[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80391.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3bmaD.bssp"
#ERROR : Can't open dsspfile "3bwnC.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "2drrA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "3b5oA.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1akaA.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "3bwoA.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "3aatA.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "2d64A.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "3bwnE.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "1czcA.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1bqdA.bssp"
#ERROR : Can't open dsspfile "1aheA.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "3bwoE.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "3bwoD.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "3bwoB.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "3bwoF.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "3caeA.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "2c0rA.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "2bieA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "2d3jA.bssp"
#ERROR : Can't open dsspfile "1ejjA.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "1bjoA.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3dpnA.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "3banA.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "2cinA.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "3a2bA.bssp"
#ERROR : Can't open dsspfile "3d46A.bssp"
#ERROR : Can't open dsspfile "3cxmA.bssp"
#ERROR : Can't open dsspfile "3bzsA.bssp"

## Summary of PDB Search
:397
    4e-57  95%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    5e-56  95%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    5e-55  95%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    8e-55  95%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    5e-42  15%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-40  15%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-38  15%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    8e-38  25%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-37  16%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-35  16%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-35  15%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-35  17%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-35  25%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    3e-35  17%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    4e-35  21%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    9e-35  15%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-34  22%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-34  10%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    3e-34  10%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    4e-34  16%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    7e-34  22%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    8e-34  25%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    2e-33  16%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    2e-33  23%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    4e-33  16%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    7e-33  17%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-32   9%  3bmaD  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    2e-32  12%  3bwnC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-32  15%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    2e-31  22%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    3e-31  16%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-30  14%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    2e-30  10%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    3e-30  15%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-30  23%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-30  15%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    9e-30  18%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-29  15%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-29  15%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-29  15%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    3e-29  11%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    4e-29  15%  1d2fB  [c.67.1] MALY PROTEIN
    5e-29  14%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-28  16%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-28  19%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    2e-28  23%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-28  13%  1c7nA  [c.67.1] CYSTALYSIN
    1e-27  18%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-27  10%  2drrA  [x.x.x] XYLANASE Y
    2e-27   9%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    3e-27  14%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-27  13%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-27  14%  3b5oA  [x.x.x] CADD-LIKE PROTEIN OF UNKNOWN FUNCTION
    4e-27  11%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    4e-27  16%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    5e-27  23%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    6e-27  11%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-27  10%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    7e-27  15%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    7e-27  14%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    9e-27  22%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-26  22%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-26  11%  1c8nA  [b.121.4] COAT PROTEIN
    2e-26  16%  1akaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-26  12%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-26  13%  3bwoA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-26  16%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-26  13%  1d2fA  [c.67.1] MALY PROTEIN
