
  624::691     7e-09  43%  704 aa  PNP_SHESH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  622::703     1e-05  33%  718 aa  PNP_NATTJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->110)
  615::690     1e-06  37%  693 aa  PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->364)
  619::690     7e-04  35%  693 aa  PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->104)
  628::690     2e-09  50%  711 aa  PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  623::689     1e-04  34%  711 aa  PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->102)
  628::703     5e-10  41%  710 aa  PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->376)
  623::696     1e-05  38%  710 aa  PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->111)
  647::697     4e-04  39%  710 aa  PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  612::680     9e-09  46%  698 aa  PNP_TREDE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 276->353)
  620::687     2e-05  35%  690 aa  PNP_PELUB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 34->105)
  621::689     8e-08  43%  706 aa  PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     3e-05  38%  706 aa  PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  706 aa  PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  619::717     9e-07  32%  723 aa  PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->126)
  648::707     8e-05  38%  723 aa  PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->292)
  619::717     7e-07  32%  723 aa  PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->126)
  648::707     5e-05  38%  723 aa  PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->292)
  619::717     7e-07  32%  723 aa  PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->126)
  648::707     5e-05  38%  723 aa  PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->292)
  619::717     7e-07  32%  723 aa  PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->126)
  648::707     5e-05  38%  723 aa  PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->292)
  619::717     7e-07  32%  723 aa  PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->126)
  648::707     5e-05  38%  723 aa  PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->292)
  619::717     9e-07  32%  723 aa  PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->126)
  648::707     8e-05  38%  723 aa  PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->292)
  621::694     1e-08  39%  706 aa  PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->368)
  622::695     1e-05  36%  706 aa  PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  643::694     5e-04  44%  706 aa  PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->281)
  634::692     1e-08  37%  717 aa  PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  658::709     9e-07  42%  717 aa  PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  634::703     1e-04  30%  717 aa  PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  626::683     3e-08  47%  701 aa  PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->357)
  614::701     9e-07  34%  701 aa  PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->114)
  623::690     3e-09  46%  706 aa  PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->361)
  623::691     2e-04  35%  706 aa  PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  620::694     3e-10  41%  720 aa  PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  603::695     1e-04  33%  720 aa  PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  621::689     8e-08  43%  705 aa  PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  705 aa  PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  705 aa  PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  628::703     3e-10  36%  746 aa  PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->368)
  629::699     4e-05  31%  746 aa  PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  653::703     1e-04  36%  746 aa  PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  621::689     1e-07  43%  711 aa  PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     8e-08  43%  707 aa  PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::694     7e-06  38%  707 aa  PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->108)
  643::690     9e-04  46%  707 aa  PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::691     8e-08  39%  711 aa  PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  622::697     6e-06  37%  711 aa  PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->111)
  626::692     3e-10  51%  694 aa  PNP_CHLPN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 298->366)
  637::736     4e-10  36%  736 aa  PNP_WOLSU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 265->369)
  621::689     1e-07  43%  711 aa  PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::695     7e-06  38%  711 aa  PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  643::690     9e-04  46%  711 aa  PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  710 aa  PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  710 aa  PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  710 aa  PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  624::692     1e-07  43%  711 aa  PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  625::693     2e-05  39%  711 aa  PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  646::693     9e-04  46%  711 aa  PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  621::689     1e-07  43%  711 aa  PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     4e-06  41%  711 aa  PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     1e-07  43%  711 aa  PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     2e-05  39%  711 aa  PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  626::688     2e-08  47%  712 aa  PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  645::689     4e-04  49%  712 aa  PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::689     7e-04  37%  712 aa  PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 34->104)
  601::694     4e-07  34%  715 aa  PNP_ACTPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 273->369)
  601::694     4e-07  34%  715 aa  PNP_ACTP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 273->369)
  601::694     4e-07  34%  715 aa  PNP_ACTP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 273->369)
  620::688     3e-08  43%  774 aa  PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  621::694     4e-05  32%  774 aa  PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  641::691     3e-04  39%  774 aa  PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->279)
  625::683     2e-08  39%  711 aa  PNP_ROSDO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  617::696     2e-07  34%  714 aa  PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->368)
  608::699     2e-05  30%  714 aa  PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->111)
  622::693     2e-07  40%  697 aa  PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->366)
  637::697     4e-05  40%  697 aa  PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 136->194)
  616::691     4e-04  33%  697 aa  PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->104)
  651::720     2e-08  40%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;(query 294->364)
  648::729     1e-05  34%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;(query 30->113)
  564::687     8e-10  37%  748 aa  PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 249->361)
  620::693     1e-04  30%  748 aa  PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  621::689     5e-07  41%  705 aa  PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::694     3e-05  37%  705 aa  PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->108)
  628::688     1e-09  47%  743 aa  PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->440)
  628::698     8e-05  32%  743 aa  PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  628::688     1e-09  47%  743 aa  PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->440)
  628::698     8e-05  32%  743 aa  PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  641::711     9e-09  39%  730 aa  PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  639::722     3e-04  30%  730 aa  PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->111)
  687::741     2e-07  46%  755 aa  PNP_CORDI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  621::689     3e-07  43%  711 aa  PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     7e-06  41%  711 aa  PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  607::674     1e-08  41%  686 aa  PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  596::676     2e-05  30%  686 aa  PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->95)
  619::689     1e-08  41%  699 aa  PNP_PELCD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  617::682     1e-09  44%  710 aa  PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  606::710     2e-04  32%  710 aa  PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->123)
  624::682     3e-08  41%  806 aa  PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::698     2e-04  33%  806 aa  PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->111)
  612::677     1e-08  39%  701 aa  PNP_SOLUE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  614::692     2e-08  35%  699 aa  PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  614::692     2e-08  35%  699 aa  PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  614::692     2e-08  35%  699 aa  PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  614::692     2e-08  35%  699 aa  PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  614::692     2e-08  35%  699 aa  PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  614::692     2e-08  35%  699 aa  PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  614::688     6e-08  38%  700 aa  PNP_SHEB9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  614::688     6e-08  38%  700 aa  PNP_SHEB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  614::688     6e-08  38%  700 aa  PNP_SHEB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  614::692     2e-08  35%  699 aa  PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     3e-04  34%  699 aa  PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  628::688     1e-08  41%  695 aa  PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->360)
  650::720     3e-09  38%  721 aa  PNP_SULDN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 290->363)
  649::699     2e-07  43%  737 aa  PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  649::699     2e-07  43%  737 aa  PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     2e-05  37%  737 aa  PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  28%  737 aa  PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  623::681     3e-06  36%  745 aa  PNP_METEP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::681     3e-06  36%  745 aa  PNP_METC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  617::682     4e-09  35%  698 aa  PNP_CLOPH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  614::683     4e-06  33%  707 aa  PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  603::691     6e-06  34%  707 aa  PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->106)
  621::689     5e-07  40%  705 aa  PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  704 aa  PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  704 aa  PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  705 aa  PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  705 aa  PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  705 aa  PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  705 aa  PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  704 aa  PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  704 aa  PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  705 aa  PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  621::689     5e-07  40%  705 aa  PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     5e-05  38%  705 aa  PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  599::698     3e-06  32%  772 aa  PNP_VARPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->370)
  621::689     5e-07  41%  711 aa  PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  622::690     8e-05  38%  711 aa  PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  643::690     9e-04  46%  711 aa  PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->277)
  608::698     3e-05  32%  706 aa  PNP_RHOFD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 193->283)
  621::689     3e-09  46%  695 aa  PNP_NITOC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  669::723     2e-07  44%  755 aa  PNP_MYCA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  645::705     5e-07  38%  713 aa  PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->290)
  606::697     2e-04  26%  713 aa  PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->109)
  621::702     3e-07  33%  709 aa  PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->377)
  621::702     2e-04  30%  709 aa  PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->117)
  641::702     5e-04  32%  709 aa  PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->290)
  621::702     3e-07  33%  709 aa  PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->377)
  621::702     2e-04  30%  709 aa  PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->117)
  641::702     5e-04  32%  709 aa  PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->290)
  621::704     1e-07  33%  709 aa  PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->379)
  641::705     6e-05  34%  709 aa  PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->293)
  621::702     2e-04  30%  709 aa  PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->117)
  621::704     1e-07  33%  709 aa  PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->379)
  641::705     6e-05  34%  709 aa  PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->293)
  621::702     2e-04  30%  709 aa  PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->117)
  614::681     1e-08  40%  710 aa  PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::690     1e-04  29%  710 aa  PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->103)
  623::692     1e-07  37%  694 aa  PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  648::694     4e-04  43%  694 aa  PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->279)
  649::699     3e-07  45%  737 aa  PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     6e-06  39%  737 aa  PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  612::712     3e-04  27%  737 aa  PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->123)
  625::683     2e-09  41%  711 aa  PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::709     2e-05  31%  711 aa  PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->120)
  614::692     2e-08  35%  699 aa  PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->367)
  603::695     1e-04  34%  699 aa  PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 18->110)
  623::692     2e-06  37%  751 aa  PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  648::698     2e-05  45%  751 aa  PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  623::681     3e-06  36%  745 aa  PNP_METPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  626::684     2e-08  39%  711 aa  PNP_DINSH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  618::683     1e-07  36%  779 aa  PNP_DEIRA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->353)
  616::690     1e-05  39%  693 aa  PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  620::693     1e-04  36%  693 aa  PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->106)
  615::691     9e-07  38%  707 aa  PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->365)
  619::691     5e-04  32%  707 aa  PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->105)
  615::691     9e-07  38%  707 aa  PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->365)
  619::691     5e-04  32%  707 aa  PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->105)
  615::691     9e-07  38%  707 aa  PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->365)
  619::691     5e-04  32%  707 aa  PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->105)
  658::729     4e-09  45%  873 aa  PNP_BIFA0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->363)
  618::691     4e-09  36%  704 aa  PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 293->368)
  643::691     2e-05  39%  704 aa  PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 232->281)
  619::693     6e-05  32%  704 aa  PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase(query 33->110)
  632::691     9e-07  40%  713 aa  PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  613::706     2e-05  34%  713 aa  PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 15->109)
  632::691     9e-07  40%  713 aa  PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  613::706     2e-05  34%  713 aa  PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 15->109)
  649::699     2e-07  49%  710 aa  PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  625::683     2e-05  34%  710 aa  PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  649::699     1e-07  47%  728 aa  PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  627::683     4e-06  39%  728 aa  PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  625::694     7e-06  33%  709 aa  PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 298->369)
  623::709     1e-04  36%  709 aa  PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 35->120)
  619::677     7e-09  46%  695 aa  PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->352)
  620::695     7e-04  30%  695 aa  PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->111)
  617::698     3e-06  30%  753 aa  PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->370)
  648::698     1e-05  45%  753 aa  PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  614::681     9e-09  41%  717 aa  PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     3e-05  31%  717 aa  PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  668::722     3e-07  44%  763 aa  PNP_MYCS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  621::679     1e-08  37%  729 aa  PNP_LEGPL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  628::686     7e-07  36%  714 aa  PNP_AKKM8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  234::280     1e-05  46% 1168 aa  PRP22_SCHPO RecName: Full=Pre-mRNA-splicing factor ATP-dependent(query 232->277)
  621::679     1e-08  42%  707 aa  PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  621::692     4e-04  31%  707 aa  PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->107)
  617::700     3e-06  30%  703 aa  PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->372)
  599::698     1e-05  32%  703 aa  PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 184->283)
  617::698     6e-06  30%  727 aa  PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->370)
  648::698     2e-05  47%  727 aa  PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  709::763     1e-06  44%  775 aa  PNP_CORK4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  614::700     1e-06  38%  712 aa  PNP_BURP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->280)
  658::720     3e-08  41%  892 aa  PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  658::736     9e-04  34%  892 aa  PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  619::688     2e-07  40%  692 aa  PNP_ACIF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  617::686     2e-07  40%  690 aa  PNP_ACIF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  627::689     1e-06  42%  706 aa  PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  623::690     1e-04  37%  706 aa  PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 34->104)
  627::689     1e-06  42%  706 aa  PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  623::690     1e-04  37%  706 aa  PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 34->104)
  617::700     2e-06  31%  757 aa  PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->370)
  648::698     5e-04  39%  757 aa  PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  613::706     6e-05  33%  713 aa  PNP_THET8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 15->109)
  625::683     1e-04  36%  741 aa  PNP_STRTD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::683     1e-04  36%  741 aa  PNP_STRT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  625::683     1e-04  36%  741 aa  PNP_STRT1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  621::692     6e-08  38%  698 aa  PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->367)
  621::695     4e-04  36%  698 aa  PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->110)
  627::695     1e-06  38%  700 aa  PNP_PSYA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->364)
  617::700     3e-06  31%  707 aa  PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->372)
  599::698     1e-05  33%  707 aa  PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 184->283)
  627::696     5e-08  41%  710 aa  PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  603::701     1e-04  30%  710 aa  PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 184->282)
  658::720     3e-08  39%  913 aa  PNP_BIFLO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  658::720     3e-08  39%  913 aa  PNP_BIFLD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::683     3e-08  38%  710 aa  PNP_BACSK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 272->357)
