[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a7lA.bssp"
#ERROR : Can't open dsspfile "1anfA.bssp"
#ERROR : Can't open dsspfile "3a3cA.bssp"
#ERROR : Can't open dsspfile "2b3bB.bssp"
#ERROR : Can't open dsspfile "2b3bA.bssp"
#ERROR : Can't open dsspfile "3d4gE.bssp"
#ERROR : Can't open dsspfile "3d4gA.bssp"
#ERROR : Can't open dsspfile "1a7lB.bssp"
#ERROR : Can't open dsspfile "3ehtA.bssp"
#ERROR : Can't open dsspfile "3d4gD.bssp"
#ERROR : Can't open dsspfile "3ef7A.bssp"
#ERROR : Can't open dsspfile "3d4cA.bssp"
#ERROR : Can't open dsspfile "1a7lC.bssp"
#ERROR : Can't open dsspfile "3c9hA.bssp"
#ERROR : Can't open dsspfile "1a99A.bssp"
#ERROR : Can't open dsspfile "3cg3A.bssp"
#ERROR : Can't open dsspfile "1d9yA.bssp"
#ERROR : Can't open dsspfile "3dm0A.bssp"
#ERROR : Can't open dsspfile "3c4mB.bssp"
#ERROR : Can't open dsspfile "3c4mA.bssp"
#ERROR : Can't open dsspfile "1d9vA.bssp"
#ERROR : Can't open dsspfile "3ehsA.bssp"
#ERROR : Can't open dsspfile "3ehuA.bssp"
#ERROR : Can't open dsspfile "3c9hB.bssp"
#ERROR : Can't open dsspfile "3cijA.bssp"
#ERROR : Can't open dsspfile "3csbA.bssp"
#ERROR : Can't open dsspfile "3cfxA.bssp"
#ERROR : Can't open dsspfile "3cvgC.bssp"
#ERROR : Can't open dsspfile "3cfzA.bssp"
#ERROR : Can't open dsspfile "2ajfE.bssp"
#ERROR : Can't open dsspfile "3cg1A.bssp"
#ERROR : Can't open dsspfile "3d0gE.bssp"
#ERROR : Can't open dsspfile "1amfA.bssp"
#ERROR : Can't open dsspfile "1dv2A.bssp"
#ERROR : Can't open dsspfile "3bg5A.bssp"

## Summary of PDB Search
:417
    3e-39  19%  1a7lA  [c.94.1] MALE-B363
    2e-38  18%  1anfA  [c.94.1 (1ez9A)] MALTODEXTRIN-BINDING PROTEIN
    2e-38  19%  3a3cA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER,
    7e-38  17%  2b3bB  [x.x.x] GLUCOSE-BINDING PROTEIN
    2e-37  17%  2b3bA  [x.x.x] GLUCOSE-BINDING PROTEIN
    2e-36  20%  3d4gE  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    2e-36  19%  3d4gA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    3e-36  17%  1a7lB  [c.94.1] MALE-B363
    6e-36  19%  3ehtA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    1e-35  21%  3d4gD  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    4e-35  20%  3ef7A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    2e-34  20%  3d4cA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    2e-34  23%  1a7lC  [c.94.1] MALE-B363
    3e-27  15%  3c9hA  [x.x.x] ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN
    4e-27  13%  1a99A  [c.94.1] PUTRESCINE-BINDING PROTEIN
    6e-27  11%  3cg3A  [x.x.x] UPF0100 PROTEIN PH0151
    3e-26  14%  1d9yA  [c.94.1] PROTEIN (PERIPLASMIC IRON-BINDING PROTEIN)
    6e-26  21%  3dm0A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH
    8e-23  20%  3c4mB  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    1e-22  17%  3c4mA  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    3e-22  16%  1d9vA  [c.94.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)
    3e-22  18%  3ehsA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    3e-21  21%  3ehuA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    1e-20  15%  3c9hB  [x.x.x] ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN
    2e-16  11%  3cijA  [x.x.x] UPF0100 PROTEIN AF_0094
    1e-14  21%  3csbA  [x.x.x] MALTOSE-BINDING PROTEIN MONOBODY YSX1 FUSION
    6e-14  14%  3cfxA  [x.x.x] UPF0100 PROTEIN MA_0280
    4e-09   8%  3cvgC  [x.x.x] PUTATIVE METAL BINDING PROTEIN
    6e-07  12%  3cfzA  [x.x.x] UPF0100 PROTEIN MJ1186
    2e-06  11%  2ajfE  [x.x.x] SARS-CORONAVIRUS SPIKE PROTEIN
    3e-05  12%  3cg1A  [x.x.x] UPF0100 PROTEIN PF0080
    6e-05  11%  3d0gE  [x.x.x] SPIKE PROTEIN S1
    3e-04  13%  1amfA  [x.x.x] MOLYBDATE TRANSPORT PROTEIN MODA
