[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS82289.1

[Show Plain Result]


## Summary of Sequence Search
    1::223
   25::136     5e-31  46%  156 aa  MOAE_BACHD RecName: Full=Molybdopterin-converting factor subunit
    2::140     5e-30  44%  148 aa  MOAE_PYRAB RecName: Full=Molybdopterin-converting factor subunit
   18::153     7e-30  46%  165 aa  MOAE_ANASP RecName: Full=Molybdopterin-converting factor subunit
    2::134     3e-29  41%  157 aa  MOAE_BACSU RecName: Full=Molybdopterin-converting factor subunit
    4::134     2e-26  40%  150 aa  MOAE_STACT RecName: Full=Molybdopterin-converting factor subunit
   22::177     8e-26  43%  189 aa  MOC2B_BOVIN RecName: Full=Molybdenum cofactor synthesis protein 2B;
   18::151     8e-26  40%  198 aa  MOC2B_ARATH RecName: Full=Molybdenum cofactor synthesis protein 2B;
   12::138     8e-26  43%  150 aa  MOAE_SALTY RecName: Full=Molybdopterin-converting factor subunit
   12::138     8e-26  43%  150 aa  MOAE_SALTI RecName: Full=Molybdopterin-converting factor subunit
   11::138     3e-25  43%  150 aa  MOAE_ECOLI RecName: Full=Molybdopterin-converting factor subunit
    4::133     4e-25  40%  148 aa  MOAE_STAAW RecName: Full=Molybdopterin-converting factor subunit
    4::133     4e-25  40%  148 aa  MOAE_STAAS RecName: Full=Molybdopterin-converting factor subunit
    4::133     4e-25  40%  148 aa  MOAE_STAAR RecName: Full=Molybdopterin-converting factor subunit
    4::133     4e-25  40%  148 aa  MOAE_STAAC RecName: Full=Molybdopterin-converting factor subunit
   27::137     5e-25  45%  150 aa  MOAE_PSEAE RecName: Full=Molybdopterin-converting factor subunit
    9::133     6e-25  42%  148 aa  MOAE_STAAN RecName: Full=Molybdopterin-converting factor subunit
    9::133     6e-25  42%  148 aa  MOAE_STAAM RecName: Full=Molybdopterin-converting factor subunit
    6::139     8e-25  46%  155 aa  MO2B1_AEDAE RecName: Full=Molybdenum cofactor synthesis protein 2B
    2::126     2e-24  45%  372 aa  MOC2B_DROWI RecName: Full=Molybdenum cofactor synthesis protein 2B;
   34::177     2e-24  42%  189 aa  MOC2B_MOUSE RecName: Full=Molybdenum cofactor synthesis protein 2B;
    4::133     2e-24  39%  150 aa  MOAE_STAES RecName: Full=Molybdopterin-converting factor subunit
    4::133     2e-24  39%  150 aa  MOAE_STAEQ RecName: Full=Molybdopterin-converting factor subunit
    6::139     2e-24  45%  155 aa  MO2B2_AEDAE RecName: Full=Molybdenum cofactor synthesis protein 2B
   44::188     3e-24  42%  200 aa  MOC2B_RAT RecName: Full=Molybdenum cofactor synthesis protein 2B;  
   12::146     4e-24  40%  176 aa  MOAE_RALSO RecName: Full=Molybdopterin-converting factor subunit
   15::143     5e-24  39%  147 aa  MOAE1_MYCTU RecName: Full=Molybdopterin-converting factor subunit 2
    2::141     9e-24  44%  157 aa  MOC2B_CULQU RecName: Full=Molybdenum cofactor synthesis protein 2B;
   10::138     9e-24  38%  150 aa  MOAE_PASMU RecName: Full=Molybdopterin-converting factor subunit
   10::147     9e-24  36%  151 aa  MOAE_HAEDU RecName: Full=Molybdopterin-converting factor subunit
   10::126     2e-23  45%  361 aa  MOC2B_DROPS RecName: Full=Molybdenum cofactor synthesis protein 2B;
   10::126     2e-23  45%  361 aa  MOC2B_DROPE RecName: Full=Molybdenum cofactor synthesis protein 2B;
    6::126     2e-23  47%  154 aa  MOC2B_ANOGA RecName: Full=Molybdenum cofactor synthesis protein 2B;
   10::138     3e-23  37%  150 aa  MOAE_HAEIN RecName: Full=Molybdopterin-converting factor subunit
   28::139     5e-23  42%  151 aa  MOAE_YERPE RecName: Full=Molybdopterin-converting factor subunit
   31::144     6e-23  47%  155 aa  MOC2B_TAEGU RecName: Full=Molybdenum cofactor synthesis protein 2B;
    5::137     6e-23  41%  150 aa  MOAE_VIBCH RecName: Full=Molybdopterin-converting factor subunit
    2::126     2e-22  41%  367 aa  MOC2B_DROYA RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::144     2e-22  41%  154 aa  MOAE_AQUAE RecName: Full=Molybdopterin-converting factor subunit
    2::126     3e-22  41%  367 aa  MOC2B_DROER RecName: Full=Molybdenum cofactor synthesis protein 2B;
    8::133     3e-22  37%  137 aa  MOAE_THEVO RecName: Full=Molybdopterin-converting factor subunit
    2::126     5e-22  41%  362 aa  MOC2B_DROGR RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::126     7e-22  41%  363 aa  MOC2B_DROAN RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::126     2e-21  40%  367 aa  MOC2B_DROSI RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::126     2e-21  40%  367 aa  MOC2B_DROME RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::126     4e-21  40%  367 aa  MOC2B_DROSE RecName: Full=Molybdenum cofactor synthesis protein 2B;