  567::697     2e-08  32%  699 aa  PNP_AZOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 249->370)
  625::683     1e-08  42%  815 aa  PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  560::701     2e-04  29%  815 aa  PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 67->197)
  649::699     5e-07  45%  709 aa  PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  625::683     3e-06  37%  709 aa  PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  709 aa  PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::699     5e-07  45%  709 aa  PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  625::683     3e-06  37%  709 aa  PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  709 aa  PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::699     5e-07  45%  709 aa  PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  625::683     3e-06  37%  709 aa  PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  709 aa  PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  621::692     1e-07  35%  698 aa  PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->367)
  621::694     4e-04  38%  698 aa  PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->111)
  627::695     1e-06  36%  700 aa  PNP_PSYCK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->364)
  616::681     3e-06  32%  722 aa  PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  647::701     6e-05  38%  722 aa  PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->287)
  616::681     3e-06  32%  722 aa  PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  647::701     6e-05  38%  722 aa  PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->287)
  591::697     2e-06  33%  709 aa  PNP_PERMH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 252->367)
  623::681     3e-07  37%  720 aa  PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::696     3e-04  32%  720 aa  PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  621::690     6e-08  43%  708 aa  PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  646::691     7e-04  43%  708 aa  PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->278)
  667::721     2e-07  44%  754 aa  PNP_MYCVP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  669::723     2e-07  44%  756 aa  PNP_MYCGI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  614::681     6e-08  38%  712 aa  PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::700     3e-06  30%  712 aa  PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->197)
  621::693     4e-07  36%  693 aa  PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  646::690     2e-04  47%  693 aa  PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  622::692     8e-08  39%  707 aa  PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->365)
  647::691     5e-05  49%  707 aa  PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  615::692     6e-06  32%  697 aa  PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->366)
  589::697     1e-05  34%  697 aa  PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 1->111)
  614::681     3e-08  43%  707 aa  PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::694     2e-05  30%  707 aa  PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->191)
  617::698     7e-06  30%  727 aa  PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->370)
  648::698     2e-05  47%  727 aa  PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  617::692     4e-06  32%  758 aa  PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->364)
  599::698     6e-06  33%  758 aa  PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 184->283)
  623::686     7e-07  38%  753 aa  PNP_RHOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  674::728     4e-06  39%  773 aa  PNP_MYCLE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  674::728     4e-06  39%  773 aa  PNP_MYCLB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  662::720     2e-06  42%  746 aa  PNP_KINRD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->440)
  639::697     6e-08  43%  729 aa  PNP_CHLT3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->438)
  614::681     3e-08  43%  705 aa  PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::703     1e-07  30%  705 aa  PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->200)
  614::681     5e-08  41%  705 aa  PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::703     5e-07  30%  705 aa  PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->200)
  624::693     1e-06  39%  715 aa  PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  654::713     3e-06  38%  729 aa  PNP_SULNB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 290->350)
  649::696     7e-06  44%  733 aa  PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->280)
  627::683     1e-05  39%  733 aa  PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  649::697     4e-07  49%  710 aa  PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     1e-05  34%  710 aa  PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  710 aa  PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::697     4e-07  49%  710 aa  PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     1e-05  34%  710 aa  PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  710 aa  PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::697     4e-07  49%  710 aa  PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     1e-05  34%  710 aa  PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  710 aa  PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::697     4e-07  49%  710 aa  PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     1e-05  34%  710 aa  PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  710 aa  PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  640::688     4e-07  49%  701 aa  PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  616::674     1e-05  34%  701 aa  PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  594::686     9e-04  27%  701 aa  PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::697     4e-07  49%  710 aa  PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     1e-05  34%  710 aa  PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  710 aa  PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  649::697     4e-07  49%  710 aa  PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     1e-05  34%  710 aa  PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  603::695     9e-04  27%  710 aa  PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->106)
  637::698     8e-05  36%  712 aa  PNP_SALRD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->360)
  620::694     1e-07  39%  707 aa  PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  618::707     3e-06  32%  707 aa  PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->122)
  671::725     1e-06  43%  752 aa  PNP_MYCTU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  671::725     1e-06  43%  752 aa  PNP_MYCTA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  664::718     3e-07  44%  759 aa  PNP_MYCSS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  664::718     3e-07  44%  759 aa  PNP_MYCSK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  664::718     3e-07  44%  759 aa  PNP_MYCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  673::727     1e-06  43%  757 aa  PNP_MYCPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  673::727     1e-06  43%  762 aa  PNP_MYCMM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  671::725     1e-06  43%  752 aa  PNP_MYCBT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  671::725     1e-06  43%  752 aa  PNP_MYCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  671::725     1e-06  43%  752 aa  PNP_MYCBO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  664::718     1e-06  43%  748 aa  PNP_MYCA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  638::706     4e-07  43%  718 aa  PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->369)
  626::707     7e-04  30%  718 aa  PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->110)
  697::751     6e-06  41%  764 aa  PNP_CORJK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  689::743     1e-05  39%  756 aa  PNP_CORA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  621::693     9e-07  37%  707 aa  PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  622::693     8e-05  32%  707 aa  PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->107)
  658::720     8e-08  37%  914 aa  PNP_BIFLI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     1e-05  34%  733 aa  PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::697     2e-04  32%  733 aa  PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  614::681     1e-07  41%  705 aa  PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::700     4e-07  31%  705 aa  PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->197)
  610::691     6e-08  39%  699 aa  PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 277->364)
  629::688     2e-07  36%  719 aa  PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  629::718     2e-04  30%  719 aa  PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->121)
  614::681     8e-08  40%  702 aa  PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::702     3e-06  31%  702 aa  PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->200)
  649::697     7e-07  49%  710 aa  PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     2e-05  34%  710 aa  PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  649::697     7e-07  49%  710 aa  PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     2e-05  34%  710 aa  PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  649::697     4e-07  49%  710 aa  PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->281)
  625::683     2e-05  34%  710 aa  PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  619::688     2e-06  34%  697 aa  PNP_STAS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  683::737     4e-06  43%  764 aa  PNP_NOCFA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  673::727     1e-06  43%  762 aa  PNP_MYCUA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  560::702     2e-07  30%  704 aa  PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 70->200)
  629::680     9e-07  40%  704 aa  PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 388->439)
  626::685     6e-05  37%  693 aa  PNP_FERNB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  620::689     2e-07  37%  713 aa  PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  612::690     4e-04  36%  713 aa  PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  622::691     2e-07  37%  715 aa  PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  614::692     4e-04  36%  715 aa  PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  622::691     2e-07  37%  715 aa  PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  614::692     4e-04  36%  715 aa  PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  622::691     2e-07  37%  715 aa  PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  614::692     4e-04  36%  715 aa  PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  614::681     3e-08  40%  712 aa  PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  614::681     3e-08  40%  712 aa  PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
    4::93      9e-07  38%  275 aa  IF2A_THEON RecName: Full=Translation initiation factor 2 subunit(query 114->199)
   38::83      4e-05  39%  275 aa  IF2A_THEON RecName: Full=Translation initiation factor 2 subunit(query 232->277)
  614::689     2e-07  38%  706 aa  PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->364)
  645::698     2e-05  43%  706 aa  PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->286)
  589::692     9e-07  32%  767 aa  PNP_LEPCP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 252->364)
  627::696     1e-07  40%  711 aa  PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  603::696     2e-04  31%  711 aa  PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 184->277)
  624::693     4e-06  40%  715 aa  PNP_CYAP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  684::738     2e-06  43%  752 aa  PNP_COREF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
    4::93      4e-06  35%  275 aa  IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit(query 114->199)
   38::83      2e-05  39%  275 aa  IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit(query 232->277)
  625::706     4e-05  30%  717 aa  PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->110)
  637::705     1e-04  38%  717 aa  PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->369)
  608::694     5e-07  34%  697 aa  PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 268->362)
  621::690     1e-06  37%  707 aa  PNP_SULAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  617::682     2e-07  35%  724 aa  PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  648::693     1e-05  50%  724 aa  PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->278)
  614::681     1e-07  38%  722 aa  PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  561::698     4e-06  31%  722 aa  PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 70->195)
  626::706     2e-07  42%  718 aa  PNP_CYAP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
  661::718     4e-06  41%  746 aa  PNP_ARTS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  661::718     3e-06  43%  752 aa  PNP_ARTCA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  661::718     3e-06  43%  750 aa  PNP_ARTAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
    5::84      3e-07  39%  275 aa  IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit(query 288->365)
   38::83      8e-05  37%  275 aa  IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit(query 232->277)
    7::73      1e-04  31%  275 aa  IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit(query 377->440)
  918::991     2e-06  39%  995 aa  SRBD1_PONAB RecName: Full=S1 RNA-binding domain-containing protein(query 293->363)
  633::694     2e-07  39%  790 aa  PNP_THERP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->355)
  621::695     5e-07  38%  705 aa  PNP_NITEC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  665::722     4e-06  43%  753 aa  PNP_MICLC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  637::705     2e-07  46%  717 aa  PNP_MICAN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->369)
  641::691     9e-04  37%  712 aa  PNP_HAEDU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->279)
  639::702     2e-07  42%  703 aa  PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->365)
  629::703     1e-04  32%  703 aa  PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->106)
  620::653     7e-06  56%  720 aa  PNP_DEHE1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->327)
  631::713     3e-07  38%  734 aa  PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->364)
  664::719     4e-04  42%  734 aa  PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  624::682     2e-06  34%  731 aa  PNP_BART1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::656     1e-04  47%  702 aa  PNP_STRMK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->327)
  623::656     1e-04  47%  702 aa  PNP_STRM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->327)
  619::688     3e-06  33%  701 aa  PNP_STACT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  674::728     6e-05  39%  756 aa  PNP_RHOE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  615::680     3e-07  35%  717 aa  PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  646::691     1e-05  50%  717 aa  PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->278)
  625::658     3e-05  53%  701 aa  PNP_MAGSM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->327)
  670::727     7e-06  39%  751 aa  PNP_KOCRD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  614::681     2e-07  40%  723 aa  PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  603::693     2e-05  33%  723 aa  PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->106)
  616::696     6e-06  35%  703 aa  PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
  616::697     1e-04  32%  703 aa  PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 26->110)
  614::702     2e-06  38%  716 aa  PNP_BURXL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->282)
  625::705     7e-06  38%  718 aa  PNP_ANAVT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
  625::705     7e-06  38%  718 aa  PNP_ANASP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
    4::93      7e-06  36%  273 aa  IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit(query 114->199)
   38::83      4e-05  39%  273 aa  IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit(query 232->277)
    5::84      9e-07  39%  275 aa  IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit(query 288->365)
    7::73      4e-04  31%  275 aa  IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit(query 377->440)
   38::83      4e-04  43%  275 aa  IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit(query 232->277)
  621::669     1e-05  45%  693 aa  PNP_THISH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->342)
  623::693     5e-07  34%  760 aa  PNP_DESVV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 289->360)
  623::693     3e-06  32%  756 aa  PNP_DESVM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 289->360)
  623::693     5e-07  34%  760 aa  PNP_DESVH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 289->360)
  629::708     3e-06  32%  743 aa  PNP_DESDA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->371)
  622::691     2e-07  37%  715 aa  PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  614::692     5e-04  36%  715 aa  PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  622::697     1e-07  38%  713 aa  PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->364)
  614::700     1e-06  38%  713 aa  PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->280)
  622::691     2e-07  37%  715 aa  PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  614::692     5e-04  36%  715 aa  PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  622::691     2e-07  37%  715 aa  PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  614::692     5e-04  36%  715 aa  PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->272)
  626::695     3e-07  41%  719 aa  PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  651::695     7e-04  42%  719 aa  PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
  626::695     1e-07  43%  718 aa  PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  651::697     6e-05  45%  718 aa  PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->279)
  657::715     7e-07  42%  744 aa  PNP_BEUC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->440)
  624::682     6e-06  34%  733 aa  PNP_BARHE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  628::692     4e-06  38%  709 aa  PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->365)
  643::691     4e-05  45%  709 aa  PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->277)
  623::696     3e-04  32%  709 aa  PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->109)
  914::991     1e-06  37%  995 aa  SRBD1_HUMAN RecName: Full=S1 RNA-binding domain-containing protein(query 289->363)
  919::981     1e-05  46%  995 aa  SRBD1_HUMAN RecName: Full=S1 RNA-binding domain-containing protein(query 381->439)
  628::690     7e-06  42%  709 aa  PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  643::691     1e-05  47%  709 aa  PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->277)
  623::691     8e-05  36%  709 aa  PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  628::690     7e-06  42%  709 aa  PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->361)
  643::691     1e-05  47%  709 aa  PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->277)
  623::691     8e-05  36%  709 aa  PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->104)
  651::713     6e-06  39%  740 aa  PNP_STRAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  619::688     5e-07  34%  701 aa  PNP_STAES RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  619::688     5e-07  34%  701 aa  PNP_STAEQ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  658::712     3e-06  43%  786 aa  PNP_SALAI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  674::728     5e-05  39%  757 aa  PNP_RHOSR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  674::728     5e-05  39%  757 aa  PNP_RHOOB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  617::682     5e-07  33%  725 aa  PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  648::697     3e-04  38%  725 aa  PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->282)
  617::682     5e-07  33%  723 aa  PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  648::697     3e-04  38%  723 aa  PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->282)
  625::705     1e-05  37%  718 aa  PNP_NOSP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
  614::689     4e-07  38%  701 aa  PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->364)
  615::669     3e-06  44%  696 aa  PNP_LEPBP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->342)
  615::669     3e-06  44%  696 aa  PNP_LEPBA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->342)
  626::684     8e-08  42%  704 aa  PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  640::703     2e-05  42%  704 aa  PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 135->197)
  623::704     8e-05  30%  704 aa  PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 30->114)
  617::682     5e-07  33%  723 aa  PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  648::697     3e-04  38%  723 aa  PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->282)