    6e-26  16%  3aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    6e-26  18%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    6e-26  15%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-25  18%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    1e-25  16%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    1e-25  14%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-25  13%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    2e-25  13%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-25  11%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    2e-25  16%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    3e-25  17%  2d64A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-25  11%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    4e-25  12%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    4e-25  14%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    8e-25  15%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-25  18%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-25  12%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-25  13%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    1e-24  13%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    1e-24  14%  3bwnE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-24  17%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-24   9%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-24  14%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-24  14%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    2e-24  12%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    3e-24  19%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-24  12%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    5e-24  12%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-24  19%  1czcA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    5e-24  18%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-24  17%  1bqdA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-24  19%  1aheA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-24  18%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-23  13%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-23   9%  1ax4A  [c.67.1] TRYPTOPHANASE
    3e-23  18%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-23  18%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    3e-23  14%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    3e-23  12%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-23  12%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-23  15%  3bwoE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-23  13%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-22   9%  1eg5A  [c.67.1] AMINOTRANSFERASE
    1e-22  13%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-22  12%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-22  10%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    2e-22  15%  3bwoD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-22  12%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-22  13%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    3e-22  15%  3bwoB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    3e-22  12%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-22  14%  3bwoF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    7e-22  13%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-22  17%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    9e-22  11%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    2e-21  10%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-21   7%  3caeA  [x.x.x] ENDODEOXYRIBONUCLEASE 1
    4e-21  11%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    6e-21  11%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    6e-21  11%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    1e-20  11%  2c0rA  [c.67.1 (1bt4A)] PHOSPHOSERINE AMINOTRANSFERASE
    1e-20   9%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    3e-20  11%  1ecxB  [c.67.1] AMINOTRANSFERASE
    4e-20  13%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    5e-20   8%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    5e-20  10%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    6e-20   8%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-19  10%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-19  11%  2c44A  [x.x.x] TRYPTOPHANASE
    7e-19  11%  2c44B  [x.x.x] TRYPTOPHANASE
    1e-18  14%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-18  10%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    2e-18  13%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    3e-18   9%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-18  11%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    6e-18  16%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    8e-18  10%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    1e-17  11%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    1e-17  11%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    2e-17  10%  2c44C  [x.x.x] TRYPTOPHANASE
    2e-17  10%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    6e-17   9%  2bieA  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-16  12%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    3e-16  12%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    3e-16  10%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-16  12%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    3e-16  11%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    4e-16  14%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    5e-16  10%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    5e-16  11%  2d3jA  [x.x.x] WNT INHIBITORY FACTOR-1
    6e-16   9%  1ejjA  [c.76.1 - c.105.1] PHOSPHOGLYCERATE MUTASE
    9e-16  10%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-15  10%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    1e-15  10%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    2e-15   9%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    2e-15  18%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-15  11%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    3e-15  10%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    4e-15  16%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    4e-15  12%  3e9kA  [x.x.x] KYNURENINASE