    7e-04  22%  1dv2A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    9e-04  15%  3bg5A  [x.x.x] PYRUVATE CARBOXYLASE
:417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPV
1a7lA           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
1anfA           -------------------------------EEGKLVIWIN--GDKGYNGLAEVGKKFEK-DTGIKVTVE
3a3cA           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
2b3bB           ------------------------------------EIFS-WWAGDEGPALEALIRLYKQKYPGVEVINA
2b3bA           ------------------------------------EIFS-WWAGDEGPALEALIRLYKQKYPGVEVITV
3d4gE           -------------------------------EEGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
3d4gA           -------------------------------EEGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
1a7lB           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
3ehtA           -------------------------------EEGKLVIWIN--GDKGYNGLAEVGKKFEK-DTGIKVTVE
3d4gD           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
3ef7A           -----------------------------KTEEGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
3d4cA           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
1a7lC           ----------------------------------------------------------------------
3c9hA           -----------------------------------------VYSSLDEPLATPMIEGFQKANPDIAVHYE
1a99A           --------------------------------------------NWSDYIAPDTVANFEK-ETGIKVVYD
3cg3A           -------------------------------REARLIIFHAGSLSIPLSQVEEKFTKYAQEKLGVKVTFQ
1d9yA           -----------------------------------------VYNGQHKEAAQAVADAFTRATGIKVK--L
3dm0A           -------------------------------------IWIN--GDKGYNGLAEVGKKFEK-DTGIKVTVE
3c4mB           --------------------------------EGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
3c4mA           -----------------------------KIEEGKLVIWI--NGDKGYNGLAEVGKKFEK-DTGIKVTVE
1d9vA           -----------------------------------------VYNGQHKEAATAVAKAFEQ-ETGIKVTLN
3ehsA           -------------------------------EEGKLVIWIN--GDKGYNGLAEVGKKFEK-DTGIKVTVE
3ehuA           -------------------------------EEGKLVIWIN--GDKGYNGLAEVGKKFEK-DTGIKVTVE
3c9hB           -----------------------------------------VYSSLDEPLATPMIEGFQKANPDIAVHYE
3cijA           -----------------------------------------FHAGSLTEPMKAFKRAFEEKHPNVEVQTE
3csbA           -------------------------------------IWIN--GDKGYNGLAEVGKKFEK-DTGIKVTVE
3cfxA           ---------------------------------------TVFHAGSLSVPFEELEAEFEAQHPGVDVQRE
3cvgC           ----------------------------------------------------------------------
3cfzA           -----------------------------------------FHAGSLSVPFEEYEKMFEKEHPNVDVERE
2ajfE           ---------------------------------------------------GDDVRQIAPGQTGVIADYN
3cg1A           ----------------------------------------------------------------------
3d0gE           ---------------------------------------------------GDDVRQIAPGQTGVIADYN
1amfA           ----------------------------------------------------------------------
1dv2A           ----------------------------------------------------------------------
3bg5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
1a7lA           H---PDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
1anfA           H---PDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3a3cA           H---PDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
2b3bB           TVTGGVNARAVLKTRMLGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLGLIDLISYKGGIWS
2b3bA           TGGAGVNARAVLKTRMLGGDPPDTFQVHAGMIGTWVVANRMEDLSALFRQEGWFPKGLIDLISYKGGIWS
3d4gE           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3d4gA           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