  622::691     2e-07  37%  713 aa  PNP_BURPS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURP0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  622::691     2e-07  37%  713 aa  PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  628::697     1e-07  41%  714 aa  PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  614::712     1e-06  35%  714 aa  PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->292)
  628::697     1e-07  41%  714 aa  PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  614::712     1e-06  35%  714 aa  PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->292)
  614::681     2e-07  38%  712 aa  PNP_BACCR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  623::681     2e-06  37%  710 aa  PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::694     9e-04  31%  710 aa  PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->107)
  656::713     8e-08  48%  782 aa  PNP_ACIC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
    5::84      9e-07  39%  275 aa  IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit(query 288->365)
    7::73      4e-04  31%  275 aa  IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit(query 377->440)
   38::83      4e-04  43%  275 aa  IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit(query 232->277)
  665::719     3e-05  39%  750 aa  PNP_SACEN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  657::714     1e-06  44%  746 aa  PNP_RENSM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  658::715     1e-05  39%  733 aa  PNP_PROAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  628::697     1e-07  40%  718 aa  PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->364)
  614::700     6e-06  37%  718 aa  PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 194->280)
  614::681     2e-07  38%  712 aa  PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  618::691     2e-04  30%  712 aa  PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->104)
  658::712     3e-06  41%  785 aa  PNP_SALTO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  617::682     3e-07  33%  728 aa  PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->439)
  648::697     7e-04  36%  728 aa  PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->282)
  599::701     2e-07  33%  716 aa  PNP_GLUOX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 264->376)
  631::710     1e-06  40%  733 aa  PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->363)
  660::716     9e-04  43%  733 aa  PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->280)
  642::701     3e-05  41%  736 aa  PNP_CHLL2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->438)
  657::714     6e-05  39%  742 aa  PNP_NOCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  651::708     4e-06  41%  729 aa  PNP_FRASC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  652::709     4e-06  41%  729 aa  PNP_FRAAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  612::682     1e-06  39%  693 aa  PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->440)
  599::693     3e-06  31%  693 aa  PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 9->106)
  698::752     5e-05  35%  765 aa  PNP_CORU7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  621::690     1e-06  32%  722 aa  PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  629::699     1e-05  40%  722 aa  PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  656::705     6e-05  40%  722 aa  PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->282)
  614::653     1e-05  48%  701 aa  PNP_CALS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->326)
  626::704     4e-07  43%  719 aa  PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  651::697     2e-04  45%  719 aa  PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->279)
  626::704     4e-07  43%  719 aa  PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  651::697     2e-04  45%  719 aa  PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->279)
  626::704     4e-07  43%  719 aa  PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->367)
  651::697     2e-04  45%  719 aa  PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->279)
  621::683     4e-07  41%  704 aa  PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 294->357)
  621::691     5e-04  30%  704 aa  PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->106)
  814::1001    9e-07  30% 1015 aa  SRBD1_MOUSE RecName: Full=S1 RNA-binding domain-containing protein 1;(query 255->439)
  613::693     5e-07  37%  707 aa  PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
  604::695     7e-04  32%  707 aa  PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 16->111)
  618::682     1e-05  35%  708 aa  PNP_THESQ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->353)
  618::682     1e-05  35%  708 aa  PNP_THEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->353)
  618::682     1e-05  35%  708 aa  PNP_THEMA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->353)
  597::657     1e-04  34%  710 aa  PNP_THELT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 261->326)
  636::703     1e-05  40%  716 aa  PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->368)
  636::703     1e-05  40%  716 aa  PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->368)
  648::698     2e-05  47%  706 aa  PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  615::691     7e-04  34%  706 aa  PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  649::699     2e-05  47%  707 aa  PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  616::692     7e-04  34%  707 aa  PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  648::698     2e-05  47%  706 aa  PNP_NEIMA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  648::698     2e-05  47%  706 aa  PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  615::691     7e-04  34%  706 aa  PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  636::707     7e-07  39%  709 aa  PNP_HELHP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 289->363)
  651::708     2e-06  41%  729 aa  PNP_FRASN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  630::709     2e-06  39%  732 aa  PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->363)
  659::715     4e-04  43%  732 aa  PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 228->280)
  614::653     1e-05  48%  701 aa  PNP_ANATD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->326)
  284::359     4e-07  42% 1244 aa  DHX8_MOUSE RecName: Full=ATP-dependent RNA helicase DHX8;       (query 289->361)
  260::335     4e-07  42% 1220 aa  DHX8_HUMAN RecName: Full=ATP-dependent RNA helicase DHX8;       (query 289->361)
  629::719     4e-07  45%  732 aa  PNP_PELLD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 276->370)
  647::700     1e-06  37%  773 aa  PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->283)
  618::684     6e-06  31%  773 aa  PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 373->439)
  613::684     5e-04  26%  773 aa  PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 20->93)
  632::697     4e-06  38%  732 aa  PNP_CHLPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 374->438)
  629::690     2e-06  40%  710 aa  PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 301->364)
  646::690     1e-04  47%  710 aa  PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->277)
    6::93      2e-05  36%  266 aa  IF2A_METJA RecName: Full=Translation initiation factor 2 subunit(query 116->199)
   38::83      2e-05  41%  266 aa  IF2A_METJA RecName: Full=Translation initiation factor 2 subunit(query 232->277)
   12::72      8e-05  37%  266 aa  IF2A_METJA RecName: Full=Translation initiation factor 2 subunit(query 381->439)
  618::697     6e-06  31%  707 aa  PNP_THENN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->368)
  612::688     3e-06  38%  703 aa  PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->357)
  522::703     4e-06  31%  703 aa  PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 28->197)
  650::697     7e-04  40%  703 aa  PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->280)
  656::713     2e-05  41%  737 aa  PNP_STRGG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  623::681     1e-06  37%  712 aa  PNP_RHIEC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-07  36%  715 aa  PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::710     1e-05  32%  715 aa  PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->123)
  648::697     1e-05  46%  701 aa  PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->282)
  615::697     2e-05  32%  701 aa  PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->369)
  624::683     6e-06  37%  721 aa  PNP_DEIGD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
  656::713     2e-05  41%  739 aa  PNP_STRCO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  656::713     2e-05  41%  738 aa  PNP_STRAW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  623::681     2e-06  37%  712 aa  PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::694     9e-04  31%  712 aa  PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->107)
  624::682     2e-06  36%  715 aa  PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  645::694     7e-04  38%  715 aa  PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->279)
  623::681     1e-06  39%  712 aa  PNP_RHIL3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  648::698     2e-05  47%  706 aa  PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  615::691     7e-04  34%  706 aa  PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  649::699     2e-05  47%  707 aa  PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->283)
  616::692     7e-04  34%  707 aa  PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->361)
  626::689     9e-07  41%  707 aa  PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  609::695     2e-04  33%  707 aa  PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 14->104)
  630::687     1e-06  46%  691 aa  PNP_METCA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 304->361)
  621::691     1e-06  39%  750 aa  PNP_GRAFK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->440)
  658::707     9e-04  32%  750 aa  PNP_GRAFK RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 234->283)
  623::681     1e-06  36%  715 aa  PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  647::699     5e-05  42%  715 aa  PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->285)
  648::701     4e-05  39%  728 aa  PNP_SULMW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->436)
  624::682     3e-06  36%  717 aa  PNP_RHISN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::681     2e-06  37%  712 aa  PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::694     9e-04  31%  712 aa  PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 33->107)
  622::656     1e-04  51%  701 aa  PNP_PSESM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->327)
  614::681     1e-06  35%  705 aa  PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->439)
  555::704     2e-06  30%  705 aa  PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 64->201)
  619::662     2e-05  52%  712 aa  PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->337)
  533::698     5e-04  28%  712 aa  PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 46->198)
  631::710     2e-05  40%  728 aa  PNP_CHLCH RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 286->363)
  623::681     2e-06  36%  713 aa  PNP_AGRT5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  651::708     4e-05  39%  767 aa  PNP_THEFY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 386->439)
  623::681     6e-06  36%  718 aa  PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  644::693     1e-04  38%  718 aa  PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 229->279)
  613::685     4e-06  42%  738 aa  PNP_EXISA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::692     3e-06  42%  796 aa  PNP_EHRCR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  626::654     3e-05  59%  713 aa  PNP_AERS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  624::682     2e-06  37%  717 aa  PNP_RHIME RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
   37::83      3e-06  40%  267 aa  IF2A_METKA RecName: Full=Translation initiation factor 2 subunit(query 231->277)
    4::92      1e-05  31%  267 aa  IF2A_METKA RecName: Full=Translation initiation factor 2 subunit(query 114->197)
   12::73      6e-05  32%  267 aa  IF2A_METKA RecName: Full=Translation initiation factor 2 subunit(query 381->440)
  663::739     7e-04  30%  791 aa  TEX_BORPE RecName: Full=Protein tex;(query 286->364)
  624::682     2e-06  37%  714 aa  PNP_SINMW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  629::721     3e-06  45%  732 aa  PNP_PROVI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 276->370)
  624::682     3e-06  36%  715 aa  PNP_MESSB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  627::715     3e-06  33%  750 aa  PNP_DESDG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->380)
  658::712     1e-04  44%  715 aa  PNP_ACHLI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 308->364)
  579::690     6e-05  29%  725 aa  RNR_MYCPU RecName: Full=Ribonuclease R;         Short=RNase R;     (query 263->365)
  636::664     2e-05  62%  714 aa  PNP_SYNP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  598::696     1e-04  32%  745 aa  PNP_RICM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->369)
  598::681     1e-04  35%  747 aa  PNP_RICFE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->353)
  624::664     2e-04  44%  721 aa  PNP_PROM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  631::686     7e-04  36%  757 aa  PNP_NEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->352)
  625::692     3e-06  37%  796 aa  PNP_EHRCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  612::652     1e-05  49%  693 aa  PNP_DICT6 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 372->412)
  662::724     4e-05  39%  757 aa  PNP_CLAMS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  662::724     4e-05  39%  757 aa  PNP_CLAM3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
   35::81      7e-06  38%  254 aa  IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit(query 231->277)
   10::70      9e-04  31%  254 aa  IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit(query 381->439)
   41::102     8e-05  29%  262 aa  IF2A_METTH RecName: Full=Translation initiation factor 2 subunit(query 232->293)
  598::703     7e-06  32%  748 aa  PNP_RICRS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->376)
  598::703     7e-06  32%  748 aa  PNP_RICRO RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->376)
  598::696     2e-05  34%  748 aa  PNP_RICPU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->369)
  598::681     3e-05  36%  749 aa  PNP_RICCN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->353)
  622::696     9e-04  29%  744 aa  PNP_RICBR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  622::696     9e-04  29%  744 aa  PNP_RICB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->369)
  598::681     3e-05  36%  748 aa  PNP_RICAE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->353)
  626::666     2e-04  44%  723 aa  PNP_PROMM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  624::682     3e-06  41%  739 aa  PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  648::695     2e-04  44%  739 aa  PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 232->280)
  233::317     4e-05  30% 1200 aa  MOG5_CAEEL RecName: Full=Probable pre-mRNA-splicing factor(query 293->377)
   10::82      3e-06  39%  254 aa  IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit(query 294->365)
   10::71      9e-04  30%  254 aa  IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit(query 381->440)
   17::88      2e-05  41%  267 aa  IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit(query 294->364)
   13::78      2e-05  38%  267 aa  IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit(query 378->440)
  628::686     4e-06  34%  702 aa  PNP_SPICI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  627::709     5e-05  33%  740 aa  PNP_ORITB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->378)
  615::684     6e-06  34%  703 aa  PNP_MACCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  633::690     3e-06  46%  713 aa  PNP_GLOVI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 383->439)
  623::681     6e-06  37%  714 aa  PNP_AGRVS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  218::282     7e-04  33% 1168 aa  DHX8_ARATH RecName: Full=Probable pre-mRNA-splicing factor(query 298->361)
  624::664     2e-04  44%  721 aa  PNP_SYNSC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  624::664     2e-04  44%  721 aa  PNP_SYNPX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  619::688     3e-05  30%  700 aa  PNP_STAHJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->357)
  629::696     1e-05  35%  789 aa  PNP_EHRRW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  629::696     1e-05  35%  789 aa  PNP_EHRRG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->361)
  627::717     5e-05  32%  779 aa  RNR_BACSU RecName: Full=Ribonuclease R;         Short=RNase R;     (query 293->370)
  617::651     3e-05  54%  689 aa  PNP_UNCTG RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->327)
  624::664     2e-04  44%  721 aa  PNP_SYNS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  636::664     6e-05  62%  719 aa  PNP_SYNR3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  624::664     2e-04  44%  721 aa  PNP_SYNPW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  634::662     3e-04  59%  712 aa  PNP_SYNJA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  624::664     3e-04  44%  721 aa  PNP_PROMS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  624::664     2e-04  44%  722 aa  PNP_PROMA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  624::664     3e-04  44%  721 aa  PNP_PROM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  624::664     3e-04  44%  721 aa  PNP_PROM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  674::731     7e-04  43%  761 aa  PNP_LEIXX RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  623::657     1e-04  49%  699 aa  PNP_BLOPB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->327)
  624::664     1e-04  44%  716 aa  PNP_ACAM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  207::284     2e-05  37% 1160 aa  DHX8_DICDI RecName: Full=ATP-dependent RNA helicase dhx8;       (query 299->374)
  204::264     2e-04  35% 1160 aa  DHX8_DICDI RecName: Full=ATP-dependent RNA helicase dhx8;       (query 383->438)
  625::688     1e-05  34%  698 aa  PNP_STAAW RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAS RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAM RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAE RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  625::688     1e-05  34%  698 aa  PNP_STAA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->357)
  598::681     3e-05  36%  745 aa  PNP_RICTY RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 262->353)
  636::664     2e-04  55%  722 aa  PNP_PROMT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  636::664     4e-04  55%  721 aa  PNP_PROMP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  624::664     3e-04  44%  721 aa  PNP_PROM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  624::664     2e-04  44%  722 aa  PNP_PROM4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  636::664     2e-04  55%  722 aa  PNP_PROM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  636::664     4e-04  55%  721 aa  PNP_PROM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  630::689     5e-04  47%  734 aa  PNP_PROA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 275->342)
  638::666     2e-04  59%  718 aa  PNP_SYNY3 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  624::664     1e-04  44%  721 aa  PNP_SYNS9 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 287->327)
  631::694     1e-04  38%  713 aa  PNP_HAES2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 304->369)
  631::694     1e-04  38%  713 aa  PNP_HAES1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 304->369)
  638::665     2e-04  61%  715 aa  PNP_CYAA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->326)
  630::688     2e-05  31%  838 aa  PNP_ANAPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  639::709     2e-04  32%  757 aa  YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;(query 293->364)
  639::709     2e-04  32%  757 aa  YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;(query 293->364)
  624::682     4e-05  34%  713 aa  PNP_OCHA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
   17::85      3e-04  34%  241 aa  NO40_MOUSE RecName: Full=Nucleolar protein of 40 kDa;       (query 295->363)
   17::85      3e-04  34%  241 aa  NO40_HUMAN RecName: Full=Nucleolar protein of 40 kDa;       (query 295->363)
   37::81      8e-05  42%  266 aa  IF2A_HALMA RecName: Full=Translation initiation factor 2 subunit(query 233->277)
  183::250     2e-05  38% 1145 aa  PRP22_YEAST RecName: Full=Pre-mRNA-splicing factor ATP-dependent(query 299->364)
  637::683     5e-05  38%  706 aa  PNP_JANSC RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 393->439)
  622::680     9e-04  36%  697 aa  PNP_COPPD RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUSU RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUSI RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUO2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUME RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUMB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUAB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  624::682     5e-05  34%  714 aa  PNP_BRUA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->439)