    5e-15  11%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    1e-14  10%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    1e-14  10%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    4e-14  10%  1bjoA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    4e-14  12%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-13  11%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    2e-13   9%  3dpnA  [x.x.x] PROTEIN CT_858
    2e-13  10%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    4e-13  11%  2btwA  [x.x.x] ALR0975 PROTEIN
    5e-13  15%  3banA  [x.x.x] D-MANNONATE DEHYDRATASE
    6e-13  16%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-12  14%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    2e-12  11%  2btwB  [x.x.x] ALR0975 PROTEIN
    3e-12   9%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-12  16%  2cinA  [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE
    5e-12  10%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    5e-12  11%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    6e-12  15%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    8e-12  10%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-11   8%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    2e-11  10%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    1e-10  11%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    3e-10  15%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    4e-10  17%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    6e-10  15%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    8e-10  14%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-09  14%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    2e-09  18%  1ei7A  [a.24.5] COAT PROTEIN
    2e-09   8%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    2e-09  11%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    4e-08  13%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    2e-07  13%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    2e-07  19%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    3e-07  17%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    2e-05  22%  3a2bA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    2e-05  14%  3d46A  [x.x.x] PUTATIVE GALACTONATE DEHYDRATASE
    4e-05   9%  3cxmA  [x.x.x] URACIL-DNA GLYCOSYLASE
    3e-04  11%  3bzsA  [x.x.x] ESCU
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
2egyD           ----SWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQY
2egyB           -KPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQY
2egyC           -KPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQY
3cbfA           ----SWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQY
3d6kC           ---------------QVREEVTAKYAELKAKNLSLDLTRGKPSAEQLDNDLLSLPGGDFRTKDGVDCRNY
3d6kB           ---------------QVREEVTAKYAELKAKNLSLDLTRGKPSAEQLDNDLLSLPGGDFRTKDGVDCRNY
3d6kD           --------------AQVREEVTAKYAELKAKNLSLDLTRGKPSAEQLDNDLLSLPGGDFRTKDGVDCRNY
3dc1A           ---------------RFITAASAARNPSPGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEELQY
3d6kA           ---------------------TAKYAELKAKNLSLDLTRGKPSAEQLDNDLLSLPGGDFRTKDGVDCRNY
3ei6A           ---------------------RRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
3ei8A           ---------------------RRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
3ei6B           --------------------ARRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
3dc1B           ---MNYARFITA------ASAARNPSPIRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQMKRALQY
3dydA           ---------------------VRPSDKVKPNPNMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGY
2douB           -------------------SVFLVVDEAKRKVGLIDLSIGST---DLPPPEAPLKALAEALNDPTT-YGY
3ei9A           ---------------------RRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
5bj4A           ----------------------RRVQAMKPGVDLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
1cl1B           ---------------KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFD-SVEAKKHATRNRANGELFYGR
1cl1A           ---------------KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFD-SVEAKKHATRNRANGELFYGR
3ei7B           --------------------ARRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
2douA           ----------------PEPSVFLVVDEAKRKVGLIDLSIGLPPPEAPLKALAEALNDPTT-------YGY
3dc1D           ---------------TAASAARNPSPIRRGPKSMISLAGGLPNPNMFPITVENGKTIQFGEEMMKRALQY
1bw0B           ---------------GLVFNPIRTVSDNSPKP-IIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGY
1djuA           ---------------------LSDRLELVSAKDVISLGIGEPDFDTPQHIKE-----YAKEALDKGLTHY
3ei7A           ---------------------RRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
3dydB           -------------------SVRPSDVKPNPNKTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGY
3bmaD           ---------------------------------HNLGAEKRSAVATTIDSFKERSQKVRALSDP--NVRF
3bwnC           ---------------------------IPMSDFVVNLDHGDPTAYEEYGDRCTVTIRGCDLMSYFSDMTN
3e2yA           ---------------GLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELS--KAAFIDN--MNQY
5bj3A           ---------------------MRGLSRRVAMKPLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
3ei9B           ---------------------RRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
3e2fA           ---------------GLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELS--KAAFIDN--MNQY
2e7jA           ---------------------------------------------------------------------L
3eiaA           ---------------------RRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
1bjwA           ---------------------VNAKALELRRQGLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
1b8gB           ---------------GWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLKNPEAAAFKKNGESIFAELALF
1aamA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLENETTKNY
3cogB           --------------------------------GQDPEQWTSRAVVPPISLST-----TFKQGAPGQHSGF
1b8gA           -----------RNATSSYFLGWQEYEKNHNTNGIIQMGLAENLESWLAKNPEAAAFKKNGESIFAELALF
1bw0A           ---------------GLVFNPIRTVSDNSPKP-IIKLSVGDPTLDKNLSAAQIKKLKEAIDSQE--CNGY