1a7lB           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3ehtA           H---PDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPETWDAVRYNGKLIA
3d4gD           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3ef7A           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3d4cA           H---PDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
1a7lC           ---------EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3c9hA           D-MLTGEIYDRIVKETDAGKKTAFAFSSAMDLQVKLSNDGYAQRSD-------LAMSARWPAWANWRNTA
1a99A           VFDSN---EVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSEWKNLDPELLKLVAKHDPDNKFA
3cg3A           DEASG-SVKAVRKVTDLKKRADIVAVADYTLIPQLMIPNYTDFYVLFEIVIAFTNKSKYADEMLKNPDKW
1d9yA           NCAKGDQLAGQIKEEGSRSPADVFYSEQIPALATLSAANLLEPLPA-----STINETRGKGVPVAAKKDW
3dm0A           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIA
3c4mB           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3c4mA           HPDKLE---EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
1d9vA           SGK-SEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISE-----QTIQQTAQKGVPLAPKKDW
3ehsA           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3ehuA           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3c9hB           DMLTG-EIYDRIVKETDAGKKTADFAFSSAMDLQVKLSNDGY------AQRSDLAMSARWPAWANWRNTA
3cijA           AAGSAATIRKVTELG---RKADVIATADYTLIQKMMYPEFANWTIMFQIVLAYRNDSRYADEINSQNWYE
3csbA           HPDKL---EEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA
3cfxA           AAGSAQSVRKITELGKKADVL---ASADYALIPSLMVPEYADWYAA-------FARNQMILAYTNESKYG
3cvgC           ----------------------------------------------------------------GISESP
3cfzA           PAGS----VACVRKIIDLGKKADILASADYSLIPQMMMPKYADWDKSKYKDEINSTNWYKILQRPDVKIG
2ajfE           YKLPDDFMGCVLAWN---TRNIDATSTGNYNKYRYLRHGKLRPFERDISNVPFSCTPPALNCYWPLNDYG
3cg1A           ----------------------------------------------------------------------
3d0gE           YKLPDDFMGCVLAWN---TRNIDATSTGNYNYYRYLRHGKLRPFERDISNVPFSCTPPALNCYWPLNDYG
1amfA           ----------------------------------------------------------ARQIEAGAPADL
1dv2A           -----------------------------------------------GYGFLSENANFAEQVERSGFIFI
3bg5A           -----------------------------------------------------ENEQFARRCAEEGIKFI


                         +         .         .         .         .         *         .:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
1a7lA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGGKYDI
1anfA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIFKYENGKYDI
3a3cA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKY
2b3bB           VPVNIHRSNVMWYPAKLKGWGVNPPRTWDKFLATCQTLKQKGLEAPLALGENWTQQHLWESVADWNNLWN
2b3bA           VPVNIRSNVMWYLPAKLKGWGVNPPRTWDKFLATCQTLKQKGLEAPLALGENWTQQHLWESVADWNNLWN
3d4gE           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYKYDI
3d4gA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYKYDI
1a7lB           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYTWPLIAADGGYAFYDI
3ehtA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIFKYENGKYDI
3d4gD           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGGKYDI
3ef7A           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGGKYDI
3d4cA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIFKYENGKYDI
1a7lC           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYAEN
3c9hA           YALTFEPAVFVYHKPSFTTEKPP--ATRAEFVDYLERHAKEVHGRIATYD-------------IERGVGF
1a99A           MPYMWATTGIGYNVDKVKAVLGEPVDSWDLILKPENLEKLKSCGVSFLD-----APEEVFATVLNYLGKD