  660::704     5e-04  47%  725 aa  PNP_ARCB4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 297->342)
   38::99      6e-05  29%  260 aa  IF2A_METST RecName: Full=Translation initiation factor 2 subunit(query 232->293)
  634::662     3e-04  59%  712 aa  PNP_SYNJB RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 299->327)
  597::656     7e-04  39%  720 aa  PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 261->327)
  624::683     1e-04  33%  721 aa  PNP_DEIDV RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->353)
   38::99      4e-04  27%  265 aa  IF2A_METS3 RecName: Full=Translation initiation factor 2 subunit(query 232->293)
  622::656     7e-04  51%  717 aa  PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 293->327)
  573::694     2e-04  28%  736 aa  PNP_LAWIP RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 249->360)
  639::675     4e-04  38%  702 aa  PNP_CAMLR RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 290->326)
  569::666     7e-04  39%  730 aa  PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 249->336)
  621::658     3e-04  47%  712 aa  PNP_GLUDA RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->418)
  672::707     4e-04  39%  735 aa  PNP_CAMC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 291->326)
   10::74      2e-04  37%  267 aa  IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit(query 381->443)
   37::81      2e-04  40%  267 aa  IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit(query 233->277)
   10::74      2e-04  37%  267 aa  IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit(query 381->443)
   37::81      2e-04  40%  267 aa  IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit(query 233->277)
  599::662     9e-04  33%  699 aa  PNP_THEM4 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 258->326)
  622::658     3e-04  49%  708 aa  PNP_RHORT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->417)
  623::669     7e-04  45%  703 aa  PNP_HYDS0 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 387->439)
  625::662     4e-04  45%  724 aa  PNP_AZOC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 381->418)
  636::669     2e-04  47%  817 aa  RNR1_LACLA RecName: Full=Ribonuclease R 1;         Short=RNase R 1;(query 293->326)
  603::728     9e-04  27%  728 aa  PNP_PHYMT RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 75->192)
  610::660     7e-04  45%  715 aa  PNP_BREBN RecName: Full=Polyribonucleotide nucleotidyltransferase; (query 273->327)
    1::536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
RS1_RHIME       ----------------ALLEESFAKTD--LAEGYVAKGIVTAIEKDVAIVDVGLKVEGRVPLKEFGAKAK
RS1_NEIMB       -------------SMEAQLLEESFTLQE-MNPGEVITAEVVAIDQNFVTVNAGLKSESLIDVAEFKN---
RS1_BUCBP       ----------------------------KTRPGSIIQGTVVAITKDTILVDAKLKSESKIPIDQFKN---
RS1_RHOPA       -----------------------------LQESSVIKGKVVAIEKDMAVIDVGLKTEGRVPLREFAGPGR
RS1_HAEIN       ------------------------------RQGSIVSGTVVAIQKGFVLVDAGLKSESAIPVAEFLN---
RS1_COXBU       ----------ETFAFEKSLTETD------LRPGALVKATVVEVRPDRVIVNAGLKSEGIIPASEFR----
RS1_CHLPN       ------------------ITSSEEESDNEIQPGAILKGTVVDINKDFVVVDVGLKSEGVIPMSEFIDSSE
RS1_RICCN       -----------------------------IKEKTVVKGQVIEIKNDIIIVDVGLKNEGRIPKSEFLALP-
RS1_RICTY       ---------EEDFSKMLKTVDTSHIKEKTVVKGQVIEIK-----NDMIIVDVGLKNEGRIP---------
RS1_RICFE       ---------EEDFSKMLETVDTSHIKEKTVVKGQVIEIK-----NDMVIVDVGLKNEGRIPKSEFLALP-
RS1_RICPR       -----------------------------IKEKTVVKGQVIEIKNDMIIVDVGLKNEGRIP---------
RS1_BUCAP       ----------------------ESLKEIKTRPGSIIRGTIVSIEKDIVLVDAGLKSESAIPVEQF-----
RS1_BUCAI       ----------------------ESLKEIKTRPGSIIRGTIVSIEKDMVLVDAGLKSESAIPVEQFQ----
RS1_RICBR       -----------------------------IKPGTVVKGQXXXXXXXXXXXX-GLKNEGRIPKSEFLLSPA
RS1_CHLMU       ---------------------TEEEPTSEVQPGAILKGTVVDISKDFVVVDVGLKSEGVIPMSEFIDSSE
RS1_PROSP       ----------------------------------------------------------------------
RS1_CHLTR       ---------------------TEEEPTSEVHPGAILKGTVVDISKDFVVVDVGLKSEGVIPMSEFIDSSE
RS1_SHIFL       ----------------------ESLKEIETRPGSIXXXXXXXXXXXXXXXXAGLKSESAIPAEQFKN---
RS1_ECOLI       ----------------------ESLKEIETRPGSIXXXXXXXXXXXXXXXXAGLKSESAIPAEQFKN---
RS1_ECOL6       ----------------------ESLKEIETRPGSIXXXXXXXXXXXXXXXXAGLKSESAIPAEQFKN---
RS1_ECO57       ----------------------ESLKEIETRPGSIXXXXXXXXXXXXXXXXAGLKSESAIPAEQFKN---
ISPH_CLOAB      ------QISNETNNEMADAMKFIAENEGKIYVGASVTGEIIQVSEKEVFLNINYKRDGVIPKSEIDD---
RS1_MYCTU       MPSPTVTSPQVAVNDIGSSEDFLAAIDKTIKDGDIVEGTIVKVDRDEVLLDIGYKTEGVIPARELSIK--
RS1H_BACC1      ---------------------------KELQVGDVVTGSVTKVEEKQVLVNVGYKTDGVIPISELANVHI
RS1_PSEAE       ----------------------------------------------------GLKSEGVIPVEQFYN---
RS1_MYCLE       MSIPAVPSPQIAVNDVGSSEDFLAAIDKTIKDGDIVEGTIVKVDRDEVLLDIGYKTEGVIPARELSIK--
ISPH_FUSNN      ----------------------------------------------------------------------
RS1_STAAR       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_STAAW       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_STAAS       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_STAAN       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_STAAM       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_STAAC       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_LEULA       ----------------------------QIKVGDVVTGELLAIDNDNQAV-VGLSTEGVVPAREYSDD--
RS1_STAHJ       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_STAS1       ----------------------------------------------------GAKFNGIIPISQLSTHHI
RS1_HELPJ       -------------------------------------------------VSVGGKTEGRLALNEIT----
RS1_STAEQ       ----------------------------------------------------GGKFNGIIPISQLSTHHI
RS1_HELPY       -------------------------------------------------VSVGGKTEGRLALNEIT----
RS1H_BACSU      --------------------------------GDVVKGIVTKVEDKHVDVEINVKQSGIIPISELSSLHV
ISPH_CLOTE      --------------------------------GQEVEGEIVIVSSNEAYVNIGYKSDAILLLSEVTKD--
RS1A_SYNY3      -----------TATIGFTLEDFAALLDKHFSPGDIVAGTVFSMESRGALIDIGAKTAAYIPIQEMSINRV
RS1_SYNP6       -------------------------------PGDTVVGTVFNLEPRGALIDIGAKTAAFLPVQEMSINRV
RS1_SYNE7       MSPSAANTPSDDFALALEAQSLDSQ------KGQLVRGKVCEYSTDGAYIDIGGKAPAFLPKREAALHAV
RR1_SPIOL       --------------------------------GSRVKGTVFCTDANGALVDITAKSSAYLPLAEACIYRI
RR1_PORYE       --------------------------------GDIVAGTIFSFELNGVLVDIGTPISAYLPIQEVS----
RR1_PORPU       --------------------------------GDIVAGTIFSFELNGVLVDIGTPVSAYLPIQEVS----
RS1B_SYNY3      --------PSSSNSAAFSLDEFAKALDKHAEKGQTVHGKICQHANEGVYVDFGGKSPGFVPVQELGLRPH
RRP5_SCHPO      -QEKAVEFMESKYDIDNPVDETIKKTYDYVA-GKITWAVVTSAKASQLNVDLAANVHGRVDVSEVPNKPL
RRP5_MOUSE      -------------------RETKNRIEEDVKEGQLLRGYVKCVLPSSVIIGLGPSVLGLAKYSHVSECVP
RRP5_BOVIN      -----------------------------LKPGMLLTGTVSSLEDHGYLVDIGVSARAFLPL-QKAQEYI
RRP5_YEAST      ----------------------------------------------------------------------
RRP5_HUMAN      -------------SLRTSIIEAQYLRYHDIEPGAVVKGTVLTIKSYGMLVKVGEQMRGLVPPMHLADILM
PNP_RHOSK       ----------------------------------------------------------------------
PNP_RHOS5       ----------------------------------------------------------------------
PNP_RHOS4       ----------------------------------------------------------------------
PNP_RHOS1       ----------------------------------------------------------------------
PNP_HERA2       ----------------------------------------------------------------------
PNP_CHLSY       ----------------------------------------------------------------------
PNP_CHLAD       ----------------------------------------------------------------------
PNP_CHLAA       ----------------------------------------------------------------------
PNP_ROSS1       ----------------------------------------------------------------------
PNP_ROSCS       ----------------------------------------------------------------------
PNP_THEYD       ----------------------------------------------------------------------
PNP_XYLFT       ----------------------------------------------------------------------
PNP_XYLFM       ----------------------------------------------------------------------
PNP_XYLFA       ----------------------------------------------------------------------
PNP_XYLF2       ----------------------------------------------------------------------
PNP_BACTN       ----------------------------------------------------------------------
PNP_XANOR       ----------------------------------------------------------------------
PNP_XANOP       ----------------------------------------------------------------------
PNP_XANOM       ----------------------------------------------------------------------
PNP_XANCP       ----------------------------------------------------------------------
PNP_XANCB       ----------------------------------------------------------------------
PNP_XANC8       ----------------------------------------------------------------------
PNP_XANC5       ----------------------------------------------------------------------
PNP_XANAC       ----------------------------------------------------------------------
PNP_SORC5       ----------------------------------------------------------------------
PNP_SYMTH       ----------------------------------------------------------------------
PNP_CLOPS       ----------------------------------------------------------------------
PNP_BACFR       ----------------------------------------------------------------------
PNP_BACFN       ----------------------------------------------------------------------
PNP_PSEHT       ----------------------------------------------------------------------
PNP_LEPIN       ----------------------------------------------------------------------
PNP_LEPIC       ----------------------------------------------------------------------
PNP_LEPBL       ----------------------------------------------------------------------
PNP_LEPBJ       ----------------------------------------------------------------------
PNP_CLOTH       ----------------------------------------------------------------------
PNP_CLOPE       ----------------------------------------------------------------------
PNP_CLOP1       ----------------------------------------------------------------------
PNP_DEHSC       ----------------------------------------------------------------------
PNP_DEHSB       ----------------------------------------------------------------------
PNP_CLOBM       ----------------------------------------------------------------------
PNP_CLOBL       ----------------------------------------------------------------------
PNP_CLOBK       ----------------------------------------------------------------------
PNP_CLOBJ       ----------------------------------------------------------------------
PNP_CLOBH       ----------------------------------------------------------------------
PNP_CLOB6       ----------------------------------------------------------------------
PNP_CLOB1       ----------------------------------------------------------------------
PNP_AQUAE       ----------------------------------------------------------------------
PNP_SYNFM       ----------------------------------------------------------------------
PNP_GEMAT       ----------------------------------------------------------------------
PNP_ALHEH       ----------------------------------------------------------------------
PNP_DESPS       ----------------------------------------------------------------------
PNP_DESOH       ----------------------------------------------------------------------
PNP_PSEA6       ----------------------------------------------------------------------
PNP_NOVAD       ----------------------------------------------------------------------
PNP_CHLTR       ----------------------------------------------------------------------
PNP_CHLTB       ----------------------------------------------------------------------
PNP_CHLTA       ----------------------------------------------------------------------
PNP_CHLT2       ----------------------------------------------------------------------
PNP_BACV8       ----------------------------------------------------------------------
PNP_THEPX       ----------------------------------------------------------------------
PNP_THEP3       ----------------------------------------------------------------------
PNP_SHELP       ----------------------------------------------------------------------
PNP_GEOSM       ----------------------------------------------------------------------
PNP_GEOBB       ----------------------------------------------------------------------
PNP_COLP3       ----------------------------------------------------------------------
PNP2_ALKMQ      ----------------------------------------------------------------------
PNP1_ALKMQ      ----------------------------------------------------------------------
YHGF_ECOLI      ----------------------------------------------------------------------
PNP_VIBVY       ----------------------------------------------------------------------
PNP_VIBVU       ----------------------------------------------------------------------
PNP_VIBCM       ----------------------------------------------------------------------
PNP_VIBCH       ----------------------------------------------------------------------
PNP_VIBC3       ----------------------------------------------------------------------
PNP_DESHD       ----------------------------------------------------------------------
PNP_CHLMU       ----------------------------------------------------------------------
PNP_SYNAS       ----------------------------------------------------------------------
PNP_SILPO       ----------------------------------------------------------------------
PNP_RUTMC       ----------------------------------------------------------------------
PNP_PSEPW       ----------------------------------------------------------------------
PNP_PSEPU       ----------------------------------------------------------------------
PNP_PSEPK       ----------------------------------------------------------------------
PNP_PSEPG       ----------------------------------------------------------------------
PNP_PSEPF       ----------------------------------------------------------------------
PNP_PSEP1       ----------------------------------------------------------------------
PNP_PSEFS       ----------------------------------------------------------------------
PNP_PSEF5       ----------------------------------------------------------------------
PNP_PSE14       ----------------------------------------------------------------------
PNP_MYXXD       ----------------------------------------------------------------------
PNP_MARAV       ----------------------------------------------------------------------
PNP_GEOUR       ----------------------------------------------------------------------
PNP_GEOMG       ----------------------------------------------------------------------
PNP_CLOTE       ----------------------------------------------------------------------
PNP_ANADE       ----------------------------------------------------------------------
PNP_ALKOO       ----------------------------------------------------------------------
PNP_PSEU2       ----------------------------------------------------------------------
PNP_PSEE4       ----------------------------------------------------------------------
PNP_HALHL       ----------------------------------------------------------------------
PNP_GEOSL       ----------------------------------------------------------------------
PNP_GEOSF       ----------------------------------------------------------------------
PNP_ERYLH       ----------------------------------------------------------------------
PNP_CLOK5       ----------------------------------------------------------------------
PNP_CLOK1       ----------------------------------------------------------------------
PNP_ANASK       ----------------------------------------------------------------------
PNP_ANAD2       ----------------------------------------------------------------------
PNP_ALCBS       ----------------------------------------------------------------------
PNP_TERTT       ----------------------------------------------------------------------
PNP_PSEU5       ----------------------------------------------------------------------
PNP_MOOTA       ----------------------------------------------------------------------
PNP_HAHCH       ----------------------------------------------------------------------
PNP_ELUMP       ----------------------------------------------------------------------
PNP_DESHY       ----------------------------------------------------------------------
PNP_CLOAB       ----------------------------------------------------------------------
PNP_AZOVD       ----------------------------------------------------------------------
PNP3_ALKMQ      ----------------------------------------------------------------------
PNP_PSYIN       ----------------------------------------------------------------------
PNP_PSEMY       ----------------------------------------------------------------------
PNP_PHOLU       ----------------------------------------------------------------------
PNP_BRAHW       ----------------------------------------------------------------------
PNP_ANADF       ----------------------------------------------------------------------
PNP_PELTS       ----------------------------------------------------------------------
PNP_NITSB       ----------------------------------------------------------------------
PNP_HELMI       ----------------------------------------------------------------------
PNP_GEOLS       ----------------------------------------------------------------------
PNP_CLONN       ----------------------------------------------------------------------
PNP_CLOBB       ----------------------------------------------------------------------
PNP_CLOBA       ----------------------------------------------------------------------
PNP_BDEBA       ----------------------------------------------------------------------
PNP_SPHAL       ----------------------------------------------------------------------
PNP_SACD2       ----------------------------------------------------------------------
PNP_PSEAE       ----------------------------------------------------------------------
PNP_PSEAB       ----------------------------------------------------------------------
PNP_PSEA8       ----------------------------------------------------------------------
PNP_PSEA7       ----------------------------------------------------------------------
PNP_PROMH       ----------------------------------------------------------------------
PNP_PELPD       ----------------------------------------------------------------------
PNP_HALOH       ----------------------------------------------------------------------
GS13_BACSU      ----------------------------------------------------------------------
PNP_CLOD6       ----------------------------------------------------------------------
PNP_BLOFL       ----------------------------------------------------------------------
PNP_ACIBY       ----------------------------------------------------------------------
PNP_ACIBT       ----------------------------------------------------------------------
PNP_ACIBS       ----------------------------------------------------------------------
PNP_ACIBC       ----------------------------------------------------------------------
PNP_ACIB5       ----------------------------------------------------------------------
PNP_ACIB3       ----------------------------------------------------------------------
PNP_ACIAD       ----------------------------------------------------------------------
PNP_PHOLL       ----------------------------------------------------------------------
PNP_IDILO       ----------------------------------------------------------------------
PNP_COXBU       ----------------------------------------------------------------------
PNP_COXBR       ----------------------------------------------------------------------
PNP_COXBN       ----------------------------------------------------------------------
PNP_COXB2       ----------------------------------------------------------------------
PNP_COXB1       ----------------------------------------------------------------------
PNP_CHLFF       ----------------------------------------------------------------------
PNP_CHLCV       ----------------------------------------------------------------------
PNP_CHLAB       ----------------------------------------------------------------------
YABR_BACSU      ----------------------------------------------------------------------
PNP_SHEWM       ----------------------------------------------------------------------
PNP_SHEPW       ----------------------------------------------------------------------
PNP_SHEPA       ----------------------------------------------------------------------
PNP_SHEHH       ----------------------------------------------------------------------
PNP_PARDP       ----------------------------------------------------------------------
PNP_DESRM       ----------------------------------------------------------------------
PNP_BARBK       ----------------------------------------------------------------------
PNP_AMOA5       ----------------------------------------------------------------------
PNP_SHESH       ----------------------------------------------------------------------
PNP_NATTJ       ----------------------------------------------------------------------
PNP_CAUCR       ----------------------------------------------------------------------
PNP_CAUCN       ----------------------------------------------------------------------
