[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80360.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aorA.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "3d5fB.bssp"

## Summary of PDB Search
:620
    2e-50  23%  1aorA  [d.152.1 - a.110.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE
    7e-24  29%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    6e-05  12%  3d5fB  [x.x.x] PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR DELTA
:620

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxGYHDRVAFVDLSTGKVWYESFGEAFWXXXXXXXXXXXXXXXXHVPKGADPLGPENALVFAPGILTGT
1aorA           ---GNWGRFIRVNLSTGDIKVEEYDEELAKKWLGSRGLAIYLLLKEMDPTVDPLSPENKLIIAAGPLTGT
1b25A           ---GWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEAR-GVEPLSPENKLIFAAGPFNGL
3d5fB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PISGSGRNTVAAKSPLTXXXXXXXXXXXXXXXLKNAGLDALVVLGQAEAPVYLHVEGGKVALHPAVHLWG
1aorA           SAPTGGRYNVVTKSPLTGFITMANSGGYFGAELKFAGYDAIVVEGKAEKPVYIYIKDEHIEIRDASHIWG
1b25A           PTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPVYIYIEDDNVSILSAEGLWG
3d5fB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARAHKETL
1aorA           KKVSETATIRKEVGSEKVKIASIGPAGENLVKFAAIMNDGHRAAGRGGVGAVMGSKNLKAIAVEGSKT--
1b25A           KTTFETERELKEIHGKNVGVLTIGPAGENLVKYAVVISQEGRAAGRPGMGAVMGSKKLKAVVIRGTKEIP
3d5fB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PAYHDPGLLKELARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALG
1aorA           VPIADKQKFMLVVREKVRNDPVAGGGLPKYGTAVLVNIINENGLYPVKNFQTGVYPYAYEQSGEAMAAKY
1b25A           VADKEELKKLSQEAYNEILNSPGYPFWKRQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTMEGMK
3d5fB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRIGRDTCYACAIRCKQVVKIEGTGKYDVRXXXXXXXXXXXXXXXSTCGVTDPYAVTKANTLCNQYGLDV
1aorA           LVRNKPCYACPIGCGRVNRLPTVGETEGPEYESVWALGANLGINDLASIIEANHMCDELGLDTISTGGTL
1b25A           VQQRGCPYCNMPCGNVVLDAEGQESELDYENVALLG---------SNLGIGKLNEVSVLNRIADEMGMDT
3d5fB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIXXXXXXXXXXXXXXXXXXKRLAESLGHPELAM
1aorA           ATAMELYEKGHIKDEELGDAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGSYRLAESYGHPELSMTVKK
1b25A           ISLGVSIAHVMEAVERGILKEG---PTFGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGTHDFAM
3d5fB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPLPIEDLSEAKI
1aorA           LELPAYDPRGAEGH----GLGYATNNRGGCHIKNYMISPEILGYPYKMDPHD-------VSDDKIKMLIL
1b25A           HVKGLEVSGYNCYIYPAMALAYGTSAIGAHH------------KEAWVIAWEIGTAPIEYKISYDPIKAQ
3d5fB           -------------------------------PFVIHDIETLWQAEKGLVWLPPYKEISVHVFYRCQCTTV


                         *         .         .         .         .         +         .:560
query           RMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEE
1aorA           FQDLTALIDSAGLCLFTTF---GLGADDYRDLLNAALGWDFTTEDYLKIGERIWNAERLFNLKAGLDPAR
1b25A           KVVELQRLRGGLFEMLTACRLVGLSLDYYPKLLKAITGVTYTWDDLYKAADRVYSLIRAYWVREFNGKWD
3d5fB           ETVFAKSIP--SFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDI


                         .         .         .         *         .         .         .:630
query           DRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEGGVDPERLRALGLEEFxxxxx
1aorA           DDTLPKRFLEEPMPEGPNKGHTVRLKEMLPRYYKLRGWDGKIPKEKLEELGIAEF-----
1b25A           RKMDYPPKRWFTEGLKSGPHDEKKYDELLSEYYRIRGWRGIPKKETLKELDLDFV-----
3d5fB           IEPKFEFAVKFNA----LELDDSDL-----------------------------------