    5::134     4e-21  39%  150 aa  MOAE_CAUCR RecName: Full=Molybdopterin-converting factor subunit
   11::138     6e-21  40%  158 aa  MOC2B_DICDI RecName: Full=Molybdenum cofactor synthesis protein 2B;
    1::153     7e-21  41%  193 aa  MOC2B_ORYSJ RecName: Full=Molybdenum cofactor synthesis protein 2B;
    1::153     7e-21  41%  193 aa  MOC2B_ORYSI RecName: Full=Molybdenum cofactor synthesis protein 2B;
    6::131     1e-20  35%  145 aa  Y903_SYNY3 RecName: Full=Uncharacterized protein slr0903;
   30::160     3e-20  40%  172 aa  MOC2B_PONAB RecName: Full=Molybdenum cofactor synthesis protein 2B;
   24::149     5e-20  40%  182 aa  MOC2B_MAGGR RecName: Full=Molybdenum cofactor synthesis protein 2B;
   30::176     2e-19  35%  188 aa  MOC2B_HUMAN RecName: Full=Molybdenum cofactor synthesis protein 2B;
   33::138     5e-19  39%  163 aa  MOAE_BRUSU RecName: Full=Molybdopterin-converting factor subunit
   33::138     5e-19  39%  163 aa  MOAE_BRUME RecName: Full=Molybdopterin-converting factor subunit
   41::161     9e-19  40%  180 aa  MOC2B_ASPNC RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::126     2e-18  37%  366 aa  MOC2B_DROMO RecName: Full=Molybdenum cofactor synthesis protein 2B;
   49::179     2e-18  38%  198 aa  MOC2B_ASPCL RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::131     5e-18  38%  345 aa  MOC2B_DROVI RecName: Full=Molybdenum cofactor synthesis protein 2B;
   33::163     6e-18  38%  179 aa  MOC2B_ASPOR RecName: Full=Molybdenum cofactor synthesis protein 2B;
   11::142     2e-17  38%  159 aa  MOAE_RHILO RecName: Full=Molybdopterin-converting factor subunit
   33::146     2e-17  43%  165 aa  MOAE_SYNE7 RecName: Full=Molybdopterin-converting factor subunit
   29::153     5e-17  36%  180 aa  MOC2B_PYRTR RecName: Full=Molybdenum cofactor synthesis protein 2B;
   37::166     5e-17  37%  206 aa  MOC2B_NEUCR RecName: Full=Molybdenum cofactor synthesis protein 2B;
   51::170     5e-17  38%  196 aa  MOC2B_COCIM RecName: Full=Molybdenum cofactor synthesis protein 2B;
   29::134     3e-15  38%  155 aa  MOAE_RHIME RecName: Full=Molybdopterin-converting factor subunit
   17::153     1e-14  33%  188 aa  MOC2B_PHANO RecName: Full=Molybdenum cofactor synthesis protein 2B;
   16::117     2e-13  40%  196 aa  MOC2B_SCLS1 RecName: Full=Molybdenum cofactor synthesis protein 2B;
   47::146     2e-13  39%  195 aa  MOC2B_EMENI RecName: Full=Molybdenum cofactor synthesis protein 2B;
   40::141     1e-12  38%  188 aa  MOC2B_NEOFI RecName: Full=Molybdenum cofactor synthesis protein 2B;
   40::141     2e-12  38%  188 aa  MOC2B_ASPFU RecName: Full=Molybdenum cofactor synthesis protein 2B;
   40::141     2e-12  38%  188 aa  MOC2B_ASPFC RecName: Full=Molybdenum cofactor synthesis protein 2B;
   52::170     2e-11  31%  205 aa  MOC2B_AJECN RecName: Full=Molybdenum cofactor synthesis protein 2B;
    2::81      4e-11  49%   81 aa  MOAD_ECOLI RecName: Full=Molybdopterin-converting factor subunit
    9::134     2e-10  34%  141 aa  MOAE2_MYCTU RecName: Full=Molybdopterin-converting factor subunit 2
    2::81      4e-08  46%   81 aa  MOAD_HAEIN RecName: Full=Molybdopterin-converting factor subunit
   27::133     6e-08  29%  146 aa  MOAE_RHOS4 RecName: Full=Molybdopterin-converting factor subunit
   23::117     3e-07  31%  119 aa  Y717_METJA RecName: Full=Uncharacterized protein MJ0717;
   15::93      4e-07  34%   93 aa  MOC2A_MAIZE RecName: Full=Molybdenum cofactor synthesis protein
    1::83      4e-07  38%   83 aa  MOC2A_CHLRE RecName: Full=Molybdenum cofactor synthesis protein
   16::96      8e-07  33%   96 aa  MOC2A_ARATH RecName: Full=Molybdenum cofactor synthesis protein
   23::93      7e-06  43%   93 aa  MOC2A_PYRTR RecName: Full=Molybdenum cofactor synthesis protein
    4::86      3e-05  36%   86 aa  MOC2A_DICDI RecName: Full=Molybdenum cofactor synthesis protein
    6::88      4e-05  35%   88 aa  MOC2A_HUMAN RecName: Full=Molybdenum cofactor synthesis protein
    6::88      6e-05  37%   88 aa  MOC2A_MOUSE RecName: Full=Molybdenum cofactor synthesis protein
   40::109     7e-05  29%  109 aa  MOC2A_ORYSJ RecName: Full=Molybdenum cofactor synthesis protein 2A;
   40::109     7e-05  29%  109 aa  MOC2A_ORYSI RecName: Full=Molybdenum cofactor synthesis protein 2A;
    8::90      7e-05  34%   90 aa  MOC2A_DROER RecName: Full=Molybdenum cofactor synthesis protein
    8::90      1e-04  40%   90 aa  MOC2A_DROME RecName: Full=Molybdenum cofactor synthesis protein
    8::90      2e-04  39%   90 aa  MOC2A_DROYA RecName: Full=Molybdenum cofactor synthesis protein
    8::90      2e-04  32%   90 aa  MOC2A_DROSE RecName: Full=Molybdenum cofactor synthesis protein
    8::90      3e-04  39%   90 aa  MOC2A_DROSI RecName: Full=Molybdenum cofactor synthesis protein