PNP_BUCBP       ----------------------------------------------------------------------
PNP_VIBPA       ----------------------------------------------------------------------
PNP_VIBHB       ----------------------------------------------------------------------
PNP_TREDE       ----------------------------------------------------------------------
PNP_PELUB       ----------------------------------------------------------------------
PNP_PECCP       ----------------------------------------------------------------------
PNP_LISW6       ----------------------------------------------------------------------
PNP_LISMO       ----------------------------------------------------------------------
PNP_LISMH       ----------------------------------------------------------------------
PNP_LISMF       ----------------------------------------------------------------------
PNP_LISMC       ----------------------------------------------------------------------
PNP_LISIN       ----------------------------------------------------------------------
PNP_FLAJ1       ----------------------------------------------------------------------
PNP_ERWCT       ----------------------------------------------------------------------
PNP_CYTH3       ----------------------------------------------------------------------
PNP_CLOB8       ----------------------------------------------------------------------
PNP_CAUSK       ----------------------------------------------------------------------
PNP_VIBSL       ----------------------------------------------------------------------
PNP_TOLAT       ----------------------------------------------------------------------
PNP_SERP5       ----------------------------------------------------------------------
PNP_PSYWF       ----------------------------------------------------------------------
PNP_PARD8       ----------------------------------------------------------------------
PNP_ESCF3       ----------------------------------------------------------------------
PNP_EDWI9       ----------------------------------------------------------------------
PNP_ECOUT       ----------------------------------------------------------------------
PNP_ECOSM       ----------------------------------------------------------------------
PNP_ECOLU       ----------------------------------------------------------------------
PNP_ECOL6       ----------------------------------------------------------------------
PNP_ECOL5       ----------------------------------------------------------------------
PNP_ECOK1       ----------------------------------------------------------------------
PNP_ECO81       ----------------------------------------------------------------------
PNP_ECO45       ----------------------------------------------------------------------
PNP_ECO27       ----------------------------------------------------------------------
PNP_CHLPN       ----------------------------------------------------------------------
PNP_WOLSU       ----------------------------------------------------------------------
PNP_SHISS       ----------------------------------------------------------------------
PNP_SHIFL       ----------------------------------------------------------------------
PNP_SHIF8       ----------------------------------------------------------------------
PNP_SHIBS       ----------------------------------------------------------------------
PNP_SHIB3       ----------------------------------------------------------------------
PNP_SALTY       ----------------------------------------------------------------------
PNP_SALPK       ----------------------------------------------------------------------
PNP_SALPC       ----------------------------------------------------------------------
PNP_SALPB       ----------------------------------------------------------------------
PNP_SALPA       ----------------------------------------------------------------------
PNP_SALG2       ----------------------------------------------------------------------
PNP_SALEP       ----------------------------------------------------------------------
PNP_SALCH       ----------------------------------------------------------------------
PNP_SALAR       ----------------------------------------------------------------------
PNP_KLEP7       ----------------------------------------------------------------------
PNP_KLEP3       ----------------------------------------------------------------------
PNP_ERWT9       ----------------------------------------------------------------------
PNP_ENTS8       ----------------------------------------------------------------------
PNP_ENT38       ----------------------------------------------------------------------
PNP_ECOSE       ----------------------------------------------------------------------
PNP_ECOLI       ----------------------------------------------------------------------
PNP_ECOLC       ----------------------------------------------------------------------
PNP_ECOHS       ----------------------------------------------------------------------
PNP_ECODH       ----------------------------------------------------------------------
PNP_ECOBW       ----------------------------------------------------------------------
PNP_ECO8A       ----------------------------------------------------------------------
PNP_ECO7I       ----------------------------------------------------------------------
PNP_ECO5E       ----------------------------------------------------------------------
PNP_ECO57       ----------------------------------------------------------------------
PNP_ECO55       ----------------------------------------------------------------------
PNP_ECO24       ----------------------------------------------------------------------
PNP_CITK8       ----------------------------------------------------------------------
PNP_AERHH       ----------------------------------------------------------------------
PNP_ACTPJ       ----------------------------------------------------------------------
PNP_ACTP7       ----------------------------------------------------------------------
PNP_ACTP2       ----------------------------------------------------------------------
PNP_SPHWW       ----------------------------------------------------------------------
PNP_ROSDO       ----------------------------------------------------------------------
PNP_PASMU       ----------------------------------------------------------------------
PNP_PARUW       ----------------------------------------------------------------------
Y568_HAEIN      ----------------------------------------------------------------------
PNP_ZYMMO       ----------------------------------------------------------------------
PNP_SODGM       ----------------------------------------------------------------------
PNP_PORGI       ----------------------------------------------------------------------
PNP_PORG3       ----------------------------------------------------------------------
PNP_OPITP       ----------------------------------------------------------------------
PNP_CORDI       ----------------------------------------------------------------------
PNP_SHIDS       ----------------------------------------------------------------------
PNP_RUBXD       ----------------------------------------------------------------------
PNP_PELCD       ----------------------------------------------------------------------
PNP_MARMM       ----------------------------------------------------------------------
PNP_ACIC5       ----------------------------------------------------------------------
PNP_SOLUE       ----------------------------------------------------------------------
PNP_SHESW       ----------------------------------------------------------------------
PNP_SHESR       ----------------------------------------------------------------------
PNP_SHESM       ----------------------------------------------------------------------
PNP_SHESA       ----------------------------------------------------------------------
PNP_SHEPC       ----------------------------------------------------------------------
PNP_SHEON       ----------------------------------------------------------------------
PNP_SHEB9       ----------------------------------------------------------------------
PNP_SHEB8       ----------------------------------------------------------------------
PNP_SHEB5       ----------------------------------------------------------------------
PNP_SHEB2       ----------------------------------------------------------------------
PNP_VESOH       ----------------------------------------------------------------------
PNP_SULDN       ----------------------------------------------------------------------
PNP_STRZT       ----------------------------------------------------------------------
PNP_STRZJ       ----------------------------------------------------------------------
PNP_STRR6       ----------------------------------------------------------------------
PNP_STRPS       ----------------------------------------------------------------------
PNP_STRPN       ----------------------------------------------------------------------
PNP_STRPJ       ----------------------------------------------------------------------
PNP_STRP7       ----------------------------------------------------------------------
PNP_STRP4       ----------------------------------------------------------------------
PNP_STRP2       ----------------------------------------------------------------------
PNP_METEP       ----------------------------------------------------------------------
PNP_METC4       ----------------------------------------------------------------------
PNP_FINM2       ----------------------------------------------------------------------
PNP_CLOPH       ----------------------------------------------------------------------
PNP_ACTSZ       ----------------------------------------------------------------------
PNP_YERPY       ----------------------------------------------------------------------
PNP_YERPS       ----------------------------------------------------------------------
PNP_YERPP       ----------------------------------------------------------------------
PNP_YERPN       ----------------------------------------------------------------------
PNP_YERPG       ----------------------------------------------------------------------
PNP_YERPE       ----------------------------------------------------------------------
PNP_YERPB       ----------------------------------------------------------------------
PNP_YERPA       ----------------------------------------------------------------------
PNP_YERP3       ----------------------------------------------------------------------
PNP_VARPS       ----------------------------------------------------------------------
PNP_SALTI       ----------------------------------------------------------------------
PNP_RHOFD       ----------------------------------------------------------------------
PNP_NITOC       ----------------------------------------------------------------------
PNP_MYCA9       ----------------------------------------------------------------------
PNP_HYPNA       ----------------------------------------------------------------------
PNP_HAEIN       ----------------------------------------------------------------------
PNP_HAEIG       ----------------------------------------------------------------------
PNP_HAEIE       ----------------------------------------------------------------------
PNP_HAEI8       ----------------------------------------------------------------------
PNP_BACCN       ----------------------------------------------------------------------
PNP_THICR       ----------------------------------------------------------------------
PNP_STRPI       ----------------------------------------------------------------------
PNP_SILST       ----------------------------------------------------------------------
PNP_SHEAM       ----------------------------------------------------------------------
PNP_METPP       ----------------------------------------------------------------------
PNP_METPB       ----------------------------------------------------------------------
PNP_LEGPA       ----------------------------------------------------------------------
PNP_DINSH       ----------------------------------------------------------------------
PNP_DESAP       ----------------------------------------------------------------------
PNP_DEIRA       ----------------------------------------------------------------------
PNP_BUCCC       ----------------------------------------------------------------------
PNP_BUCAT       ----------------------------------------------------------------------
PNP_BUCAI       ----------------------------------------------------------------------
PNP_BUCA5       ----------------------------------------------------------------------
PNP_BIFA0       ----------------------------------------------------------------------
PNP4_ALKMQ      ----------------------------------------------------------------------
PNP_THETH       ----------------------------------------------------------------------
PNP_THET2       ----------------------------------------------------------------------
PNP_STRP3       ----------------------------------------------------------------------
PNP_STRGC       ----------------------------------------------------------------------
PNP_HAEPS       ----------------------------------------------------------------------
PNP_DESAH       ----------------------------------------------------------------------
PNP_DELAS       ----------------------------------------------------------------------
PNP_BACWK       ----------------------------------------------------------------------
PNP_MYCS2       ----------------------------------------------------------------------
PNP_LEGPL       ----------------------------------------------------------------------
PNP_LEGPH       ----------------------------------------------------------------------
PNP_LEGPC       ----------------------------------------------------------------------
PNP_AKKM8       ----------------------------------------------------------------------
PRP22_SCHPO     ----------------------------------------------------------------------
PNP_RHOCS       ----------------------------------------------------------------------
PNP_POLNA       ----------------------------------------------------------------------
PNP_DIAST       ----------------------------------------------------------------------
PNP_CORK4       ----------------------------------------------------------------------
PNP_BURP8       ----------------------------------------------------------------------
PNP_BIFAA       ----------------------------------------------------------------------
PNP_ACIF5       ----------------------------------------------------------------------
PNP_ACIF2       ----------------------------------------------------------------------
PNP_YEREN       ----------------------------------------------------------------------
PNP_YERE8       ----------------------------------------------------------------------
PNP_VEREI       ----------------------------------------------------------------------
PNP_THET8       ----------------------------------------------------------------------
PNP_STRTD       ----------------------------------------------------------------------
PNP_STRT2       ----------------------------------------------------------------------
PNP_STRT1       ----------------------------------------------------------------------
PNP_SHEFN       ----------------------------------------------------------------------
PNP_PSYA2       ----------------------------------------------------------------------
PNP_POLSJ       ----------------------------------------------------------------------
PNP_HERAR       ----------------------------------------------------------------------
PNP_BIFLO       ----------------------------------------------------------------------
PNP_BIFLD       ----------------------------------------------------------------------
PNP_BACSK       ----------------------------------------------------------------------
PNP_AZOSE       ----------------------------------------------------------------------
PNP_ACIBL       ----------------------------------------------------------------------
PNP_STRA5       ----------------------------------------------------------------------
PNP_STRA3       ----------------------------------------------------------------------
PNP_STRA1       ----------------------------------------------------------------------
PNP_SHEDO       ----------------------------------------------------------------------
PNP_PSYCK       ----------------------------------------------------------------------
PNP_POLSQ       ----------------------------------------------------------------------
PNP_POLNS       ----------------------------------------------------------------------
PNP_PERMH       ----------------------------------------------------------------------
PNP_NITHX       ----------------------------------------------------------------------
PNP_NITEU       ----------------------------------------------------------------------
PNP_MYCVP       ----------------------------------------------------------------------
PNP_MYCGI       ----------------------------------------------------------------------
PNP_GEOSW       ----------------------------------------------------------------------
PNP_DICNV       ----------------------------------------------------------------------
PNP_CHRSD       ----------------------------------------------------------------------
PNP_BAUCH       ----------------------------------------------------------------------
PNP_BACA2       ----------------------------------------------------------------------
PNP_ACISJ       ----------------------------------------------------------------------
PNP_ACIAC       ----------------------------------------------------------------------
PNP_RHOBA       ----------------------------------------------------------------------
PNP_MYCLE       ----------------------------------------------------------------------
PNP_MYCLB       ----------------------------------------------------------------------
PNP_KINRD       ----------------------------------------------------------------------
PNP_CHLT3       ----------------------------------------------------------------------
PNP_BACSU       ----------------------------------------------------------------------
PNP_BACLD       ----------------------------------------------------------------------
PNP_THEEB       ----------------------------------------------------------------------
PNP_SULNB       ----------------------------------------------------------------------
PNP_STRSV       ----------------------------------------------------------------------
PNP_STRPZ       ----------------------------------------------------------------------
PNP_STRPM       ----------------------------------------------------------------------
PNP_STRPD       ----------------------------------------------------------------------
PNP_STRPC       ----------------------------------------------------------------------
PNP_STRPB       ----------------------------------------------------------------------
PNP_STRP6       ----------------------------------------------------------------------
PNP_STRP1       ----------------------------------------------------------------------
PNP_SALRD       ----------------------------------------------------------------------
PNP_PHOPR       ----------------------------------------------------------------------
PNP_MYCTU       ----------------------------------------------------------------------
PNP_MYCTA       ----------------------------------------------------------------------
PNP_MYCSS       ----------------------------------------------------------------------
PNP_MYCSK       ----------------------------------------------------------------------
PNP_MYCSJ       ----------------------------------------------------------------------
PNP_MYCPA       ----------------------------------------------------------------------
PNP_MYCMM       ----------------------------------------------------------------------
PNP_MYCBT       ----------------------------------------------------------------------
PNP_MYCBP       ----------------------------------------------------------------------
PNP_MYCBO       ----------------------------------------------------------------------
PNP_MYCA1       ----------------------------------------------------------------------
PNP_MARMS       ----------------------------------------------------------------------
PNP_CYAP7       ----------------------------------------------------------------------
PNP_CORJK       ----------------------------------------------------------------------
PNP_CORA7       ----------------------------------------------------------------------
PNP_BUCAP       ----------------------------------------------------------------------
PNP_BIFLI       ----------------------------------------------------------------------
PNP_BARQU       ----------------------------------------------------------------------
PNP_BACP2       ----------------------------------------------------------------------
PNP_AZOSB       ----------------------------------------------------------------------
PNP_AZOPC       ----------------------------------------------------------------------
PNP_ANOFW       ----------------------------------------------------------------------
PNP_STRPG       ----------------------------------------------------------------------
PNP_STRPF       ----------------------------------------------------------------------
PNP_STRP8       ----------------------------------------------------------------------
PNP_STAS1       ----------------------------------------------------------------------