3bwoC           ---------------------------IPMSDFVVNLDHGDPTAYEEYGDRCTVTIRGCDLMSYFSDMTN
1d2fB           -----------------------------SKVVLLPFTISDMDFATAPCII------EALNQRLMHGVFG
1ajsA           ---------------------LIADFREDPDPRKVNLGVGAYRTDDPWVLPVVRKVEQRIANNSSLNHEY
3eiaB           --------------------ARRRSAHLLKYPDVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGY
3b46B           ---------------------------------LINLGQGFFSYSPPQFAIKEAQ--KALDIPMVN--QY
1b5pA           MRGLS------RRVQAMKPSATVAVNAKALEVDLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
1c7nA           ---------------SRKNLGSLKWDLMYSQNEVVPLSVADMEFKNPPELIEGL-------KKYLDETVL
1aiaA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETKNY
2drrA           -------------------------------------------------------------------KNS
1c4kA           ----------------------------PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLL
3cq5A           ----------------LSDLPLREELRGEHANVDIRLNTN--ENPYPPSEALVADLVATVDKIATEL-NR
2cstA           ---------------------LTADFREDGDSRKVNLGVGAYRTDEPWVLPVVRKVEQLIAGDGSLNHEY
3b5oA           ---------------------------------------------------------QLLAQDYV-AFSI
3dzzB           ------------------------------------------------------------------VAAF
1ay4A           -----------GNLKPQAPDKILALFRADPRQGKIDLGVGVYTGHTPIMRAVHAAEQRMLETET--TKTY
1djuB           ---------------------LSDRLE--LVSDVISLGIGEPDFDTPQHIKE-----YAKEALDKGLTHY
3drdA           -------------------------VKDINGKEYYDGFSSVWLNVHGRKKELDDAIKKQLGKIAHSTLLG
1dtyA           ---------------------------------------------------------------------F
2e7uA           -------------------------VWDADGNRYLDYVMSWGPLILGH--AHPKVLARVRETLERGLTFG
3cq6A           -----------------------------QLNVDIRLNTN--ENPYPPSEALVADLVATVDKIATEL-NR
1b5oA           ---------------AMKPSATVAVNAKALEVDLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
1bkgA           ---------------AMKPSATVAVNAKALEVDLVALTAGEPDFDTPEHVKE-----AARRALAQGKTKY
1c8nA           ----------------------------------------------------------------------
1akaA           ---------------MGPPDPILGVTEAFKRKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKM-DKEY
2bwnD           ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
3bwoA           -----------------------------MSDFVVNLDHGDPTAYEEYWRKMGDRCTVCDLMSYFSDMTN
7aatA           ---------------MGPPDPILGVTERDTNSKNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKM-DKEY
1d2fA           ---------------------------------LLPFTISDMDFATAPCII------EALNQRLMHGVFG
3aatA           ---------------------LADLFRADERPGKINLGIGVYTGKTPVLTSVKKAEQYLLENETTK--NY
2aatA           -------------------LGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLENETTKNY
1asfA           ---------------------LADLFRADERPGKINLGIGVYTGKTPVLTSVKKAEQYLLENETTKNYLG
1arsA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLENETTKNY
1ay5B           ---------------NLKPQAPDKILALMGEFGKIDLGVGVYKATGHTPIMRAVHAAEQRMLETETTKTY
3bwnF           -------------------------------DFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGSYFSDMTN
2e54A           ---------------------------------YLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNL
3cogD           --------------------------------GQDPEQWTSRAVVPPISLSTT-----FKQGAPGQHSGF
3dzzA           ------------------------------------------------------------------VAAF
1ay4B           ---------------------LMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMETETTKTY
2d64A           ---------------------LADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKN
1dgdA           ---------------------------------ILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSG
2aeuA           -----------------ARKIILEILNEKGRDALYDLSGLSGGFLI--------------DEKDKALLNI
3cq4B           --------------------TLSDLPLREELRVDIRLNTNENPYPPSE---------ALVADLVATVDKI
1bqaA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLENETTKNY
1asbA           --------------TAAPADPILGLFRADERPGKIIGVYKDETGKTPVLTSVKKAEQYLLENET--TKNY
3bwnB           ---------------------------IPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVCDLMSYFSDMTN
3dxvA           -------------------------------------------------------------------LSA
2eh6A           -------------------------LYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNL
3bwnE           --------------------------------FVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDL-MSYF
2d61A           ---------------------LADLLRADERPGKIDLGMGVYTGKTPVLTSVKKAEQYLLENETTKNYLG
2bhxB           ---------------------------------VFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELS
3cq5B           ---------------LSDLPLREELRGEHAYNVDIRLNTNENPYPPSEALVADL---VATVDKIATELNR
2aevA           ---------------------ILEILNEKGRDALYDLSGLSGGFLI--------------DEKDKALLNT
1e5eB           ----------------------PATACIHANPQKDQFGAAIPPIYQTS-TFVFDNCQQGGNRFAGQESGY
2d5yA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLENETTKNY
1e5eA           ----------------------PATACIHANPQKDQFGAAIPPIYQTS-TFVFDNCQQGGNRFAGQESGY
1ajrA           ---------------------LIADFREDPDPRKVNLGVGRTDDCQPWVLPVVRKVEQRIANNSSLNHEY
1czcA           ---------------------LADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLENETTKNY
1ariA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLENETTKNY
1bqdA           -----------ENITAAPADPILGLFRADERPGKINLGIGVYTGKTPVLTSVKKAEQYLLENET--TKNY
1aheA           -------------------LGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLENETTKLY
1arhA           ---------------------LADLFRADERPGKINLGIGVYTGKTPVLTSVKKAEQYLLENETTK--NY
3cq4A           --------------------TLSDLPLREELRVDIRLNTN--ENPYPPSEALVADLVATVDK------IA
1ax4A           ---------------MVEKIRVPSREEREAAYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAY
1b4xA           ---------------------LADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKN
3b46A           -KVVANKYFTSNTAKDVWSLTNEAAAKAANNQGLINLGQGFFSYSPPQFAIKEAQ--KALDIPM--VNQY
2dr1B           -----------------------------------------------------------MKVQMFSHRSK
2bwoD           ---------------------------------ITVWCGNDY-LGMGQHPVVLAAMHEALEAVGAGSGGT
2bwnA           ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