   15::120     4e-04  32%  145 aa  MOAE_HELPY RecName: Full=Molybdopterin-converting factor subunit
   23::96      6e-04  39%   96 aa  MOC2A_PHANO RecName: Full=Molybdenum cofactor synthesis protein
    4::84      6e-04  34%   84 aa  MOC2A_CAEEL RecName: Full=Molybdenum cofactor synthesis protein
    1::223

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
MOAE_BACHD      ----------------------------------------------------------------------
MOAE_PYRAB      ----------------------------------------------------------------------
MOAE_ANASP      ----------------------------------------------------------------------
MOAE_BACSU      ----------------------------------------------------------------------
MOAE_STACT      ----------------------------------------------------------------------
MOC2B_BOVIN     --------------------------------------------------------------PLVEGS--
MOC2B_ARATH     ----------------------------------------------------------------------
MOAE_SALTY      ----------------------------------------------------------------------
MOAE_SALTI      ----------------------------------------------------------------------
MOAE_ECOLI      ----------------------------------------------------------------------
MOAE_STAAW      ----------------------------------------------------------------------
MOAE_STAAS      ----------------------------------------------------------------------
MOAE_STAAR      ----------------------------------------------------------------------
MOAE_STAAC      ----------------------------------------------------------------------
MOAE_PSEAE      ----------------------------------------------------------------------
MOAE_STAAN      ----------------------------------------------------------------------
MOAE_STAAM      ----------------------------------------------------------------------
MO2B1_AEDAE     ----------------------------------------------------------------------
MOC2B_DROWI     ----------------------------------------------------------------------
MOC2B_MOUSE     ----------------------------------------------------------------KDVDDV
MOAE_STAES      ----------------------------------------------------------------------
MOAE_STAEQ      ----------------------------------------------------------------------
MO2B2_AEDAE     ----------------------------------------------------------------------
MOC2B_RAT       ---------------------------------------------------------------LKDVDDV
MOAE_RALSO      ----------------------------------------------------------------------
MOAE1_MYCTU     ----------------------------------------------------------------------
MOC2B_CULQU     ----------------------------------------------------------------------
MOAE_PASMU      ----------------------------------------------------------------------
MOAE_HAEDU      ----------------------------------------------------------------------
MOC2B_DROPS     ----------------------------------------------------------------------
MOC2B_DROPE     ----------------------------------------------------------------------
MOC2B_ANOGA     ----------------------------------------------------------------------
MOAE_HAEIN      ----------------------------------------------------------------------
MOAE_YERPE      ----------------------------------------------------------------------
MOC2B_TAEGU     ----------------------------------------------------------------------
MOAE_VIBCH      ----------------------------------------------------------------------
MOC2B_DROYA     ----------------------------------------------------------------------
MOAE_AQUAE      --------------------------------------------------------------------EV
MOC2B_DROER     ----------------------------------------------------------------------
MOAE_THEVO      ----------------------------------------------------------------------
MOC2B_DROGR     ----------------------------------------------------------------------
MOC2B_DROAN     ----------------------------------------------------------------------
MOC2B_DROSI     ----------------------------------------------------------------------
MOC2B_DROME     ----------------------------------------------------------------------
MOC2B_DROSE     ----------------------------------------------------------------------
MOAE_CAUCR      ----------------------------------------------------------------------
MOC2B_DICDI     ----------------------------------------------------------------------
MOC2B_ORYSJ     -------------------------------------------------MASDELPVAAAAT--EEEDLV
MOC2B_ORYSI     -------------------------------------------------MASDELPVAAAAT--EEEDLV
Y903_SYNY3      ----------------------------------------------------------------------