PNP_NOCFA       ----------------------------------------------------------------------
PNP_MYCUA       ----------------------------------------------------------------------
PNP_LYSSC       ----------------------------------------------------------------------
PNP_FERNB       ----------------------------------------------------------------------
PNP_BURCJ       ----------------------------------------------------------------------
PNP_BURCH       ----------------------------------------------------------------------
PNP_BURCC       ----------------------------------------------------------------------
PNP_BURCA       ----------------------------------------------------------------------
PNP_BACHK       ----------------------------------------------------------------------
PNP_BACCZ       ----------------------------------------------------------------------
PNP_BACCQ       ----------------------------------------------------------------------
PNP_BACC7       ----------------------------------------------------------------------
PNP_BACC4       ----------------------------------------------------------------------
PNP_BACC3       ----------------------------------------------------------------------
PNP_BACC2       ----------------------------------------------------------------------
PNP_BACC1       ----------------------------------------------------------------------
PNP_BACAN       ----------------------------------------------------------------------
PNP_BACAH       ----------------------------------------------------------------------
PNP_BACAC       ----------------------------------------------------------------------
PNP_BACAA       ----------------------------------------------------------------------
IF2A_THEON      ----------------------------------------------------------------------
PNP_THIDA       ----------------------------------------------------------------------
PNP_LEPCP       ----------------------------------------------------------------------
PNP_JANMA       ----------------------------------------------------------------------
PNP_FLAPJ       ----------------------------------------------------------------------
PNP_CYAP4       ----------------------------------------------------------------------
PNP_COREF       ----------------------------------------------------------------------
IF2A_PYRKO      ----------------------------------------------------------------------
PNP_TRIEI       ----------------------------------------------------------------------
PNP_THEAB       ----------------------------------------------------------------------
PNP_SULAA       ----------------------------------------------------------------------
PNP_RALPJ       ----------------------------------------------------------------------
PNP_GEOTN       ----------------------------------------------------------------------
PNP_CYAP8       ----------------------------------------------------------------------
PNP_ARTS2       ----------------------------------------------------------------------
PNP_ARTCA       ----------------------------------------------------------------------
PNP_ARTAT       ----------------------------------------------------------------------
IF2A_PYRFU      ----------------------------------------------------------------------
SRBD1_PONAB     ---------------------------KDLQVGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKL
PNP_THERP       ----------------------------------------------------------------------
PNP_NITEC       ----------------------------------------------------------------------
PNP_MICLC       ----------------------------------------------------------------------
PNP_MICAN       ----------------------------------------------------------------------
PNP_HAEDU       ----------------------------------------------------------------------
PNP_FUSNN       ----------------------------------------------------------------------
PNP_DEHE1       ----------------------------------------------------------------------
PNP_CHLPB       ----------------------------------------------------------------------
PNP_BART1       ----------------------------------------------------------------------
PNP_STRMK       ----------------------------------------------------------------------
PNP_STRM5       ----------------------------------------------------------------------
PNP_STACT       ----------------------------------------------------------------------
PNP_RHOE4       ----------------------------------------------------------------------
PNP_RALSO       ----------------------------------------------------------------------
PNP_MAGSM       ----------------------------------------------------------------------
PNP_KOCRD       ----------------------------------------------------------------------
PNP_HAMD5       ----------------------------------------------------------------------
PNP_GEOKA       ----------------------------------------------------------------------
PNP_CLOCE       ----------------------------------------------------------------------
PNP_BURXL       ----------------------------------------------------------------------
PNP_ANAVT       ----------------------------------------------------------------------
PNP_ANASP       ----------------------------------------------------------------------
IF2A_THEGJ      ----------------------------------------------------------------------
IF2A_PYRAB      ----------------------------------------------------------------------
PNP_THISH       ----------------------------------------------------------------------
PNP_DESVV       ----------------------------------------------------------------------
PNP_DESVM       ----------------------------------------------------------------------
PNP_DESVH       ----------------------------------------------------------------------
PNP_DESDA       ----------------------------------------------------------------------
PNP_BURVG       ----------------------------------------------------------------------
PNP_BURTA       ----------------------------------------------------------------------
PNP_BURS3       ----------------------------------------------------------------------
PNP_BURM1       ----------------------------------------------------------------------
PNP_BORPD       ----------------------------------------------------------------------
PNP_BORA1       ----------------------------------------------------------------------
PNP_BEUC1       ----------------------------------------------------------------------
PNP_BARHE       ----------------------------------------------------------------------
PNP_ALISL       ----------------------------------------------------------------------
SRBD1_HUMAN     --------------------------------GTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKL
PNP_VIBFM       ----------------------------------------------------------------------
PNP_VIBF1       ----------------------------------------------------------------------
PNP_STRAT       ----------------------------------------------------------------------
PNP_STAES       ----------------------------------------------------------------------
PNP_STAEQ       ----------------------------------------------------------------------
PNP_SALAI       ----------------------------------------------------------------------
PNP_RHOSR       ----------------------------------------------------------------------
PNP_RHOOB       ----------------------------------------------------------------------
PNP_RALME       ----------------------------------------------------------------------
PNP_RALEH       ----------------------------------------------------------------------
PNP_NOSP7       ----------------------------------------------------------------------
PNP_NITMU       ----------------------------------------------------------------------
PNP_LEPBP       ----------------------------------------------------------------------
PNP_LEPBA       ----------------------------------------------------------------------
PNP_ENTFA       ----------------------------------------------------------------------
PNP_CUPTR       ----------------------------------------------------------------------
PNP_BURPS       ----------------------------------------------------------------------
PNP_BURP6       ----------------------------------------------------------------------
PNP_BURP1       ----------------------------------------------------------------------
PNP_BURP0       ----------------------------------------------------------------------
PNP_BURMS       ----------------------------------------------------------------------
PNP_BURMA       ----------------------------------------------------------------------
PNP_BURM9       ----------------------------------------------------------------------
PNP_BURM7       ----------------------------------------------------------------------
PNP_BURCM       ----------------------------------------------------------------------
PNP_BURA4       ----------------------------------------------------------------------
PNP_BACCR       ----------------------------------------------------------------------
PNP_AGRRK       ----------------------------------------------------------------------
PNP_ACIC1       ----------------------------------------------------------------------
IF2A_PYRHO      ----------------------------------------------------------------------
PNP_SACEN       ----------------------------------------------------------------------
PNP_RENSM       ----------------------------------------------------------------------
PNP_PROAC       ----------------------------------------------------------------------
PNP_BURPP       ----------------------------------------------------------------------
PNP_BACC0       ----------------------------------------------------------------------
PNP_SALTO       ----------------------------------------------------------------------
PNP_RALEJ       ----------------------------------------------------------------------
PNP_GLUOX       ----------------------------------------------------------------------
PNP_CHLTE       ----------------------------------------------------------------------
PNP_CHLL2       ----------------------------------------------------------------------
PNP_NOCSJ       ----------------------------------------------------------------------
PNP_FRASC       ----------------------------------------------------------------------
PNP_FRAAA       ----------------------------------------------------------------------
PNP_DICTD       ----------------------------------------------------------------------
PNP_CORU7       ----------------------------------------------------------------------
PNP_CHRVO       ---------------------------------QAKEGRLHILGLMKEAVDGPQELSAHAP--RLYVMKI
PNP_CALS8       ----------------------------------------------------------------------
PNP_BORPE       ----------------------------------------------------------------------
PNP_BORPA       ----------------------------------------------------------------------
PNP_BORBR       ----------------------------------------------------------------------
PNP_BACHD       ----------------------------------------------------------------------
SRBD1_MOUSE     --------------------------------GTVLTGKVENATLFGVFVDIGVGKAGLIPIRFITEAKL
PNP_THETN       ----------------------------------------------------------------------
PNP_THESQ       ----------------------------------------------------------------------
PNP_THEP1       ----------------------------------------------------------------------
PNP_THEMA       ----------------------------------------------------------------------
PNP_THELT       ----------------------------------------------------------------------
PNP_SYNP6       ----------------------------------------------------------------------
PNP_SYNE7       ----------------------------------------------------------------------
PNP_NEIMF       ----------------------------------------------------------------------
PNP_NEIMB       ----------------------------------------------------------------------
PNP_NEIMA       ----------------------------------------------------------------------
PNP_NEIM0       ----------------------------------------------------------------------
PNP_HELHP       ----------------------------------------------------------------------
PNP_FRASN       ----------------------------------------------------------------------
PNP_CHLP8       ----------------------------------------------------------------------
PNP_ANATD       ----------------------------------------------------------------------
DHX8_MOUSE      ----------------------------------------------------------------------
DHX8_HUMAN      ----------------------------------------------------------------------
PNP_PELLD       ----------------------------------------------------------------------
PNP_LACLA       ----------------------------------------------------------------------
PNP_CHLPD       ----------------------------------------------------------------------
PNP_CELJU       ----------------------------------------------------------------------
IF2A_METJA      ----------------------------------------------------------------------
PNP_THENN       ----------------------------------------------------------------------
PNP_SYNWW       ----------------------------------------------------------------------
PNP_STRGG       ----------------------------------------------------------------------
PNP_RHIEC       ----------------------------------------------------------------------
PNP_PHEZH       ----------------------------------------------------------------------
PNP_LARHH       ----------------------------------------------------------------------
PNP_DEIGD       ----------------------------------------------------------------------
PNP_STRCO       ----------------------------------------------------------------------
PNP_STRAW       ----------------------------------------------------------------------
PNP_RHILW       ----------------------------------------------------------------------
PNP_RHILO       ----------------------------------------------------------------------
PNP_RHIL3       ----------------------------------------------------------------------
PNP_NEIG2       ----------------------------------------------------------------------
PNP_NEIG1       ----------------------------------------------------------------------
PNP_METI4       ----------------------------------------------------------------------
PNP_METCA       ----------------------------------------------------------------------
PNP_GRAFK       ----------------------------------------------------------------------
PNP_DECAR       ----------------------------------------------------------------------
PNP_SULMW       ----------------------------------------------------------------------
PNP_RHISN       ----------------------------------------------------------------------
PNP_RHIE6       ----------------------------------------------------------------------
PNP_PSESM       ----------------------------------------------------------------------
PNP_OCEIH       ----------------------------------------------------------------------
PNP_MANSM       ----------------------------------------------------------------------
PNP_DESAA       ----------------------------------------------------------------------
PNP_CHLCH       ----------------------------------------------------------------------
PNP_AGRT5       ----------------------------------------------------------------------
PNP_THEFY       ----------------------------------------------------------------------
PNP_NITWN       ----------------------------------------------------------------------
PNP_EXISA       ----------------------------------------------------------------------
PNP_EHRCR       ----------------------------------------------------------------------
PNP_AERS4       ----------------------------------------------------------------------
PNP_RICCK       ----------------------------------------------------------------------
PNP_RHIME       ----------------------------------------------------------------------
PNP_CAMC1       ----------------------------------------------------------------------
IF2A_METKA      ----------------------------------------------------------------------
TEX_BORPE       ----------------------------------------------------------------------
PNP_SINMW       ----------------------------------------------------------------------
PNP_PROVI       ----------------------------------------------------------------------
PNP_MESSB       ----------------------------------------------------------------------
PNP_DESDG       ----------------------------------------------------------------------
PNP_ACHLI       ----------------------------------------------------------------------
RNR_MYCPU       ----------------------------------------------------------------------
PNP_SYNP2       ----------------------------------------------------------------------
PNP_RICM5       ----------------------------------------------------------------------
PNP_RICFE       ----------------------------------------------------------------------
PNP_PROM3       ----------------------------------------------------------------------
PNP_NEOSM       ----------------------------------------------------------------------
PNP_EHRCJ       ----------------------------------------------------------------------
PNP_DICT6       ----------------------------------------------------------------------
PNP_CLAMS       ----------------------------------------------------------------------
PNP_CLAM3       ----------------------------------------------------------------------
NUSA_HAEIN      ----AMQTARQVISTKIREAERAKVVEQREEEGKIVTGTVKKVSRDSIILDLGNKAEAMIAREDM----L
IF2A_THEVO      ----------------------------------------------------------------------
IF2A_METTH      ----------------------------------------------------------------------
PNP_RICRS       ----------------------------------------------------------------------
PNP_RICRO       ----------------------------------------------------------------------
PNP_RICPU       ----------------------------------------------------------------------
PNP_RICCN       ----------------------------------------------------------------------
PNP_RICBR       ----------------------------------------------------------------------
PNP_RICB8       ----------------------------------------------------------------------
PNP_RICAE       ----------------------------------------------------------------------
PNP_PROMM       ----------------------------------------------------------------------
PNP_EXIS2       ----------------------------------------------------------------------
MOG5_CAEEL      ----------------------------------------------------------------------
IF2A_THEAC      ----------------------------------------------------------------------
IF2A_ARCFU      ----------------------------------------------------------------------
ZAM_SYNY3       ----------------------------------------------------------------------
PNP_SPICI       ----------------------------------------------------------------------
PNP_ORITI       ----------------------------------------------------------------------
PNP_ORITB       ----------------------------------------------------------------------
PNP_MACCJ       ----------------------------------------------------------------------
PNP_GLOVI       ----------------------------------------------------------------------
PNP_AGRVS       ----------------------------------------------------------------------
DHX8_ARATH      ----------------------------------------------------------------------
PNP_SYNSC       ----------------------------------------------------------------------
PNP_SYNPX       ----------------------------------------------------------------------
PNP_STAHJ       ----------------------------------------------------------------------
PNP_EHRRW       ----------------------------------------------------------------------
PNP_EHRRG       ----------------------------------------------------------------------
RNR_BACSU       ----------------------------------------------------------------------
PNP_UNCTG       ----------------------------------------------------------------------
PNP_SYNS3       ----------------------------------------------------------------------
PNP_SYNR3       ----------------------------------------------------------------------
PNP_SYNPW       ----------------------------------------------------------------------
PNP_SYNJA       ----------------------------------------------------------------------
PNP_PROMS       ----------------------------------------------------------------------
PNP_PROMA       ----------------------------------------------------------------------
PNP_PROM5       ----------------------------------------------------------------------
PNP_PROM2       ----------------------------------------------------------------------
PNP_LEIXX       ----------------------------------------------------------------------
PNP_BLOPB       ----------------------------------------------------------------------
PNP_ACAM1       ----------------------------------------------------------------------
DHX8_DICDI      ----------------------------------------------------------------------
PNP_STAAW       ----------------------------------------------------------------------
PNP_STAAT       ----------------------------------------------------------------------
PNP_STAAS       ----------------------------------------------------------------------
PNP_STAAR       ----------------------------------------------------------------------
PNP_STAAN       ----------------------------------------------------------------------