3bwoE           ------------------------------SDFVVNLDHGDPTA-YEEYWRKMGDRCTVTIRGCDLMSYF
2bwpA           ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
1eg5A           --------------------------------------------------------------------NS
3bv0B           ---------------------------------VLDAMSSWWTAIHGGHPALDQALTTQLRVMNHVMFGG
2bwoB           ---------------------------------ITVWCGNDY-LGMGQHPVVLAAMHEALEAVGAGSGGT
1d7uA           ----HLVRYGGTFEPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSG
3bwoD           ------------------------------SDFVVNLDHGDPTA-YEEYWRKMGDRCTVTIRGCDLMSYF
2bwoA           ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
3bwnA           ---------------------------IPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSMTN
3bwoB           ------------------------------SDFVVNLDHGDPTA-YEEYWRKMGDRCTVTIRGCDLMSYF
2bwnE           ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
3bwoF           --------------------------------FVVNLDHGDPTA-YEEYWRKMGDRCTVTIRGCDLMSYF
3bwnD           --------------------------------FVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSMTN
2d66A           ---------------------LADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLENETTKNY
2dkjA           ---------------------IALEEKRQREGLELIASENFVSKQVREAVGSV-----LTNKYAEGYPGA
2dr1A           -------------------------------KEVYEMVKPKYKLFTAGPVACFPEVLEIMKVQMFSHRSK
3caeA           ----------------------------------------------------------------------
2bwnB           ---------------------------------ITVWCGNDYLGMGQHPVVLAAMH-EALEAVGAGSGGT
1c7gA           --PAEPFRIKSVETVSMISRDERVKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAY
3bn1D           -----------------------------------------------------------VLECMDTTWIS
2c0rA           ---------------------------------AYNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMS
3bcaA           --------------GWDESTLELFLHELAVMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGQPKA
1ecxB           ---------------------------------------------------------------GNPNSAH
1bj4A           --------------------------------------------------------------------YY
2dgkC           -----------------HEMRDDVAFQIINDELYLDGNARTFCQTWDDENVHKLMDLSINKNWIDKEEYP
3dr4A           -----------------------------------------------------------VLECMDTTWIS
2dgmB           ---------------PLHEMRDDVAFQIINDELYLDGNAATFCQTWDDENVHKLMDLSINKNWIDKEEYP
3bcbA           ------------------------------------------------------------------QPKA
2c44A           ---------------------YREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAY
2c44B           ---------------------YREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAY
2cfbA           ----------------------------------------------------------------------
2dgmC           ---------------PLHEMRDDVAFQIINDELYLDGNAATFCQTWDDENVHKLMDLSINKNWIDKEEYP
2cb1A           ----------------------------------------------------------------------
2bieB           ------------------------------------FNAGPSALPKPALERAQKELLNFNDTQMSVMELS
3dr4B           -----------------------------------------------------------VLECMDTTWIS
1cs1A           -----------------------------RKQATIAVRSGLNDDE-------------QYGCVVP-PIHL
1b9iA           ------------------------------------------------------------------QWWR
2c81A           --------------------------------------------------------------------IS
2dgmE           ---------------PLHEMRDDVAFQIINDELYLDGNARTFCQTWDDENVHKLMDLSINKNWIDKEEYP
2c44C           ---------------VIEPVKRTTRAYRKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAY
2ch1A           -----------------------------------PPPASLRNPLIIPEKIMMGPGPKRVLTAMTNTVLS
2bieA           ---------------------------------------------------------NFNDTQMSVMELS
1c0nA           ----------------------PVLSREVNGLPLAYLDSAASAQ-KPSQVIDAEAEFYRHGYAAVHAGAH
1b9hA           -------------------------------------------------------------------WWR
3dr4D           -----------------------------------------------------------VLECMDTTWIS
1dfoB           ----------------------------------------------------------------------
3dxvB           ---------------------------------------------------------------------T
3caiA           ---------------------VRGLHPSLGDG-WVHFDAP--AGMLIPDSVATTVSTAFRRSGASTVGAH
3b8xA           ------------------------------------------------------------------SKMF
2d3jA           ---------------WIDAHQARVLIGFEEDILIVSEGKMAPFTHDFR---KAQQRMPAIPVNIHSMNFT
1ejjA           ----------------------------------------------------------------------
2dgkA           -----------------HEMRDDVAFQIINDELYLDGNAATFCQTWDDENVHKLMDLSINKNWIDKEEYP
3bc8A           ---------------PEDGWDESTLELFLHESNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRQPKA
3bcxB           ---------------------------------PKPFEAGKSVVPPSGKVIGTKELQLMVEASLD--GWL
1bjnA           ----------------------------------NFSSGPAMLPA-EVLKQAQQELRDWNGLGTSVMEVS
3ecdC           ---------------------------------------------------------RAVLDAQGSVLTN
2c7tA           ---------------------------------------HWPEWPQHSDRTRRKIEEVFQSNR---WAIS
3bs8A           -----------------------SKIFDIDGNEYIDYVLSWGPLILGH-TNDRVVESLKKVAEYGTSFGA
3ecdB           -----------------------------------------------------------VLDAQGSVLTN
3e9kA           -DKLRHFREFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAK---IAAYGHE
3bb8A           ---------------------------------PKPFEAGKSVVPPSGKVIGTKELQLMVEASLD--GWL
2bkwA           ----------------------------------------------------------------------
3bn1C           -----------------------------------------------------------VLECMDTTWIS
1bjoA           ----------------------------------NFSSGPAMLPA-EVLKQAQQELRDWNGLGTSVMEVS
3b8xB           ------------------------------------------------------------------SKMF
1ejiA           --------------------------------------------------------------------YY
3dpnA           ----------------------------------------------------------------------
3dr7B           -----------------------------------------------------------VLECMDTTWIS
2btwA           ----------------------------------------------------------------------
3banA           ----------------------------------------------------------------------