MOC2B_PONAB     ------------------------------------------------------------EPSRKDMDEV
MOC2B_MAGGR     ----------------------------------------------------------------------
MOC2B_HUMAN     ------------------------------------------------------------EPSRKDMDEV
MOAE_BRUSU      ----------------------------------------------------------------------
MOAE_BRUME      ----------------------------------------------------------------------
MOC2B_ASPNC     ----------------------------------------------------------------------
MOC2B_DROMO     ----------------------------------------------------------------------
MOC2B_ASPCL     ----------------------------------------------------------------------
MOC2B_DROVI     ----------------------------------------------------------------------
MOC2B_ASPOR     ----------------------------------------------------------------------
MOAE_RHILO      ----------------------------------------------------------------------
MOAE_SYNE7      ----------------------------------------------------------------------
MOC2B_PYRTR     ----------------------------------------------------------------------
MOC2B_NEUCR     ----------------------------------------------------------------------
MOC2B_COCIM     ----------------------------------------------------------------------
MOAE_RHIME      ----------------------------------------------------------------------
MOC2B_PHANO     ----------------------------------------------------------------------
MOC2B_SCLS1     ----------------------------------------------------------------------
MOC2B_EMENI     ----------------------------------------------------------------------
MOC2B_NEOFI     ----------------------------------------------------------------------
MOC2B_ASPFU     ----------------------------------------------------------------------
MOC2B_ASPFC     ----------------------------------------------------------------------
MOC2B_AJECN     ----------------------------------------------------------------------
MOAD_ECOLI      --IKVLFFAQVRELVGTDEVAADFPTVEALRQHMAAQSDRW-ALALEDGLAAVNQTLVSFDHPLTDGDEV
MOAE2_MYCTU     ----------------------------------------------------------------------
MOAD_HAEIN      --LNVLFFAQTRELIGVDAIQLETAEAVREHLAQKGDKW---ALALEKGLVAINQTLMPLESAVKNGDEI
MOAE_RHOS4      ----------------------------------------------------------------------
Y717_METJA      ----------------------------------------------------------------------
MOC2A_MAIZE     --VKVLFFARARDLTGVADSAVEVPPGSTAGECLARVLAQFPKLEEIRGVLALNEEYAADSAAVADGDEL
MOC2A_CHLRE     MQIKVLYFAKSREVAGVNEQTFELGDGAHTEDLLAQIIAAHPALDMKTCVFALNQEYVRPQDKLKDGDEV
MOC2A_ARATH     VEIKVLLFARARELTGVPDLTLKMPSGSTTQKCLDELVLKFPSLEEVRSVLALNEEYTTDSAIVQHRDEL
MOC2A_PYRTR     ----------------TGKTSEHLPAPVRARHVFTMLEERYPGIGLSSCAVTVNLEYVDAEQQIEEGDEV
MOC2A_DICDI     -QFKILLFAKVKEVIGKDSIFIDLPESTSFNLIRK-LKHIYPQISLEVSLLAVNQEYISRDQDIKSNDEI
MOC2A_HUMAN     -QVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIAVRQELGDQLLVLQPGDEI
MOC2A_MOUSE     -QIDVLYFAKSAEIAGVRSETISVPQEIKASELWKELEMLHPGLADVRNQVAVRQELGDXXXXXXPGDEV
MOC2A_ORYSJ     -----------RDLTGVTEAPVEVPAGSTAGDCLARVLAAFPRLERRSMVLALNEEYAPEDAAVGDGDEL
MOC2A_ORYSI     -----------RDLTGVTEAPVEVPAGSTAGDCLARVLAAFPRLERRSMVLALNEEYAPEDAAVGDGDEL
MOC2A_DROER     VNVHVLFFAKSRELANTPRSKVDVPTKITASDLLDLLVSRFGLISIRDNLIAHNESYIDSDTVLKEGDEL
MOC2A_DROME     VNVHVLFFAKSRELANTPRSTVEVPTEITATELLDHLVSKF-------GLTSINLILAHNESYIKEGDEL
MOC2A_DROYA     VNVHVLFFAKSRELANTPRSKVDLPTEITASDLLELLVSKF-------GLTPINLILAHNESYIKEGDEL
MOC2A_DROSE     VNVHVLFFAKSRELANTPRSTVDVPTEITANELLDHLVSKFGLISIRDNLIAHNESYIDNLSDFKEGDEL
MOC2A_DROSI     VNVHVLFFAKSRELANTPRSTVDVPTEITATELLDHLVSKF-------GLTSINLILAHNESYIKEGDEL
MOAE_HELPY      ----------------------------------------------------------------------
MOC2A_PHANO     ----------------TGKTSEHLPAPIKACDLFDTLEDRYPGIK--GKVLAINEGAADLERVIQEGDEV
MOC2A_CAEEL     --IKVLFFGEACQLVGKREEAIDFPEETDYEEIRKTILENYPALQKKVMMLAVDQEYAGDRFELVRFTEI


                         .         .         *         .         .         .         .:140
query           AFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMA
MOAE_BACHD      -------------------------------PHAGAINTFIGTVRELTKGKRTLYLQYEAYPSMAEKKLA
MOAE_PYRAB      --------GKSKVSLVKKPEDIEEAIALVSSSSTGGIVIFLGKVRDENLGRKVEKLIYEAYDEMAIKEME
MOAE_ANASP      ---------EDSFAITFAPLSLEEIHALADDSANGAVVVMSGMVRNQTDGKPVVSLEYQAYEPMALRVFY
MOAE_BACSU      ----------ERFEITKTPINTENIIKKVEKREAGAITTFIGTVREWTNGKRTVRLEYEAYEPMAVQMLA
MOAE_STACT      ------------FEIVTEPIQTEQHRDFTLNPHQGAVVVFTGHVREWTKGIRTEHLEYEAYIPMAEKKLA
MOC2B_BOVIN     TFEPPGKDSKDIIKFTSEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEIR
MOC2B_ARATH     -------------------VDVVKYIDYVSAPQAGAIATFSGTTRDMFEGKTVLELRYEAYVPMATRCLS