3cg3A           YEILSRPDVSFGFSDPNQDP--CGYRSVMVMKLAELYYGRPIFKELVEKTTNI-YSNGTRIYAPKEIIIK
1d9yA           VALSGRSRVVVYDTRKLSEKDLE--KSVLNYATPKWKNRIGYVPTSGAFLEQIVAIV-------------
3dm0A           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKY
3c4mB           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIFKYENGKYDI
3c4mA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIFKYENGKYDI
1d9vA           IALSGRSRVVVYDHTKLSEK--DMEKSVLDYATPKWKGKIGYV-------STSGAFLEQVVAL-------
3ehsA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGGKYDI
3ehuA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGG-----
3c9hB           YALTFEPAVFVYHKPSFTTEKPP--ATRAEFVDYLERHAKEVHGRIATYDIERSGVGFLFMSRDQEQFGD
3cijA           ILKRPDVRFGFSNPNDDPCG----YRSLMAIQLAELYYNDPTIFDENLRFSEDNGSYVLRMPSSERIEIN
3csbA           YPIAVEALSLIYNKDLLPNP----PKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA---------
3cfxA           DEINTDNWYEILRRPDVRYGFSNPNAGYRSQMVTQLAESYYNDDMIYDDLMLANTGMTLTTEENGTALIH
3cvgC           SYYAFRDHFLIGPPSNPAK-----LSGDSDIADFSKH------DAAEAGNTKPPVRFLSRYDKSATNIKE
3cfzA           FSNPNDDPCGYRTQMVLQLAELYYPTIYDNLVLKHSNIKVEENNGTYL---------ILVPKELDVDTNK
2ajfE           FY---TTTGIGYQPYRVVVLSF------------------------------------------------
3cg1A           VLFATNEIVIAFTDKSRYVEEMKSNPAREDVRFGFSDPNQDPCGYRSLMVIKLADLYYGKEIFKELIEEN
3d0gE           FYT---TTGIGYQPYRVVVLSF------------------------------------------------
1amfA           FISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPA
1dv2A           GPKAETIRLMVSAIAAMKKAGVPCVDDMDKNRAIAKRI----GYPV-IIKAS-----------GGGGGRG
3bg5A           GPHLEHLDMFVKARTTAIKADLPVIPGTDGPIELAKEFAEEAGFPL-MIKAT-----------SRIVREE


                         .         .         .         +         .         .         .:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
1a7lA           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTI-NGPWAWSNIDTSKVNYGVTVLP
1anfA           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLP
3a3cA           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
2b3bB           GKLKFTDPKAVRAWEVFGRVLDCANKDAAGLSWAVDRVVQGKAAFNIMGDWAAGYMTTTLKLKPGTDFAW
2b3bA           GKLKFTDPKAVRAWEVFGRVLDCANKDAAGLSWAVDRVVQGKAAFNIMGDWAAGYMTTTLKLKPGTDFAW
3d4gE           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTI-NGPWAWSNIDTSKVNYGVTVLP
3d4gA           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
1a7lB           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLP
3ehtA           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
3d4gD           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYIAEAAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
3ef7A           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTI-NGPWAWSNIDTSKVNYGVTVLP
3d4cA           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
1a7lC           GKYDVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAANKGETAMTINGPWAWS-NIDTSKVNYGVTVLP
3c9hA           LFMSRDQEQFGDIWSVIKAMGAAGVKVYSTSSAILERVSDGRFVLGY-NILGSYAADWASRHPDVGIVLP
1a99A           PNSTKADDYTGPATDLLLKLRPNIRYF--HSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVS
3cg3A           DKRVIMRPKETDLVGLVESGSLDYI-----FIYKSVAKQHHLSYITLPDDINLGDFNKADFYGRVSITLG
1d9yA           -----KLKGEAAALKWLKGLKEYGKPYA-KNSVALQAVENGEIDAALINNYYWHAFAREKGVQNVHTRLN
3dm0A           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAA--------------------------------
3c4mB           KDVGVDNAGAKAGLTFLVDLIKNK----------------------------------------------
3c4mA           KDVGVDNAGAKAGLTFLVDLIKNKHMNATDYSIAEAAFNKGETAMTINGP-WAWSNIDTSKVNYGVTVLP
1d9vA           ----SKMKGDKVALNWLKGLKENGKLYA-KNSVALQAVENGEVPAALINN-YYWYNLAKEKGVENLKSRL
3ehsA           KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLP
3ehuA           ----------------------------------------------------------------------
3c9hB           IWS------------VIKAMGAAGVKVYSTSSAILERVSDGRFVLG-YNILGSYAADWASRHPDVGIVLP
3cijA           KSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGF-----NFVELPVEIDLSSPDYAELYSKVKVVLA
3csbA           ----------------------------------------------------------------------
3cfxA           VPASESKIMLRSMEVELSSALETGEI-DYLYIYRSVAEQHGFEYVALPPAIDLSSLEYADNYSKVQVEMV
3cvgC           AELWL--SIGQVPWATAYSTWYHQYI---TFPIQALTAAILLREYTITDYGTYLSIPRGLRDQVIYKKGT
3cfzA           LFVRSKETDLLAPLEAGAFDYLFIYKSVANQHHLKYIELPKEINLG--------YYEYADTYKKVALKII
2ajfE           ----------------------------------------------------------------------
3cg1A           TNIYSNGTQIYAPKEITVNPGKIVIRPDYIFIYKSVAKQHNLSYITLPSEINLGDFSKEKFYGQISITLG
3d0gE           ----------------------------------------------------------------------
1amfA           GIYAKEALQKLGAWDTLSPKLAPAE----DVRGALALVERNEAPLGI----VYGSDAVASKGVKVVATFP
1dv2A           MRVVRGDAELAQSISMTRAEAKAAFSND------------------------------------------
3bg5A           SELEDAFHRAKSEA--------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYA
1a7lA           T-FKGQPSKPFVGVLSAGINAAS--PNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEE----EL
1anfA           T-FKGQPSKPFVGVLSAGINAA-SPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALK-----SYEEEL
3a3cA           -TFKGQPSKPFVGVLSAGINAAS--PNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEE----EL
2b3bB           APSPGTQGVFMMLSDSFGLPKGA--KNRQNAINWLRLVGSKEGQDTSNPLKGSIAARLDSDPSKYNAYGQ
2b3bA           APSPGTQGVFMMLSDSFGLPKGA--KNRQNAINWLRLVGSKEGQDTSNPLKGSIAARLDSDPSKYNAYGQ
3d4gE           T-FKGQPSKPFVGVLSAGINAASPNKEL--AKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEE----EL
3d4gA           T-FKGQPSKPFVGVLSAGINAASPNKEL--AKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAK--
1a7lB           TFKGQPSK-PFVGVLSAGINAASPNKELA-KEFLENYLLTDEGLEAVNKDKPLGAVALKS-----YEEEL
3ehtA           T-FKGQPSKPFVGVLSAGINAAS--PNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDP
3d4gD           T-FKGQPSKPFVGVLSAGINAASPNKEL--AKEFLENYLLTDEGLEAVNKDKPLG----AVALKSYEEEL
3ef7A           T-FKGQPSKPFVGVLSAGINAASPNKEL--AKEFLENYLLTDEGLEAVNKDKPLGAV----ALKSYEEEL
3d4cA           T-FKGQPSKPFVGVLSAGINAASPNKEL--AKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEE----EL
1a7lC           T-FKGQPSKPFVGVLSAGINAASPNKEL--AKEFLEYLLTDEGLEAVNKDKPLGAVA-----LKSYEEEL
3c9hA           ------KDYTVVMSRIGLVPEAAANPELG--RRYLEFFMSKEGQTIMARQLQIPAVSPEVAGENTANTMQ
1a99A           --FSIPKEGAMAFFDVFAMPADA--KNKDEAYQFLNYLLRPDVVAHISDHVFYANANKAATPLV--SAEV
3cg3A           --STGKTIKAKPIVYGITVLKNAPNRELA--IEFLRFLLGNEGRKIFEDNYQEFLSPPVAFGN--VPPEI
1d9yA           FVRHRDPGA-LVTYSGAAVLKSS--QNKDEAKKFVAFLAGKEGQRALTAVRAEYPLNPHVVSTFNLEPIA
3dm0A           ----------------------------------------------------------------------
3c4mB           ----------------------------------------------------------------------
3c4mA           TFKGQPSKPFVGVL---SAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDP
1d9vA           YFVRHQDPGALVSYSGAAVLKASKNQAEA--QKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYE
3ehsA           TFKGQPSKPFVGVLSAGINAASPNKELA------------------------------------------
3ehuA           ----------------------------------------------------------------------
3c9hB           ------KDYTVVMSRIGLVPEAA--ANPELGRRYLEFFMSKEGQTIMARQLQIPAVSPEVAGENTANTMQ
3cijA           N---GKEVTGKPIVYGITIPKNA--ENRELAVEFVKLVISEEGQEILR-ELGQEPL--------------
3csbA           ----------------------------------------------------------------------
3cfxA           ---NGEVVTGSPIVYGVTIPNNA--ENSELATEFVALLLGETGQQIFI-ENGQPPI--------------