3ecdA           ---------------------------------------------------------RAVLDAQGSVLTN
2a7vA           ----------------------------------------------------------LQREKDRQCRGL
2btwB           ----------------------------------------------------------------------
3e77A           ---------------------------------------------------------DYKGVGISVLEMS
2cinA           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
3bcxA           ---------------------------------PKPFEAGKSVVPPSGKVIGTKELQLMVE--ASLDGWL
2bwpB           ----------------------------------------------------------------------
3e77C           ---------------------------------------------------------DYKGVGISVLEMS
2dgmA           ---------------PLHEMRDDVAFQIINDELYLDGNAATFCQTWDDENVHKLMDLSINKNWIDKEEYP
1agxA           -----------------------FFLNLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAVAL---ASSNE
1eghA           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
3ecdD           ---------------------------------------------------------------GSVLTNK
3bn1A           ---------------------------------------------------------------------S
3dr4C           ---------------------------------------------------------------------S
1djeA           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
2cy8A           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
1cj0A           ----------------------------------------------------------------------
1cj0B           ----------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
3a2bA           ----------------------------------------------------------------------
3d46A           ---SCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARP---DLAKEMGFIGGKMPTHWGPHDGDA
3cxmA           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2egyD           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2egyB           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
2egyC           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
3cbfA           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
3d6kC           GGLLGIADIRELWAEALGLPIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEIN
3d6kB           GGLLGIADIRELWAEALGLPIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEIN
3d6kD           GGLLGIADIRELWAEALGLPIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEIN
3dc1A           SPSAGIPELLSWLKQLPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
3d6kA           GGLLGIADIRELWAEALGLPIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEIN
3ei6A           GAEQGAKPLRATFYGGLGIGDDDVFVSDGAKCDISRLQVMF-GSNVTIAVQDPSYPAYVDSSVIMGQTGQ
3ei8A           GAEQGAKPLRAAIAKTFYGGLDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
3ei6B           GAEQGAKPLRATFYGGLGIGDDDVFVSDGAKCDISRLQV-MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
3dc1B           SPSAGIPELLSWLKQLQIQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
3dydA           APSIGFLSSREEIASYYPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVK
2douB           CLKSCTLPFLEEAARWYEGRRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTF
3ei9A           GAEQGAKPLRAAIAKTFYGGLDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
5bj4A           APPAGIPELREALAEKFRREPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1cl1B           RGTLTHFSLQQAMCELEG--GAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLG
1cl1A           RGTLTHFSLQQAMCELE--GGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLG
3ei7B           GAEQGAKPLRAAIAKTFYGGLDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
2douA           CLKSCTLPFLEEAARWYEGRRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTF
3dc1D           SPSAGIPELLSWLKQLQIQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
1bw0B           FPTVGSPEAREAVATWWTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMH
1djuA           GPNIGLLELREAIAEKEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPV
3ei7A           GAEQGAKPLRKTFYGGLGIGDDDVFVSDGAKCDISRLQV-MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
3dydB           APSIGFLSSREEIASYYPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVK
3bmaD           VPFFGSSEWLRFDGAHPAVLYRPYLLGQGGAASLNQYFGPQLENKQVVYVISPQWFSKNGYDPAAFQQYF
3bwnC           LCWFLEPELEDAIKDLAATEDRYIVVGTGSTQLCQAASSLARSQPVSVVAAAPFYSTYVEETTYVRSGMY
3e2yA           TRGFGHPALVKALSCLYIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPV
5bj3A           APPAGIPELREALAEKFRREPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
3ei9B           GAEQGAKPLRATFYGGLGIGDDDVFVSDGAKCDISRLQVMF-GSNVTIAVQDPSYPAYVDSSVIMGQTGQ
3e2fA           TRGFGHPALVKALSCLQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPV
2e7jA           EWPPIHDFIHNQLPKFLG--CDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIA
3eiaA           GAEQGAKPLRAAIAKTFYGGGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
1bjwA           APPAGIPELREALAEKFRREPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1b8gB           QDYHGLPAFKKAMVDFVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTHCTS
1aamA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
3cogB           EYSRSGNPTRNCLEKAVAALGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFG
1b8gA           QDYHGLPAFKKAMVDFVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEI
1bw0A           FPTVGSPEAVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMH
3bwoC           LCWFLEPELEDAIKDLAATEDRYIVVGTGSTQLCQAAVHALSSQPVSVVAAAPFYSTYVEETTYVRSGMY
1d2fB           YSRWKNDEFLAAIAHWFSTQSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVM
1ajsA           LPILGLAEFRTCASRLALGDRVGGVQSLGGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDI
3eiaB           GAEQGAKPLRAAIAKTFGIGDDDVFVSDGAKCDISRLQV-MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQ
3b46B           SPTRGRPSLINSLIKLYSPIAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVV
1b5pA           APPAGIPELREALAEKFRREPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1c7nA           GYTGPTEEYKKTVKKWMDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKII
1aiaA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLAKSVKRVWVSNPSWPNHKSVFNSAGLEVR
2drrA           WGPAPDGEEYFALALFFARWGDGDEQPFYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSD
1c4kA           IHEGPAVAAEKHAARVYNA-DKTYFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNSALAMAGGRP
3cq5A           YPERDAVELRDELAAYITKQRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFI
2cstA           LPILGLPEFRANASRIAAQKRVGSVQGLGGTGALRIGAEFNNNTATPVYVSSPTWENHNSVFMDAGFKDI
3b5oA           TENPVVQLSQASFAQIAYVQPKELVGFTERRKALGAGWNGVAQELQENIDEEGSTTGGISHYTLLADGLE
3dzzB           GYESVPAEYYKAVADWERARPEDWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNFYSVIEGNGRRVIS
1ay4A           AGLSGEPEFQKAMGELILGDGLKSETTATGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQ
1djuB           GPNIGLLELREAIAEKEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPV
3drdA           MTNVPATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKSYKAPIPYVY
1dtyA           LADSGSVAVEVAMKMALQYWRDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMD
2e7uA           APSPLEVALAKKVKRAYPTMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPE
3cq6A           YPERDAVELRDELAAYITKQRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFI
1b5oA           APPAGIPELREALAEKFRREPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1bkgA           APPAGIPELREALAEKFRREPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
1c8nA           ------------------VSNSELTPIALAYTVQSLPLIATQ--PAWLGTIADNYSKWRWVSLRIIPKCP
1akaA           LPIAGLADFTRASAELALYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQ
2bwnD           RNISGTTAYHRRLEAEIAHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
3bwoA           LCWFLEPELEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALRSQPVSVVAAAPFYSTYVEETTYVRSGMY
7aatA           LPIAGLADFTRASAELALGETVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQ
1d2fA           YSRWKNDEFLAAIAHWFSTQSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVM
3aatA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLATSVKRVWVSNPSWPNHKSVFNSAGLEVR
2aatA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
1asfA           IDGIPQELLFGKGSALINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
1arsA           LGIDGIPEFGGKGSALINDKRARTAQTPGGTGALRVAADFLAKNVKRVWVSNPSWPNHKSVFNSAGLEVR
1ay5B           AGLSGEPEFQKAMGELILGDGL-KSETTATLARQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQ
3bwnF           LCWFLEPELEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALSSQPVSVVAAAPFYSTYVEETTYVRSGMY
2e54A           FWNRPQMELAELLSKNTF--GGKVFFANTGTEANEAAIKIARKYGKKILSAHNSFHGRTLGSLTATGQPK
3cogD           EYSRSGNPTRNCLEKAVALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFG
3dzzA           GYESVPAEYYKAVADWEEIEKEDWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNFYSVIEGNGRRVIS
1ay4B           AGLSGEPEFQKAMGELILGDGLKSLATVGGTGALALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQ
2d64A           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPGWPTHKSVFNSAGLEVR
1dgdA           MLSRPVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAKLVTGKVGPAAVGSFAIPAPFTYRPRFER
2aeuA           GSSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAK
3cq4B           ATELDAVELRDELAAYIAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFI
1bqaA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
1asbA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLAKSVKRVWVSNPSWPNHKSVFNSAGLEVR
3bwnB           LCWFLEPELEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMY
3dxvA           SNAPAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAKATGRSGVIAFAGAYHGCTVGSMAFSGLIL
2eh6A           YENPWQEELAHKLVKHFWFANSGTESVEAAIKLARKYWRDKGKNKWKFISFENSFHGRTYGSLSATGQPK
3bwnE           SDMTNLCWLEDAIKDLHGVVDRYIVVGTGSTQLCQAASSLARSQPVSVVAAAPFYSTYVEETTYVRSGMY
2d61A           IDGIPEFGLFGKGSALINDKRARTAQTPGGTGALRVAADFLATSVKRVWVSNPSWPNHKSVFNSAGLEYA
2bhxB           HRSQSYEEVHEQAQNLLPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGET
3cq5B           YPERDAVELRDELAAYITKQRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFI
2aevA           SSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAKY
1e5eB           IYTRLGNPTVSNLEGKIAEKTEACVATSSGMGAIAATVLTILKAGDHLISDECLYGCTHALFEHALTKFG
2d5yA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
1e5eA           IYTRLGNPTVSNLEGKIAFLTEACVATSSGMGAIAATVLTILKAGDHLISDECLYGCTHALFEHALTKFG
1ajrA           LPILGLAEFRTCASRLLQEKRVGGVQSLGGTEFLARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDI
1czcA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLAKNVRRVWVSNPSWPNHKSVFNSAGLEVR
1ariA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSHPNHKSVFNSAGLEVR
1bqdA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFLNTSVKRVWVSNASWPNHKSVFNSAGLEVR
1aheA           LGIDGIPEFGRCTQELINDKRARTAQTPGGSGALRVAADFLAKNVKRVWVSNPSWPNHKSVFNSAGLEVR
1arhA           LGIDGIPEFGRCTQELINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
3cq4A           TELRDAVELRDELAAYITKQRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFI
1ax4A           AGSRNYYDLKDKAKELFNYDHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFHFDTTAAHVELNGCKAI
1b4xA           YGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR
3b46A           SPTRGRPSLINSLIKLYSPIAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVV
2dr1B           EYRKVHMDTVERLREFLEVEKGEVLVPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRK
2bwoD           RNISGTTAYHRRLEAEIAHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
2bwnA           RNISGTTAYHRRLEAEIAHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
3bwoE           SDMTNLCWLEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALSSLPVSVVAAAPFYSTYVEETTYVRSGMY
2bwpA           RNISGTTAYHRRLEAEIAHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
1eg5A           AHGGIEANLHEKAREKVGVSPSEIFFTSCATESINWILKTVEKRKRTIITTPIEHKAVLETKYLSKGFKV
3bv0B           LTHEPAARLAKLLVDITPAGLDTVFFSDRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAP
2bwoB           RNISGTTAYHRRLEAEIAGLKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
1d7uA           MLSRPVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAKLVTKGVGPAAVGSFAIPAPFTYRPRFER
3bwoD           SDMTNLCWLEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALSSLPVSVVAAAPFYSTYVEETTYVRSGMY
2bwoA           RNISGTTAYHRRLEAEIAHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