MOAE_SALTY      ------------------PFSVGEEYSWLAADEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALA
MOAE_SALTI      ------------------PFSVGEEYSWLAADEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALA
MOAE_ECOLI      -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNHNLGDSVNALTLEHYPGMTEKALA
MOAE_STAAW      ------------FEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
MOAE_STAAS      ------------FEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
MOAE_STAAR      ------------FEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
MOAE_STAAC      ------------FEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
MOAE_PSEAE      ----------------------------------GAVVGFVGYVRDFNDGREVGGMFLEHYPGMTEKALG
MOAE_STAAN      -----------------EPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
MOAE_STAAM      -----------------EPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
MO2B1_AEDAE     --------------LTFDKLEVGEINDLVAHESCGAISLFVGTTRDNFDGKTVVLLEYEAYEAMALKTMN
MOC2B_DROWI     ----------DHIELISSPLDITTLYTLLGDPGCGASSVFVGTTRDSFEGKKVLSLEYEAYEPMAIKEMK
MOC2B_MOUSE     QEKP-----KDIIQFTAEKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVPMAENEIR
MOAE_STAES      ------------FEIVTQPIETEQYRDFTINERQGAVVVFTGHVREWTKGIRTQHLEYEAYIPMAEKKLA
MOAE_STAEQ      ------------FEIVTQPIETEQYRDFTINERQGAVVVFTGHVREWTKGIRTQHLEYEAYIPMAEKKLA
MO2B2_AEDAE     --------------LTFDKLEVGEINDLVAHESCGAISLFVGTTRDNFDGKTVVLLEYEAYEAMALKTMN
MOC2B_RAT       LEKP-----KDIIQFTAKKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEIR
MOAE_RALSO      --------------------DLGAEIAALRAPQIGAVASFIGTVRDINDGSGVSEMELEHYPGMTEKALA
MOAE1_MYCTU     --------------LTDQPLSVDEVLAAVSGPEQGGIVIFVGNVRDHNAGHDVTRLFYEAYPPMVIRTLM
MOC2B_CULQU     --------GSNYLKLTFDKLDVGEINELVAHESCGAVALFVGTTRDNFDGKEVVLLQYEAYEAMALKSMN
MOAE_PASMU      ----------------EQPFDQNAAYRWLSEQHVGATVVFVGKVRDLNLGDEVSSLYLEHYPAMTEKALT
MOAE_HAEDU      ----------------QAPFDQHAIYQWLSEPHVGATTIFVGKVREMNLGDNVSGLYLEHYPAMTKKALQ
MOC2B_DROPS     ------------------PIDVTYAINLISDPSCGASSIFIGTTRDSFQGKKVVSLAYEAYENMALKEMD
MOC2B_DROPE     ------------------PIDVTYAINLISDPSCGASSIFIGTTRDSFQGKKVVSLAYEAYENMALKEMD
MOC2B_ANOGA     --------------LTFDKLDVGALNDQVAHESCGAVSLFVGTTRDNFEGKTVVLLEYEAYEAMAIKTMN
MOAE_HAEIN      ----------------EQPFDQNAVYQWLSEQHIGATVIFVGKVRDLNLGDEVSSLYLEHYPAMTEKALN
MOAE_YERPE      --------------------------------EDGAVVTFTGKVRNHNLGASVSALTLEHYPGMTEKALT
MOC2B_TAEGU     -------------------------------PYCGAVSLFIGTTRNNFEGKKVIHLEYEAYTSMAETEMK
MOAE_VIBCH      -----VSVQKEDFSVAQE---YEAL---AQGSQAGAVVTFVGKVRDMNLGDNVVGLHLEHYPGMTEKSLL
MOC2B_DROYA     ----------DHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVVSLAYEAYDSMALKEMN
MOAE_AQUAE      GMIPRVYLGHEWFGAER------ILSEYQVPEDCGAQVLFLGIPRNPEDGGNIEALEYEAYPEMAIKEME
MOC2B_DROER     ----------DHVKLVNDPIDIAHIHQLLADAGCGASSVFVGTTRDNFQGKKVVSLAYEAYDSMALKEMN
MOAE_THEVO      --------------ITEKDINPLDLINRVRRPDAGAIVTFEGTVRNDSDGVRVTALYYEAYKEMAEMQIA
MOC2B_DROGR     ----------DHIQLVNSQIDINHIHNLLIDESCGASSVFVGTTRDNFDGKKVISLEYESYEKMALKEMS
MOC2B_DROAN     ----------DHVKLVGDPIDISHIHELLLDDGCGASSVFVGTTRDNFQGKKVVSLAYEAYDNMAIKEMN
MOC2B_DROSI     ----------DHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMN
MOC2B_DROME     ----------DHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMN
MOC2B_DROSE     ----------DHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMN
MOAE_CAUCR      --------------LTDQPFEPGVLVSCAGREETGAVATFIGLARAEQGAARA--LELEAYPGFTDAAIT
MOC2B_DICDI     --------------ISENIIDLNYWYKIVSDDSSGATSSFLGTTRNEFKGKSVERLEYETYEPMAIKEIE
MOC2B_ORYSJ     EILDEGSGRLDIARYVDHVRDLAA----------GAIATFEGTTRDSFEGRRVVELRYEAYGXXXXXXXX
MOC2B_ORYSI     EILDEGSGRLDIARYVDHVRDLAA----------GAIATFEGTTRDSFEGRRVVELRYEAYGXXXXXXXX
Y903_SYNY3      ------------FDISDQPINTQPLISALQCDQAGALVTFAGWVRNHNDGKQVDSLEYQVYRELAINEGF
MOC2B_PONAB     E-----EKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVR
MOC2B_MAGGR     -------------GLTHDKLDVQRTMDRVRSPEAGAIVVFVGTTRNSFDGKPVKELNYTAYNPMALRTMI
MOC2B_HUMAN     E-----EKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVR
MOAE_BRUSU      --------------------------------EIGAIVTFTGLCRDEDG--QLAALELEHYPGMAQAEIS
MOAE_BRUME      --------------------------------EIGAIVTFTGLCRDEDG--QLAALELEHYPGMAQAEIS
MOC2B_ASPNC     ------------------PLDPTSALSKISSPNAGANVLFLGTTRNSFEDRPVAQLSYTAYPPLALKTLS
MOC2B_DROMO     ----------DHIKLIRNKIDINHIHQLIIDQSCGACSVFVGTTRDHFEGKKVISLEYEAYESMALKEMG
MOC2B_ASPCL     --------------LTYSPLNPSQALTHTSSPAAGANVLFLGTTRDTFEGRAVSQLSYTCYPPLALKTLL
MOC2B_DROVI     ----------DHIQLLNDKIDINLIHQLLIDQSCGACSVFLGTTRDNFEGKNVISLEYEAYENMALKEMG
MOC2B_ASPOR     --------------LTYSPLNAQSALDKISSPAAGANVLFLGTTRNTFEDRAVSQLSYTAYPPLTLKTLA