3cvgC           -----NDADDPLLNPAHLLVGAR--AKNAEAKEFAKWLVSKEGGQKVIEGFKKDGQQLYS----------
3cfzA           AKNKTINAKPIVYGMTVP----TNAPHKKEAIEFVKFVLGHPEV---LENNGQPAI--------------
2ajfE           ----------------------------------------------------------------------
3cg1A           STGKTIKAKPIVYGVTVL----KDAPNREVAIEFLRYLLSENGKRIFEKN-HQDFL--------------
3d0gE           ----------------------------------------------------------------------
1amfA           EDSHKKVEY-------PVAVVEGHNNATV--KAFYDYLKGPQAAEIFKRY-GFT----------------
1dv2A           ----------------------------------------------------------------------
3bg5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSRxx
1a7lA           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDEALKDGSQDPRVRG-----
1anfA           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDEALKDAQTRIT--------
3a3cA           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDEALKDAQTNSSSVP-----
2b3bB           SAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVM-----EIFLQTRNPQAAANAAQAIADQVGLGR--
2b3bA           SAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVM-----EIFLQTRNPQAAANAAQAIADQV------
3d4gE           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDAALAAAQ------------
3d4gA           --DPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDAALAAAQ------------
1a7lB           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDEALKDGSQDPR--------
3ehtA           RIAATMENAQKG-------------------------------------------------------
3d4gD           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDAALAAAQ------------
3ef7A           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDAALAAAQ------------
3d4cA           AKDPRIAATMENAQKGEIMPNIPQMSAFW-YAVRTAVINAASGRQTVDAALAAAQ------------
1a7lC           AKDPRIAATMENAQKGEIMPNIPQMSAF-WYAVRTAVINAASGRQTVDEALKDG-------------
3c9hA           AIHGAQLRPVPVSPGLMVYLDQVKRSRLI-ERWNEALR-----------------------------
1a99A           RENPGIYPPADVRAKLFTLKVQDPKIDRVRTRAWTKVK-----------------------------
3cg3A           RRLVEV-------------------------------------------------------------
1d9yA           KLEAPQVSATTVSEKEHATRLLEQGMK----------------------------------------
3dm0A           -------------------------------------------------------------------
3c4mB           -------------------------------------------------------------------
3c4mA           RIAATMENAQKGEIMPNIPQMSAFWYAVRT-------------------------------------
1d9vA           KLEAPVVSATTAQDKEHAIKLIEE-------------------------------------------
3ehsA           -------------------------------------------------------------------
3ehuA           -------------------------------------------------------------------
3c9hB           AIHGAQLRPVPVSPGLMVYLD-QVKRSRLIERWNEALR-----------------------------
3cijA           -------------------------------------------------------------------
3csbA           -------------------------------------------------------------------
3cfxA           -------------------------------------------------------------------
3cvgC           -------------------------------------------------------------------
3cfzA           -------------------------------------------------------------------
2ajfE           -------------------------------------------------------------------
3cg1A           -------------------------------------------------------------------
3d0gE           -------------------------------------------------------------------
1amfA           -------------------------------------------------------------------
1dv2A           -------------------------------------------------------------------
3bg5A           -------------------------------------------------------------------