PNP_STAAM       ----------------------------------------------------------------------
PNP_STAAE       ----------------------------------------------------------------------
PNP_STAAC       ----------------------------------------------------------------------
PNP_STAAB       ----------------------------------------------------------------------
PNP_STAA9       ----------------------------------------------------------------------
PNP_STAA8       ----------------------------------------------------------------------
PNP_STAA3       ----------------------------------------------------------------------
PNP_STAA2       ----------------------------------------------------------------------
PNP_STAA1       ----------------------------------------------------------------------
PNP_RICTY       ----------------------------------------------------------------------
PNP_RICAH       ----------------------------------------------------------------------
PNP_PROMT       ----------------------------------------------------------------------
PNP_PROMP       ----------------------------------------------------------------------
PNP_PROM9       ----------------------------------------------------------------------
PNP_PROM4       ----------------------------------------------------------------------
PNP_PROM1       ----------------------------------------------------------------------
PNP_PROM0       ----------------------------------------------------------------------
PNP_PROA2       ----------------------------------------------------------------------
PNP_SYNY3       ----------------------------------------------------------------------
PNP_SYNS9       ----------------------------------------------------------------------
PNP_SULSY       ----------------------------------------------------------------------
PNP_RICPR       ----------------------------------------------------------------------
PNP_HAES2       ----------------------------------------------------------------------
PNP_HAES1       ----------------------------------------------------------------------
PNP_CYAA5       ----------------------------------------------------------------------
PNP_ANAPZ       ----------------------------------------------------------------------
YHGF_NEIMB      ----------------------------------------------------------------------
YHGF_NEIMA      ----------------------------------------------------------------------
PNP_OCHA4       ----------------------------------------------------------------------
NO40_MOUSE      ----------------------------------------------------------------------
NO40_HUMAN      ----------------------------------------------------------------------
IF2A_HALMA      ----------------------------------------------------------------------
PRP22_YEAST     ----------------------------------------------------------------------
PNP_WIGBR       ----------------------------------------------------------------------
PNP_METFK       ----------------------------------------------------------------------
PNP_JANSC       ----------------------------------------------------------------------
PNP_CORGL       ----------------------------------------------------------------------
PNP_CORGB       ----------------------------------------------------------------------
PNP_COPPD       ----------------------------------------------------------------------
PNP_BRUSU       ----------------------------------------------------------------------
PNP_BRUSI       ----------------------------------------------------------------------
PNP_BRUO2       ----------------------------------------------------------------------
PNP_BRUME       ----------------------------------------------------------------------
PNP_BRUMB       ----------------------------------------------------------------------
PNP_BRUC2       ----------------------------------------------------------------------
PNP_BRUAB       ----------------------------------------------------------------------
PNP_BRUA2       ----------------------------------------------------------------------
PNP_BRUA1       ----------------------------------------------------------------------
PNP_ARCB4       ----------------------------------------------------------------------
IF2A_METST      ----------------------------------------------------------------------
PNP_SYNJB       ----------------------------------------------------------------------
PNP_MAGSA       ----------------------------------------------------------------------
PNP_DEIDV       ----------------------------------------------------------------------
PNP_TROWT       ----------------------------------------------------------------------
PNP_TROW8       ----------------------------------------------------------------------
PNP_STRU0       ----------------------------------------------------------------------
PNP_PELPB       ----------------------------------------------------------------------
IF2A_METS3      ----------------------------------------------------------------------
PNP_CAMJE       ----------------------------------------------------------------------
PNP_ACICJ       ----------------------------------------------------------------------
PNPT1_MOUSE     ----------------------------------------------------------------------
PNP_LAWIP       ----------------------------------------------------------------------
PNP_CAMLR       ----------------------------------------------------------------------
RNR_SHIFL       ----------------------------------------------------------------------
RNR_ECOLI       ----------------------------------------------------------------------
PNP_XANP2       ----------------------------------------------------------------------
PNP_GLUDA       ----------------------------------------------------------------------
PNP_CARHZ       ----------------------------------------------------------------------
PNP_TREPS       ----------------------------------------------------------------------
PNP_TREPA       ----------------------------------------------------------------------
PNP_CAMC5       ----------------------------------------------------------------------
PNPT1_HUMAN     ----------------------------------------------------------------------
IF2A_HALSA      ----------------------------------------------------------------------
IF2A_HALS3      ----------------------------------------------------------------------
RNR_THEMA       ----------------------------------------------------------------------
PNP_THEM4       ----------------------------------------------------------------------
PNP_STRSY       ----------------------------------------------------------------------
PNP_STRS2       ----------------------------------------------------------------------
PNP_RHORT       ----------------------------------------------------------------------
PNP_HYDS0       ----------------------------------------------------------------------
PNP_AZOC5       ----------------------------------------------------------------------
PNPT1_PONAB     ----------------------------------------------------------------------
RNR1_LACLA      ----------------------------------------------------------------------
PNP_PETMO       ----------------------------------------------------------------------
NUSA_BUCAI      -----TQTAKQVIVQKVREAERAMLVEQRKYTGQIITGIVKKINRDNIMLDLGNNAEALI----LREGML
PNP_STRMU       ----------------------------------------------------------------------
PNP_GRABC       ----------------------------------------------------------------------
PNP_CAMJD       ----------------------------------------------------------------------
NUSA_SHIFL      -----TQTAKQVIVQKVREAERAMVVDQREHEGEIITGVVKKVNRDNISLDLGNNAEAVI----LREDML
NUSA_ECOLI      -----TQTAKQVIVQKVREAERAMVVDQREHEGEIITGVVKKVNRDNISLDLGNNAEAVI----LREDML
NUSA_ECOL6      -----TQTAKQVIVQKVREAERAMVVDQREHEGEIITGVVKKVNRDNISLDLGNNAEAVI----LREDML
NUSA_ECO57      -----TQTAKQVIVQKVREAERAMVVDQREHEGEIITGVVKKVNRDNISLDLGNNAEAVI----LREDML
NUSA_BUCAP      -----TQTAKQVIVQKVREAERAMLVDQRKHIGQIITGIVKKISRDNLTLDLGNNAEALI----LREGML
PNP_STRS7       ----------------------------------------------------------------------
PNP_STREM       ----------------------------------------------------------------------
PNP_STRE4       ----------------------------------------------------------------------
PNP_PHYMT       ----------------------------------------------------------------------
PNP_CAMHC       ----------------------------------------------------------------------
RPOE1_METJA     ----------------------------------------------------------------------
PNP_CAMFF       ----------------------------------------------------------------------
PNP_BREBN       ----------------------------------------------------------------------
RNR_VIBCH       ----------------------------------------------------------------------
PNP_METRJ       ----------------------------------------------------------------------
PNP_LACLS       ----------------------------------------------------------------------
PNP_LACLM       ----------------------------------------------------------------------
PNP_BRASO       ----------------------------------------------------------------------
PNP_BRAJA       ----------------------------------------------------------------------
RPOE_SULAC      ----------------------------------------------------------------------
PNP_HELPS       ----------------------------------------------------------------------
PNP_HELP2       ----------------------------------------------------------------------
PNP_BRASB       ----------------------------------------------------------------------
Y1198_METJA     ----------------------------------------------------------------------
RNR2_LACLA      ----------------------------------------------------------------------
PNP_METS4       ----------------------------------------------------------------------
PNP_HELPJ       ----------------------------------------------------------------------
PNP_HELPH       ----------------------------------------------------------------------
PNP_FRATW       ----------------------------------------------------------------------
PNP_FRATT       ----------------------------------------------------------------------
PNP_FRATO       ----------------------------------------------------------------------
PNP_FRATN       ----------------------------------------------------------------------
PNP_FRATM       ----------------------------------------------------------------------
PNP_FRATH       ----------------------------------------------------------------------
PNP_FRATF       ----------------------------------------------------------------------
PNP_FRAT1       ----------------------------------------------------------------------
RR1_SPIOL       ----------------------------------------------------------------------
RS1B_SYNY3      ----------------------------------------------------------------------
PNP_RHOSK       ----------------------------------------------------------------------
PNP_RHOSK       --------------------------------GQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRL
PNP_RHOS5       ----------------------------------------------------------------------
PNP_RHOS5       --------------------------------GQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRL
PNP_RHOS4       ----------------------------------------------------------------------
PNP_RHOS4       --------------------------------GQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRL
PNP_RHOS1       ----------------------------------------------------------------------
PNP_RHOS1       --------------------------------GQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANKRL
PNP_HERA2       ----------------------------------------------------------------------
PNP_HERA2       -------------------------LTREAKVGEIFTGKVVRIMPYGAFVNVLPGKDGMVHVSELDEKRV
PNP_HERA2       ----------------------------------------------------------------------
PNP_CHLSY       ----------------------------------------------------------------------
PNP_CHLSY       -------------------------LTREAKVGDIFLGKVVSIKPFGAFVNILPGKDGMVHVSELDEKRV
PNP_CHLSY       ----------------------------------------------------------------------
PNP_CHLAD       ----------------------------------------------------------------------
PNP_CHLAD       -------------------------LTREAKVGDIFLGKVVSIKPFGAFVNILPGKDGMVHVSELDEKRV
PNP_CHLAD       ----------------------------------------------------------------------
PNP_CHLAA       ----------------------------------------------------------------------
PNP_CHLAA       -------------------------LTREAKVGDIFLGKVVSIKPFGAFVNILPGKDGMVHVSELDEKRV
PNP_CHLAA       ----------------------------------------------------------------------
PNP_ROSS1       ----------------------------------------------------------------------
PNP_ROSS1       -------------------------LTREIKVGDIFLGKVVRIMPFGAFVNLAPGKDGMVHVSELDVGRV
PNP_ROSS1       ----------------------------------------------------------------------
PNP_ROSCS       ----------------------------------------------------------------------
PNP_ROSCS       -------------------------LTREIKVGDIFLGKVVRIMPFGAFVNLAPGKDGMVHVSELDVGRV
PNP_ROSCS       ----------------------------------------------------------------------
PNP_THEYD       ----------------------------------------------------------------------
PNP_THEYD       --------------------------------GRIYMGKVTRIVDFGAFVEIMPGVEGLLHISQIADKRI
PNP_XYLFT       ----------------------------------------------------------------------
PNP_XYLFT       ----------------AAAREAKRRIEQDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XYLFM       ----------------------------------------------------------------------
PNP_XYLFM       ----------------AAAREAKRRIEQDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XYLFA       ----------------------------------------------------------------------
PNP_XYLFA       ----------------AAAREAKCRIEQDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XYLF2       ----------------------------------------------------------------------
PNP_XYLF2       ----------------AAAREAKRRIEQDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_BACTN       ----------------------------------------------------------------------
PNP_BACTN       --------------------------------GEVYKGKVRSIMPYGAFIEFLPGKDGLLHISEIDWKRL
PNP_XANOR       ----------------------------------------------------------------------
PNP_XANOR       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANOP       ----------------------------------------------------------------------
PNP_XANOP       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANOM       ----------------------------------------------------------------------
PNP_XANOM       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANCP       ----------------------------------------------------------------------
PNP_XANCP       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANCB       ----------------------------------------------------------------------
PNP_XANCB       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANC8       ----------------------------------------------------------------------
PNP_XANC8       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANC5       ----------------------------------------------------------------------
PNP_XANC5       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_XANAC       ----------------------------------------------------------------------
PNP_XANAC       -----------------------------VEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSERV
PNP_SORC5       ----------------------------------------------------------------------
PNP_SYMTH       ----------------------------------------------------------------------
PNP_SYMTH       ---------------ERARQMIEA-LVKDPEPGMIYTGRVTRLMQFGAFVEILPGKEGLVHISELSDKRV
PNP_CLOPS       -------------------------LTKEVKSGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRV
PNP_BACFR       ----------------------------------------------------------------------
PNP_BACFR       ----------------------------------------------------------------------
PNP_BACFR       --------------------------------GEVYKGKVRSIMPYGAFVEFLPGKDGLLHISEIDWKRL
PNP_BACFN       ----------------------------------------------------------------------
PNP_BACFN       ----------------------------------------------------------------------
PNP_BACFN       --------------------------------GEVYKGKVRSIMPYGAFVEFLPGKDGLLHISEIDWKRL
PNP_PSEHT       ----------------------------------------------------------------------
PNP_PSEHT       ------------------------QLTAELEVGTIYEGKVVRIVDFGAFVNILPGKDGLVHISQISTERV
PNP_PSEHT       ----------------------------------------------------------------------
PNP_LEPIN       ----------------------------------------------------------------------
PNP_LEPIN       -----------------------------VEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRV
PNP_LEPIC       ----------------------------------------------------------------------
PNP_LEPIC       -----------------------------VEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRV
PNP_LEPBL       ----------------------------------------------------------------------
PNP_LEPBL       -----------------------------VEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRV
PNP_LEPBJ       ----------------------------------------------------------------------
PNP_LEPBJ       -----------------------------VEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRV
PNP_CLOTH       -------------------------IAKDIEPGQVFLGRVIRVTSFGAFVEFLPGKEGLVHISKLDKKRV
PNP_CLOPE       -------------------------LTKEVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRV
PNP_CLOP1       -------------------------LTKEVKAGEIYLGKVTKIAQFGAFVEVLPNKEGLVHISKLDNKRV
PNP_DEHSC       ----------------------------------------------------------------------
PNP_DEHSC       -------------------------LTKDIEAGSIYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRV
PNP_DEHSB       ----------------------------------------------------------------------
PNP_DEHSB       -------------------------LTKDIEAGSIYTGKVTRIMTFGAFVEILPGKEGMVHISELADHRV
PNP_CLOBM       ----------------------------------------------------------------------
PNP_CLOBM       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_CLOBL       ----------------------------------------------------------------------
PNP_CLOBL       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_CLOBK       ----------------------------------------------------------------------
PNP_CLOBK       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_CLOBJ       ----------------------------------------------------------------------
PNP_CLOBJ       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_CLOBH       ----------------------------------------------------------------------
PNP_CLOBH       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_CLOB6       ----------------------------------------------------------------------
PNP_CLOB6       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_CLOB1       ----------------------------------------------------------------------
PNP_CLOB1       -------------------------LTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARV
PNP_SYNFM       ----------------------------------------------------------------------
PNP_SYNFM       ---------------------------------------------------------------RVITIMI
PNP_GEMAT       ----------------------------------------------------------------------
PNP_ALHEH       ----------------------------------------------------------------------
PNP_DESPS       ----------------------------------------------------------------------
PNP_DESPS       -------------ALAEALVERVKSITAEVEVGAVYTGKVKTIKDFGAFVEILPGTDGLVHISELALERV
PNP_DESPS       ----------------------------------------------------------------------
PNP_DESOH       ----------------------------------------------------------------------
PNP_DESOH       ----------------AASTEEEARIAIKAEPGEIYEGEVVRITDFGAFIQIKNGTDGLCHISELEHHHV
PNP_PSEA6       ----------------------------------------------------------------------
PNP_PSEA6       ----------------------------------------------------------------------
PNP_NOVAD       ----------------------------------------------------------------------
PNP_NOVAD       ----------------------------------------------------------------------
PNP_CHLTR       ----------------------------------------------------------------------
PNP_CHLTR       -------------------------LTGEVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKV
PNP_CHLTB       ----------------------------------------------------------------------
PNP_CHLTB       -------------------------LTGEVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKV
PNP_CHLTA       ----------------------------------------------------------------------
PNP_CHLTA       -------------------------LTGEVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKV
PNP_CHLT2       ----------------------------------------------------------------------
PNP_CHLT2       -------------------------LTGEVEVGKVYNGRVTSIATFGVFVEVLPGKEGLCHISELSKQKV
PNP_BACV8       ----------------------------------------------------------------------
PNP_BACV8       --------------------------------GEVYVGKVRSVMPYGVFVEFLPGKDGLLHISEIDWKRL
PNP_BACV8       ----------------------------------------------------------------------
PNP_THEPX       ----------------------------------------------------------------------
PNP_THEPX       -------------SGERAKQMIEA-ITKDIAVGEIYLGKVLRITPFGAFVEIAPGKEGLVHISKLSKKRV
PNP_THEP3       ----------------------------------------------------------------------
PNP_THEP3       -------------SGERAKQMIEA-ITKDIAVGEIYLGKVLRITPFGAFVEIAPGKEGLVHISKLSKKRV
PNP_SHELP       ----------------------------------------------------------------------