MOAE_RHILO      --------------IQRQDFDVAAEIAALTQADVGAVVSFSGLCRDEQGA--LSALELEHYPGMXXXXXX
MOAE_SYNE7      ---------------------------------YGAFASFVGWVRRVNVGRLVTGITYQSFQPLCRTVLT
MOC2B_PYRTR     --------------LTPHDLDSLAATRFVRSPSAGATVLFIGTTRDSFNNEPVSSLAYTSYTPLAISTLF
MOC2B_NEUCR     --------------LTHDHLNYQSVIDRVRSPEAGAIVVFAGTTRNNFNSLPVQHLSYTSYAPLALRTML
MOC2B_COCIM     --------------LTYHPLSPSTYLAHTRSPAAGANVLFLGTTRDTFEDKPVARLAYTSYAPLALRTLS
MOAE_RHIME      --------------------------------DIGAVVTFSGLCR--DEAGALSALELEHYPGMAEAEIE
MOC2B_PHANO     ----PVTKTTDTIHIELTPNDLDSLAAFVRSPSAGATVLFIGTTRDSFNDKAVSSLSYTSYAPLAISTLY
MOC2B_SCLS1     --------------LTHEHLDAKVMMDKVRSPKAGAIVLFAGTTRDNFGGKPVKELQYTSYEPRALQSML
MOC2B_EMENI     --------------LTYHTLSPTTALQHVSSPSSGANILFLGTTRDTFDDRPVARLSYTSYPALALKSLH
MOC2B_NEOFI     --------------LTYSTLNPTVALEHTSSPAAGANVLFLGTTRNTFEGRAVSQLSYTSYPPLALKSLM
MOC2B_ASPFU     --------------LTYSTLNPTVALEHTSSPAAGANVLFLGTTRDTFEGRAVSQLSYTSYPPLALKSLM
MOC2B_ASPFC     --------------LTYSTLNPTVALEHTSSPAAGANVLFLGTTRDTFEGRAVSQLSYTSYPPLALKSLM
MOC2B_AJECN     --------------LTYNPLDPTKSLAQIRSPHAGANVLFLGTTRSTFDNRPVARLTYTSYAPLALRTLE
MOAD_ECOLI      AFFPPVTGG-------------------------------------------------------------
MOAE2_MYCTU     --------------LTDQPIFLEELVSHRSA---GAIVGFVGMIXXXXXXXXVLRLEYSAHPSAAQ-VLA
MOAD_HAEIN      AFFPPVTGG-------------------------------------------------------------
MOAE_RHOS4      ----------------------------------GAIVTFTGLVRDLSGALEA--MEIEHYPGMTXXXXX
Y717_METJA      --------------------------------KFGCIVTFNGFVREYDLGEKVPSKGMKIDEDILEKLKL
MOC2A_MAIZE     AVIPPISGG-------------------------------------------------------------
MOC2A_CHLRE     AIIPPLSGG-------------------------------------------------------------
MOC2A_ARATH     AIIPPISGG-------------------------------------------------------------
MOC2A_PYRTR     AIIPPVSSG-------------------------------------------------------------
MOC2A_DICDI     AIIPPVSGG-------------------------------------------------------------
MOC2A_HUMAN     AVIPPISGG-------------------------------------------------------------
MOC2A_MOUSE     AIIPPISGG-------------------------------------------------------------
MOC2A_ORYSJ     AIIPPISGG-------------------------------------------------------------
MOC2A_ORYSI     AIIPPISGG-------------------------------------------------------------
MOC2A_DROER     AIIPPLSGG-------------------------------------------------------------
MOC2A_DROME     AIIPPLSGG-------------------------------------------------------------
MOC2A_DROYA     AIIPPLSGG-------------------------------------------------------------
MOC2A_DROSE     AVIPPLSGG-------------------------------------------------------------
MOC2A_DROSI     AVIPPLSGG-------------------------------------------------------------
MOAE_HELPY      ---------------------LKAYQEEACAKNFGAFCVFVGIVRKEDNIQGLSFDIYEA----------
MOC2A_PHANO     AIIPPVSSG-------------------------------------------------------------
MOC2A_CAEEL     AVIPPLSGG-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGS
MOAE_BACHD      QIGQEIQERWPEARVAITHRIGRLEITDVAVVIAVSTPHRADSYEASRYAIERIKEIVPIWKKEHWEDGE
MOAE_PYRAB      RIRNEALDRFPIVDALIWHRIGELEVGENTILVVVSAKHRREAFEACAWIVDEVKKRVPVWKREVTDEGE
MOAE_ANASP      QIAADIRSAWPVNRVVIHHRIGRLQVGQISVLVAIGCPHRSEAFAACRYAIDTLKHNAPIWKKEHWQDGS
MOAE_BACSU      QIGAEIEEKWEGASAAITHRIGVLDIGEAAVVIAVSSPHRKAAYEANEYAIERIKQIVPIWKKEIWEDGE
MOAE_STACT      QIGDEINEQWPGTIVSIVHRIGPLKISDIAVLIAVSSPHRKDAYAANEYAIDRIKEVVPIWKKEIWEDGA
MOC2B_BOVIN     KICSDMRQKWPVRHIAVFHRLGLVPVTEASVIIAVSSAHRAASLEAVSYAIDALKARVPIWKKEYEESSS
MOC2B_ARATH     SICTTARSTWDIHKIAVAHRLGPVPVGETSVLIAVSSVHRADGLDACKFLIDELKASVPIWKKEVYTNGE
MOAE_SALTY      EIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGD
MOAE_SALTI      EIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGD
MOAE_ECOLI      EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGD
MOAE_STAAW      QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
MOAE_STAAS      QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
MOAE_STAAR      QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
MOAE_STAAC      QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
MOAE_PSEAE      KIAAEAGQRWPLLRLEILHRIGRLEPGEPIVFVGCASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGP
MOAE_STAAN      QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
MOAE_STAAM      QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
MO2B1_AEDAE     QICEELRARWPIKHIGIHHRLGTVPVKEASVVIAVSSPHRKSSLEAVHFAIDELKKSVPVWKKEQYADGS
MOC2B_DROWI     TICTDLRAKWPLKHIVIYHRLGSVPVGEASVVIATSAPHRLSALESVSLAVDQLKTRVPIWKKE------
MOC2B_MOUSE     KICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEYEESTS
MOAE_STAES      QIGKEIEEKWPGTITTIVHRIGPLQISDIAVLIAVSSPHRKAAYAANEYAIERIKEIVPIWKKEIWEDGA
MOAE_STAEQ      QIGKEIEEKWPGTITTIVHRIGPLQISDIAVLIAVSSPHRKAAYAANEYAIERIKEIVPIWKKEIWEDGA
MO2B2_AEDAE     QICEELRARWPIKHIGIHHRLGTVPVKEASVVIAVSSPHRKSSLEAVHFAIDELKKSVPVWKKEQYAEGS
MOC2B_RAT       KICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEYEESTS
MOAE_RALSO      NIVDAAMQRWDLIDALVIHRVGKLRPEDQIVLVAVASGHRGEAFAACEFIMDYLKSEAPFWKKEQTAQGA
MOAE1_MYCTU     SIIGRCEDKAEGVRVAVAHRTGELQIGDAAVVIGASAPHRAEAFDAARMCIELLKQEVPIWKKEFSSTGA
MOC2B_CULQU     HICEELRGRWTLVHIGIHHRLGTVPVKEASVVIAISSPHREAALEAVRWAIDELKKSVPVWKKEQYAEGS
MOAE_PASMU      EIVAQAKARWDIQRVCVIHRVGLLQTGDEIVFVGVSSAHRGEAYQANEFIMDFLKSKAPFWKKEKTTQGE
MOAE_HAEDU      EIVNQARQRWELQRIAVIHRIGQLHTGDEIVLVGVSSAHRGDAYLANEFIMDYLKTKAPFWKRETTAEGE
MOC2B_DROPS     KICSDLRATWPLKHILIYHRLGTVPENEASVVIAASAPHRSAALKAVTFAIDQLKSRVPIWKKE------
MOC2B_DROPE     KICSDLRATWPLKHILIYHRLGTVPENEASVVIAASAPHRSAALKAVTFAIDQLKSRVPIWKKE------
MOC2B_ANOGA     LLCEEVRARWPVVNIGIHHRLGTVPVKEASVVIAISSPHRKSSLEAVHFTIDELKKSVPVWKKE------
MOAE_HAEIN      EIVAQAKVRWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGE
MOAE_YERPE      EIIADARSRWSLQRVSVIHRVGPLFPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATVEGE
MOC2B_TAEGU     KICRDVRQKWPVKHIAVHHRLGVVPITEASVIIAVSSPHRAESLEAVMYCINTLKASVPIWKKEIYEDEY
MOAE_VIBCH      EICDMAQERWPLQRVRVIHRIGDMLSGDQIVLVGVSSAHRNAAFAACEFIMDYLKTRAPFWKKELTTEAS
MOC2B_DROYA     KICSDLRSKWPLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKE------
MOAE_AQUAE      KIRQETIEKFGVKEVFIHHRLGLVKIGEPSFLVLAVGGHREETFKACRYAVDETKKRVPIWKKEIFKEGG
MOC2B_DROER     KICLDLRSKWPLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKE------
MOAE_THEVO      DLIDEAKKKYNILDAAVCHRIGLVGLTEDSVVISVSSAHRSSAFEACRYIIDTIKERVPIWKRDILENGN
MOC2B_DROGR     KICSQLRARWPLKHIAIYHRLGTVPVKEASVVIATSAPHRAAALESVTFAVEQLKSRVPIWKKE------
MOC2B_DROAN     KICSDLRSKWPLKHIVIHHRLGTVPVREASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKE------
MOC2B_DROSI     KICSDLRSKWDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKE------
MOC2B_DROME     KICSDLRSKWDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKE------
MOC2B_DROSE     KICSDLRSKWDLKHIVIYHRLGTVPVCQASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKE------
MOAE_CAUCR      EIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGP
MOC2B_DICDI     KICKTILNGFEIKKIGIVHRIGNVPVGESSILIVISSGHRKSSLEAVHYAIDTIKSTVPIWKKEFYTDGS
MOC2B_ORYSJ     XXXXXXXXXHSLRRLAVAHRLGTVPAGEASVFVAASAVHRADAMEACRYVIDEVKASVPIWKKEVYDDGE
MOC2B_ORYSI     XXXXXXXXXHSLRRLAVAHRLGTVPAGEASVFVAASAVHRADAMEACRYVIDEVKASVPIWKKEVYDDGE
Y903_SYNY3      KIIAEAKEKYDLHQAIAVHRSGHLKIGETAVWVGTVASHRQAAFQGTQYVIDQIKLRLPIWKKEHYFD--
MOC2B_PONAB     KICSDIRQKWPVKHIAVFHRLG----------------HRAASLEAVSYAIDTLKAKVPIWKKEIYEESS
MOC2B_MAGGR     SICKAMKTKHGLKGIAMVHRLGVVPISEDSIVIAVSSPHRQAAWRAGEEALEECKAKVEVWKREEFEGG-
MOC2B_HUMAN     KICSDIRQKWPVKHIAVFHRLGLXXXXXXXXXXXXXXXXXXXXLEAVSYAIDTLKAKVPIWKKEIYEESS
MOAE_BRUSU      RMAKQALERWPLNGLTIIHRYGLIKPGENIVLVVAASRHRHAAFEAASFLMDYMKTNAPFWKREHLADGT
MOAE_BRUME      RMAKQALERWPLNGLTIIHRYGLIKPGENIVLVVAASRHRHAAFEAASFLMDYMKTNAPFWKREHLADGT
MOC2B_ASPNC     KIAEDAVAKHELLGVVIGHRLGDVPIGESSIVIAVSAGHRGAAWRAGEEVLELCKEKAEIWKKEVFVDG-
MOC2B_DROMO     KICSELRIRWPLKHIAIYHRLGXXXXXXXXXXXXXXXXHRPAALESVSFAVDKLKSSVPIWKKE------
MOC2B_ASPCL     DIATKAAEKFRLEGVYIAHRLGVVPIQESSIVVAVSAGHRGMAWRAGEEVLEEVKARLEVWKREEFVDGG
MOC2B_DROVI     KICTDLRVRWPLKHIVIYHRLGXXXXXXXXXXXXXXXXHRVAALESVNFAIDQLKSRVPIWKKEYEKD--
MOC2B_ASPOR     GIARDAVAKHGLTGIVIAHRLGVVPIREASIVIAVSSGHRRAAWRAGEEVLEICKEKAEIWKREEFVDGG
MOAE_RHILO      XXXXXXXXXWPLQGLTVIHRHGKIRPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHRTDGS
MOAE_SYNE7      EICQE--AEQVFGRIYVQHRLGETRVGDPTVLIGVGAIHRDEACEACRYVIEELKHRAPIWKLEHYEDGS
MOC2B_PYRTR     KIATSILAKHSCTKIAIIHKLGECPIGEESIVIAVSAPHRQAAWRAGEETLEETKDRAEIWKLERFKGG-
MOC2B_NEUCR     TICRSILTKHGLKGIAMVHRLGVVPIGEESILIAVSSPHRQAAWRAGEEALEECKAKVEVWKREEGEGGG
MOC2B_COCIM     SIARDAVAKHGLCGVSIAHRLGDVAVGEESIAIAISAPHRGAAWRAGEEVLEECKRRVEIWKRE------
MOAE_RHIME      RICHEAVERFGLQAATAIHRFGRMEPGANIVLVATASPHRQAAFDGANFIMDFLKTSAPFWKKEHHADGS
MOC2B_PHANO     KIASNILTKHACTKIAIIHKLGECPIGEESIVIAVSAPHRKXXXXXXXXXXXXTKDKAEIWKLERFEGG-
MOC2B_SCLS1     SICKTILHKHSLTSIAMIHRLGVVPIGEESILITVSSPHRQAAWRA------------------------
MOC2B_EMENI     KISSEAVEKFGLNGVYIAHRLGEVPVGEASIVVAVGAGHRGEAW--------------------------
MOC2B_NEOFI     SIATRAAEKFDLKGVYIAHRLGVVPISEASIVVAVSAGHRGMAWKA------------------------
MOC2B_ASPFU     SIATRAVEKFDLKGVYIAHRLGVVPISEASIVVAVSAGHRGMAWKA------------------------
MOC2B_ASPFC     SIATRAVEKFDLKGVYIAHRLGVVPISEASIVVAVSAGHRGMAWKA------------------------
MOC2B_AJECN     KIARGAVTKYQLCGISISHRLGXXXXXXXXXXXXXXXGHRRPAWRAGEEVLEECKAAVEIWKR-------
MOAD_ECOLI      ----------------------------------------------------------------------