PNP_SHELP       ------------------IQEITAEVEV----GTVYNGKVVRIVDFGAFVTILPGKDGLVHISQ-----I
PNP_SHELP       ----------------------------------------------------------------------
PNP_GEOSM       ----------------------------------------------------------------------
PNP_GEOBB       ----------------------------------------------------------------------
PNP_COLP3       ----------------------------------------------------------------------
PNP_COLP3       ---------------EDAINRIKA-LTAEIEVGTLYTGKVVRIVDFGAFVNVLPGKDGLVHISQ-----I
PNP2_ALKMQ      ----------------------------------------------------------------------
PNP2_ALKMQ      --------PDQE-SARVALEMIELIVKDPV-VGEVYTGKVIKIMDFGAFVEILPGKEGLVHISNLAHERV
PNP1_ALKMQ      ----------------------------------------------------------------------
PNP1_ALKMQ      --------PDQE-SARVALEMIELIVKDPV-VGEVYTGKVIKIMDFGAFVEILPGKEGLVHISNLAHERV
YHGF_ECOLI      ----------------------------------------------------------------------
YHGF_ECOLI      -----------------------------LQPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLSNKFV
PNP_VIBVY       ----------------------------------------------------------------------
PNP_VIBVY       ------------------IQEITAEVEV----GVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRV
PNP_VIBVU       ----------------------------------------------------------------------
PNP_VIBVU       ------------------IQEITAEVEV----GVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRV
PNP_VIBCM       ----------------------------------------------------------------------
PNP_VIBCM       ------------------IQEITAEVEV----GVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRV
PNP_VIBCH       ----------------------------------------------------------------------
PNP_VIBCH       ------------------IQEITAEVEV----GVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRV
PNP_VIBC3       ----------------------------------------------------------------------
PNP_VIBC3       ------------------IQEITAEVEV----GVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRV
PNP_DESHD       ----------------------------------------------------------------------
PNP_CHLMU       ----------------------------------------------------------------------
PNP_SYNAS       ----------------------------------------------------------------------
PNP_SYNAS       --------------------------------GKIYRGTVKKVVDFGAFVEILPGTEGLLHISQLAKERV
PNP_SILPO       ----------------------------------------------------------------------
PNP_SILPO       --------------------------------GQVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENRRL
PNP_RUTMC       ----------------------------------------------------------------------
PNP_PSEPW       ----------------------------------------------------------------------
PNP_PSEPW       ----------------------------------------------------------------------
PNP_PSEPU       ----------------------------------------------------------------------
PNP_PSEPU       ----------------------------------------------------------------------
PNP_PSEPK       ----------------------------------------------------------------------
PNP_PSEPK       ----------------------------------------------------------------------
PNP_PSEPG       ----------------------------------------------------------------------
PNP_PSEPG       ----------------------------------------------------------------------
PNP_PSEPF       ----------------------------------------------------------------------
PNP_PSEPF       ----------------------------------------------------------------------
PNP_PSEP1       ----------------------------------------------------------------------
PNP_PSEP1       ----------------------------------------------------------------------
PNP_PSEFS       ----------------------------------------------------------------------
PNP_PSEFS       ----------------------------------------------------------------------
PNP_PSEF5       ----------------------------------------------------------------------
PNP_PSEF5       ----------------------------------------------------------------------
PNP_PSE14       ----------------------------------------------------------------------
PNP_PSE14       ----------------------------------------------------------------------
PNP_MYXXD       ----------------------------------------------------------------------
PNP_MYXXD       -------------AVKAAIAMIQA-LTREAEIGKIYTGTVRKIAEFGAFVELFPGTDGLIHISELSDKRV
PNP_MARAV       ----------------------------------------------------------------------
PNP_MARAV       ----------------------------------------------------------------------
PNP_MARAV       ----------------------------------------------------------------------
PNP_GEOUR       ----------------------------------------------------------------------
PNP_GEOMG       ----------------------------------------------------------------------
PNP_CLOTE       ----------------------------------------------------------------------
PNP_CLOTE       -------------------------LTKDVEAGEIYLGKVTRTTNFGAFVEILPGKEGLVHISKLDFTRV
PNP_ANADE       -------------------------LTQEAEVGRIYMGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRV
PNP_ALKOO       ----------------------------------------------------------------------
PNP_ALKOO       --------------------------------GDIFKGKVIKLMNFGAFVEILPGKEGLVHISNLAHERV
PNP_PSEU2       ----------------------------------------------------------------------
PNP_PSEU2       ----------------------------------------------------------------------
PNP_PSEE4       ----------------------------------------------------------------------
PNP_PSEE4       ----------------------------------------------------------------------
PNP_HALHL       ----------------------------------------------------------------------
PNP_HALHL       -----------------------------VEVGKVYDGKVAKLMDFGAFVNILPGRDGLVHISQISNNRV
PNP_GEOSL       ----------------------------------------------------------------------
PNP_GEOSF       ----------------------------------------------------------------------
PNP_ERYLH       ----------------------------------------------------------------------
PNP_ERYLH       --------------IEAARKWIEGIVEE-AEVGKIYNGKVVNIVDFGAFVNFMGGKDGLVHVSEMKNERV
PNP_CLOK5       ----------------------------------------------------------------------
PNP_CLOK5       -------------------------LTREILVGEIYLGKVTKITNFGAFVEIHKGKEGLVHISKLDFTRV
PNP_CLOK1       ----------------------------------------------------------------------
PNP_CLOK1       -------------------------LTREILVGEIYLGKVTKITNFGAFVEIHKGKEGLVHISKLDFTRV
PNP_ANASK       -------------------------LTQEAEVGRIYLGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRV
PNP_ANAD2       -------------------------LTQEAEVGRIYLGTVRKIAEFGAFVEIFPGTDGLIHISELSDKRV
PNP_ALCBS       ----------------------------------------------------------------------
PNP_ALCBS       ---------------EAVRRVEEITAEAEV--GAIYEGKVTRVVDFGAFVAIMPGTEGLLHISQIAEERV
PNP_TERTT       ----------------------------------------------------------------------
PNP_TERTT       ----------------------------------------------------------------------
PNP_PSEU5       ----------------------------------------------------------------------
PNP_PSEU5       --------------------------------GKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDQRI
PNP_PSEU5       ----------------------------------------------------------------------
PNP_MOOTA       ----------------------------------------------------------------------
PNP_HAHCH       ----------------------------------------------------------------------
PNP_ELUMP       ----------------------------------------------------------------------
PNP_DESHY       ----------------------------------------------------------------------
PNP_CLOAB       ----------------------------------------------------------------------
PNP_CLOAB       -------------------------LTKDVKVGEVYLGKVTKITNFGAFVEVLPGKEGLVHISKLDINKV
PNP_AZOVD       ----------------------------------------------------------------------
PNP_AZOVD       --------------------------------GKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDQRI
PNP_AZOVD       ----------------------------------------------------------------------
PNP3_ALKMQ      ----------------------------------------------------------------------
PNP3_ALKMQ      --------------------------------GEVYTGKVIKIMDFGAFVEILPGKEGLVHISNLAHERV
PNP_PSYIN       ----------------------------------------------------------------------
PNP_PSYIN       -------------------------LTAEVEVGTIYTGKVVRLADFGAFVNILPGKDGLVHISQICEERV
PNP_PSYIN       ----------------------------------------------------------------------
PNP_PSEMY       ----------------------------------------------------------------------
PNP_PSEMY       ---------------EAAKQRVLA-ITAEAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDQRV
PNP_PSEMY       ----------------------------------------------------------------------
PNP_PHOLU       ----------------------------------------------------------------------
PNP_PHOLU       -----------------------------IEVGRIYAGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_BRAHW       ----------------------------------------------------------------------
PNP_ANADF       ----------------------------------------------------------------------
PNP_NITSB       ----------------------------------------------------------------------
PNP_HELMI       ----------------------------------------------------------------------
PNP_HELMI       -----------------------------VEVGKVYTGKVTRIMNFGAFVEVLPGKEGLIHISQLAEERV
PNP_GEOLS       ----------------------------------------------------------------------
PNP_CLONN       ----------------------------------------------------------------------
PNP_CLONN       ---------------------------REVKEGEVYLGKVTKIANFGAFVEILPGKEGLVHISKLDVKRV
PNP_CLONN       ----------------------------------------------------------------------
PNP_CLOBB       ----------------------------------------------------------------------
PNP_CLOBB       -------------------------LTKDVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERV
PNP_CLOBA       ----------------------------------------------------------------------
PNP_CLOBA       -------------------------LTKDVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERV
PNP_BDEBA       ----------------------------------------------------------------------
PNP_BDEBA       ----ASADPEATKKAIAMINDIIAEAEV----GKTYKGRIVKIAEFGAFVEILPNTQGLLHISEISNERV
PNP_SPHAL       ----------------------------------------------------------------------
PNP_SPHAL       -----------------------AGIVEEAEVGKIYDGKVVNLVDFGAFVNFMGGKDGLVHVSEIRNERV
PNP_SPHAL       ----------------------------------------------------------------------
PNP_SACD2       ----------------------------------------------------------------------
PNP_PSEAE       ----------------------------------------------------------------------
PNP_PSEAE       ----------------------------------------------------------------------
PNP_PSEAE       --------------------------------GKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRI
PNP_PSEAB       ----------------------------------------------------------------------
PNP_PSEAB       ----------------------------------------------------------------------
PNP_PSEAB       --------------------------------GKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRI
PNP_PSEA8       ----------------------------------------------------------------------
PNP_PSEA8       ----------------------------------------------------------------------
PNP_PSEA8       --------------------------------GKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRI
PNP_PSEA7       ----------------------------------------------------------------------
PNP_PSEA7       ---------------EAAKQRVLA-ITAEAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISQISDKRI
PNP_PSEA7       ----------------------------------------------------------------------
PNP_PROMH       ----------------------------------------------------------------------
PNP_PROMH       ----AATSGEQAKQAIARIEEITAEVEV----GRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_PELPD       ----------------------------------------------------------------------
PNP_HALOH       ----------------------------------------------------------------------
PNP_HALOH       ------------------------KLTKEVEVGDIYEGRVKKITNFGAFVEILPGREGLVHISELADHHV
GS13_BACSU      ----------------------------------------------------------------------
GS13_BACSU      --------------------------------GSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFV
GS13_BACSU      ----------------------------------------------------------------------
PNP_CLOD6       ----------------------------------------------------------------------
PNP_CLOD6       ----------------------------------------------------------------------
PNP_BLOFL       --------------------------------GSIYTGRVTHIVDFGAFVTLFAGKEGLVHISQITEKRV
PNP_ACIBY       ----------------------------------------------------------------------
PNP_ACIBY       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERI
PNP_ACIBY       ----------------------------------------------------------------------
PNP_ACIBT       ----------------------------------------------------------------------
PNP_ACIBT       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERI
PNP_ACIBT       ----------------------------------------------------------------------
PNP_ACIBS       ----------------------------------------------------------------------
PNP_ACIBS       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERI
PNP_ACIBS       ----------------------------------------------------------------------
PNP_ACIBC       ----------------------------------------------------------------------
PNP_ACIBC       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERI
PNP_ACIBC       ----------------------------------------------------------------------
PNP_ACIB5       ----------------------------------------------------------------------
PNP_ACIB5       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERI
PNP_ACIB5       ----------------------------------------------------------------------
PNP_ACIB3       ----------------------------------------------------------------------
PNP_ACIB3       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERI
PNP_ACIB3       ----------------------------------------------------------------------
PNP_ACIAD       ----------------------------------------------------------------------
PNP_ACIAD       -----------------------------VEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERV
PNP_ACIAD       ----------------------------------------------------------------------
PNP_PHOLL       ----------------------------------------------------------------------
PNP_PHOLL       -----------------------------IEVARIYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_IDILO       ----------------------------------------------------------------------
PNP_COXBU       ----------------------------------------------------------------------
PNP_COXBR       ----------------------------------------------------------------------
PNP_COXBN       ----------------------------------------------------------------------
PNP_COXB2       ----------------------------------------------------------------------
PNP_COXB1       ----------------------------------------------------------------------
PNP_CHLFF       ----------------------------------------------------------------------
PNP_CHLCV       ----------------------------------------------------------------------
PNP_CHLAB       ----------------------------------------------------------------------
YABR_BACSU      ----------------------------------------------------------------------
PNP_SHEWM       ----------------------------------------------------------------------
PNP_SHEPW       ----------------------------------------------------------------------
PNP_SHEPA       ----------------------------------------------------------------------
PNP_SHEHH       ----------------------------------------------------------------------
PNP_PARDP       ----------------------------------------------------------------------
PNP_PARDP       --------------------------------GKIYVGKVVKLVDFGAFVNFFGKRDGLVHVSQIAGKRL
PNP_DESRM       ----------------------------------------------------------------------
PNP_AMOA5       ----------------------------------------------------------------------
PNP_AMOA5       ----------------------------------------------------------------------
PNP_AMOA5       -------------------QEAVQSAEKRVKDGDVYQGTVKSIVPFGAFVEFMPGKEGLLHISEVKWERI
PNP_SHESH       ----------------------------------------------------------------------
PNP_NATTJ       -------------------------LIKEPEVGEVYLGKVVRTEKYGAFVEILPGKEGLVHISELAEDRV
PNP_BUCBP       ----------------------------------------------------------------------
PNP_BUCBP       -----------------------------VEVGSVYTGKVTRIVDFGAFVSIGIGKEGLVHISQIAHKRV
PNP_VIBPA       ----------------------------------------------------------------------
PNP_VIBPA       --------------------------------GRIYTGKVARLADFGAFVTVLPGKDGLVHISQIAEKRV
PNP_VIBHB       ----------------------------------------------------------------------
PNP_VIBHB       --------------------------------GRIYTGKVARLADFGAFVTVLPGKDGLVHISQIAEKRV
PNP_VIBHB       ----------------------------------------------------------------------
PNP_TREDE       ----------------------------------------------------------------------
PNP_PELUB       ---------------------------------KIYSGKVMKIMEFGAFVNFLGKQDGLVHISELATKRV
PNP_PECCP       ----------------------------------------------------------------------
PNP_PECCP       --------------------------------GRVYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_PECCP       ----------------------------------------------------------------------
PNP_LISW6       ---------------------------REVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERV
PNP_LISW6       ----------------------------------------------------------------------
PNP_LISMO       ---------------------------REVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERV
PNP_LISMO       ----------------------------------------------------------------------
PNP_LISMH       ---------------------------REVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERV
PNP_LISMH       ----------------------------------------------------------------------
PNP_LISMF       ---------------------------REVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERV
PNP_LISMF       ----------------------------------------------------------------------
PNP_LISMC       ---------------------------REVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERV
PNP_LISMC       ----------------------------------------------------------------------
PNP_LISIN       ---------------------------REVEVGEVYTGKVRRIEKFGAFVELFKGTDGLVHISELAHERV
PNP_LISIN       ----------------------------------------------------------------------
PNP_ERWCT       ----------------------------------------------------------------------
PNP_ERWCT       --------------------------------GRVYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_ERWCT       ----------------------------------------------------------------------
PNP_CYTH3       ----------------------------------------------------------------------
PNP_CYTH3       ----------------------------------------------------------------------
PNP_CYTH3       --------------------------------GEVYEGKVKSITAFGAFVEFLPGKDGLLHISEIKWERL
PNP_CLOB8       ----------------------------------------------------------------------
PNP_CLOB8       -------------------------LTKEVKAGEVYLGKVTKITTFGAFVEILPSKEGLVHISKLAKERV
PNP_VIBSL       ----------------------------------------------------------------------
PNP_VIBSL       --------------------------------GRIYQGKVARLADFGAFVTILPGKDGLVHISQIADKRV
PNP_TOLAT       ----------------------------------------------------------------------
PNP_TOLAT       -----------------AAQEAIRRIQALVEIGRIYEGKVTRLAEFGAFVNILPGKDGLVHISQITDERV
PNP_SERP5       ----------------------------------------------------------------------
PNP_SERP5       --------------------------------GRIYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_SERP5       ----------------------------------------------------------------------
PNP_PARD8       ----------------------------------------------------------------------
PNP_PARD8       --------------------------------GEVYEGKISSIMPYGAFVEFMPGKDGLLHISEIDWKRL
PNP_PARD8       ----------------------------------------------------------------------
PNP_ESCF3       ----------------------------------------------------------------------
PNP_ESCF3       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_EDWI9       ----------------------------------------------------------------------
PNP_EDWI9       --------------------------------GRIYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_EDWI9       ----------------------------------------------------------------------
PNP_ECOUT       ----------------------------------------------------------------------
PNP_ECOUT       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_ECOSM       ----------------------------------------------------------------------
PNP_ECOSM       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_ECOLU       ----------------------------------------------------------------------
PNP_ECOLU       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_ECOL6       ----------------------------------------------------------------------
PNP_ECOL6       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_ECOL5       ----------------------------------------------------------------------
PNP_ECOL5       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
PNP_ECOK1       ----------------------------------------------------------------------
PNP_ECOK1       --------------------------------GRVYNGKVTRIVDFGAFVAIGGGKEGLVHI