MOAE2_MYCTU     DLVAEVAEESSGVRVAASHRIGVLQVGEXXXXXXXXXXXXXXXFGTCAHLVETIKARLPVWKHQFFEDGT
MOAD_HAEIN      ----------------------------------------------------------------------
MOAE_RHOS4      XXXXXXXQRWHLIDALVIHRHGRLGPSEPIMMVXXXXXXXXXXXXXXEFLMDYLKSRAPFWKKEVTAGGA
Y717_METJA      -VIEEAKNKFDVIDILFYHNTGFLSIGERIASIAVFARHRKEGFEALEYIINEMKK--------------
MOC2A_MAIZE     ----------------------------------------------------------------------
MOC2A_CHLRE     ----------------------------------------------------------------------
MOC2A_ARATH     ----------------------------------------------------------------------
MOC2A_PYRTR     ----------------------------------------------------------------------
MOC2A_DICDI     ----------------------------------------------------------------------
MOC2A_HUMAN     ----------------------------------------------------------------------
MOC2A_MOUSE     ----------------------------------------------------------------------
MOC2A_ORYSJ     ----------------------------------------------------------------------
MOC2A_ORYSI     ----------------------------------------------------------------------
MOC2A_DROER     ----------------------------------------------------------------------
MOC2A_DROME     ----------------------------------------------------------------------
MOC2A_DROYA     ----------------------------------------------------------------------
MOC2A_DROSE     ----------------------------------------------------------------------
MOC2A_DROSI     ----------------------------------------------------------------------
MOAE_HELPY      -LLKTWFEKWDLGVVLMAHSLGDVLIGQSSFLCVSMGKNRKNALELYENFIEDFKHNAPIWK--------
MOC2A_PHANO     ----------------------------------------------------------------------
MOC2A_CAEEL     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FWVEGFAPEDKRL
MOAE_BACHD      MWV----------
MOAE_PYRAB      FWIEG--------
MOAE_ANASP      TWV----------
MOAE_BACSU      QWI----------
MOAE_STACT      EWI----------
MOC2B_BOVIN     SW-----------
MOC2B_ARATH     IWKENSEFMEKRL
MOAE_SALTY      RWVE---------
MOAE_SALTI      RWVE---------
MOAE_ECOLI      RWVE---------
MOAE_STAAW      KW-----------
MOAE_STAAS      KW-----------
MOAE_STAAR      KW-----------
MOAE_STAAC      KW-----------
MOAE_PSEAE      RWVEG--------
MOAE_STAAN      KW-----------
MOAE_STAAM      KW-----------
MO2B1_AEDAE     EWKE---------
MOC2B_DROWI     -------------
MOC2B_MOUSE     SW-----------
MOAE_STAES      EW-----------
MOAE_STAEQ      EW-----------
MO2B2_AEDAE     EWKE---------
MOC2B_RAT       SW-----------
MOAE_RALSO      RWVDARVTDERAL
MOAE1_MYCTU     EWV----------
MOC2B_CULQU     EWKE---------
MOAE_PASMU      RWIE---------
MOAE_HAEDU      RWIESRESDEQQL
MOC2B_DROPS     -------------
MOC2B_DROPE     -------------
MOC2B_ANOGA     -------------
MOAE_HAEIN      RWIE---------
MOAE_YERPE      RWVE---------
MOC2B_TAEGU     SWKE---------
MOAE_VIBCH      RWID---------
MOC2B_DROYA     -------------
MOAE_AQUAE      EWVLG--------
MOC2B_DROER     -------------
MOAE_THEVO      -------------
MOC2B_DROGR     -------------
MOC2B_DROAN     -------------
MOC2B_DROSI     -------------
MOC2B_DROME     -------------
MOC2B_DROSE     -------------
MOAE_CAUCR      RWIE---------
MOC2B_DICDI     -------------
MOC2B_ORYSJ     VWKE---------
MOC2B_ORYSI     VWKE---------
Y903_SYNY3      -------------
MOC2B_PONAB     SW-----------
MOC2B_MAGGR     -------------
MOC2B_HUMAN     TW-----------
MOAE_BRUSU      -------------
MOAE_BRUME      -------------
MOC2B_ASPNC     -------------
MOC2B_DROMO     -------------
MOC2B_ASPCL     MWRE---------
MOC2B_DROVI     -------------
MOC2B_ASPOR     MWRE---------
MOAE_RHILO      GWVE---------
MOAE_SYNE7      GWVPG--------
MOC2B_PYRTR     -------------
MOC2B_NEUCR     VW-----------
MOC2B_COCIM     -------------
MOAE_RHIME      -------------
MOC2B_PHANO     -------------
MOC2B_SCLS1     -------------
MOC2B_EMENI     -------------
MOC2B_NEOFI     -------------
MOC2B_ASPFU     -------------
MOC2B_ASPFC     -------------
MOC2B_AJECN     -------------
MOAD_ECOLI      -------------
MOAE2_MYCTU     -------------
MOAD_HAEIN      -------------
MOAE_RHOS4      DWV----------
Y717_METJA      -------------
MOC2A_MAIZE     -------------
MOC2A_CHLRE     -------------
MOC2A_ARATH     -------------
MOC2A_PYRTR     -------------
MOC2A_DICDI     -------------
MOC2A_HUMAN     -------------
MOC2A_MOUSE     -------------
MOC2A_ORYSJ     -------------
MOC2A_ORYSI     -------------
MOC2A_DROER     -------------
MOC2A_DROME     -------------
MOC2A_DROYA     -------------
MOC2A_DROSE     -------------
MOC2A_DROSI     -------------
MOAE_HELPY      -------------
MOC2A_PHANO     -------------
MOC2A_CAEEL     -------------