3bwnA           LCWFLEPELEDAIKDLHGVVDRYIVVGTGSTQLCQAASSLARSQPVSVVAAAPFYSTYVEETTYVRSGMY
3bwoB           SDMTNLCWLEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALSSLPVSVVAAAPFYSTYVEETTYVRSGMY
2bwnE           RNISGTTAYHRRLEAEIAGLKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
3bwoF           SDMTNLCWLEDAIKDLHGVVDRYIVVGTGSTQLCQAAVHALSSQPVSVVAAAPFYSTYVEETTYVRSG--
3bwnD           LCWFLEPELEDAIKDLHGVVDRYIVVGTGSTQLCQAASSLARSQPVSVVAAAPFYSTYVEETTYVRSGMY
2d66A           LGIDGIPEFFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVVWVSNPGWPTHKSVFNSAGLEVR
2dkjA           RYYGGCEVIDRVESLALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGK
2dr1A           EYRKVHMDTVERLREFLEVEKEVLLVPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRV
3caeA           ----------------LEDKVSKQLESKGIKFEYEEWKVPYSNNQQNYSS--HTYTPDFLLPNGIFVETK
2bwnB           RNISGTTAYHRRLEAEIAGLKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGP
1c7gA           AGSENFYHLEKTVKELFGF--KHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQEKNGATFVD
3bn1D           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPV
2c0rA           HRGAVYEAVHNEAQARLLALYKVLFIQGGASTQFAMIPMNFLKEGQTANYVMTGSWASKALKEAKLIGDT
3bcaA           AGSSLLNKITNSLVLNVIKLASCFVVPMATGTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPV
1ecxB           GMGIEANLHMEKAREKVGVSPSEIFFTSCATESINWVAETFEKRKRTIITTPIEHKAVLETMKYLSMKGF
1bj4A           GGTEFIDELETLCQKRALQAWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKI
2dgkC           QSAAIDLRCVNMVADLWHAPACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELR
3dr4A           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPV
2dgmB           QSAAIDLRCVNMVADLWHAPACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELR
3bcbA           AGSSLLNKITNSLVLNVGVHSASCFVVPMATGMSLTLCFLTLPKAKYIIWPRIDQKSCFKSMVTAGFEPV
2c44A           SGSRSYYALAESVKNIFGYQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVR
2c44B           SGSRSYYALAESVKNIFGYQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVR
2cfbA           ----PCLLENILAEMVIAAVPEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHAATLTAPYND
2dgmC           QSAAIDLRCVNMVADLWHNGQAVGTNTIGSSEACMLGGMAMKWRWKPNLVCGPVQICWHKFARYWDVELR
2cb1A           ----------------------EAVVLASGQAATFAALLALLRPGDEVVAAKGLFGQTIGLFGQVLSLMG
2bieB           HRSQSYEEVHEQAQNLLRELYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGET
3dr4B           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPV
1cs1A           SSTYNFTGFNEPRAHDYSRDVVQRVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGC
1b9iA           MGGDEVNSFEREFAAHHGA-AHALAVTNGTHALELALQVMGVGPGTEVIVPAFTFISSSQAAQRLGA--V
2c81A           GYWTGEESMERKFAKAFADFPYCVPTTSGSTALMLALEALGIGEGDEVIVPSLTWIATATAVLNVNALPV
2dgmE           QSAAIDLRCVNMVADLWHAPQAVGTNTIGSSEACMLGGMAMKWRDKPNLVCGPVQICWHKFARYWDVELR
2c44C           SGSRSYYALAESVKNIFGYQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVR
2ch1A           NFHAELFRVKDGLRYIFQTERATMCVSGSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVEMSERDVRT
2bieA           HRSQSYEEVHEQAQNLLRELYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGET
1c0nA           TLSAQATEKMENVRKRAARSAEELVFVRGTNLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVR
1b9hA           MGGDEVNSFEREFAAHHGA-AHALAVTNGTHALELALQVMGVGPGTEVIVPAFTFISSSQAAQRLGA--V
3dr4D           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPV
1dfoB           --------AIDRAKELFGA-DYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGK
3dxvB           HKIWFGHSGSDANEAAYRAIRSGVIAFAGAYHGCTVGSMAFSGHSVQADAAKADGLILLPYPDPYRPYRN
3caiA           PSARRSAAVREAVADLVNADPGGVVLGADRAVLLSLLAEASSSRAGLVIVSRLDDEANIAPWLRAAVKWA
3b8xA           TMGEYVKQYETQFAKTFGSKSSGSTANLLMIAALFFTKKPRLKKGDEIIVPAVSWSTTYYPLQQYGLRVK
2d3jA           WQAAGQAEYFYEFLSLRSADPTVNVPLLGTVPHKASVVQVGFGKQDGVAAFEVDVIVMNSEGNTILQTPQ
1ejjA           ----------------------------------------------PVALIILDGFAL---------RDE
2dgkA           QSAAIDLRCVNMVADLWHNGQAVGTNTIGSSEACMLGGMAMKWRDKPNLVCGPVQICWHKFARYWDVELR
3bc8A           AGSSLLNKLVLNVIKLAGVHASCFVVPMATGMLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPV
3bcxB           TTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPV
1bjnA           HRGKEFIQVAEEAEKDFRDLYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTP
3ecdC           KYAEGYDEVEALAIERVKRLGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLI--
2c7tA           GYWTGEESMERKFAKAFADFPYCVPTTSGSTALMLALEALGIGEGDEVIVPSLTWIATATAVLNVNALPV
3bs8A           PTEVENELAKLVIDRVPSV--EIVRMVSSGTEATMSALRLHGDSLLIKAGSGVATLGLPDSPGVPEGIAK
3ecdB           KYAEGYADEVEALAIERVKRGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLI--
3e9kA           VGKRPWITGDESIVGLMGANEKEIALMNALTVNLHLLMLSFFPKRYKILLEAKAFPSDHYAIESQLQLHG
3bb8A           TTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTAVRALKPGDEVITVAAGFPTTVNPTIQNGLIPV
2bkwA           --QRVLKNTRAVFKSAAASKSQPFVLAGSGTLGWDIFASNFIAPNKNVLVVSTGTFSDRFADCLRSVDVV
3bn1C           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPV
1bjoA           HRGKEFIQVAEEAEKDFPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAIKEAKKYCTPNVF
3b8xB           TMGEYVKQYETQFAKTFGSKSSGSTANLLMIAALFFTKKPRLKKGDEIIVPAVSWSTTYYPLQQYGLRVK
1ejiA           GGTEFIDELELCQKRALQAYWGVNVQPYSGSPANFAVYTALVEPHGRIGLDLPDGGHLTHGFTDKKKISA
3dpnA           ----------------------------------------------------------------------
3dr7B           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPV
2btwA           ----------------------PNLIGFNSNEGEKL----LLTSRSREDFFPLSQFVTQVNQAYCGVASI
3banA           ----------------------------------------------------------------------
3ecdA           KYAEGADEVEALAIERVFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLI--
2a7vA           ELIASENFCSRAALEALGYSEGVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHD
2btwB           ----------------------PNLIGFNSNEGEKL----LLTSRSREDFFPLSQFVTQVNQAYCGVASI
3e77A           HRSSDFAKIINNTENLVPDNYKVIFLQGGGCGQFSAVPLNLIGAGRCADYVVTGAWSAKEAKKFGTINIV
2cinA           -------------------------------------------------------------FPKFDWPRI
3d19A           ---------------------EIRFWSRIMKEHSFFLRLGFRCEDTQLIEEANQFYRFEHIEQIAHSYTN
3bcxA           TTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTAVRALKPGDEVITVAAGFPTTVNPTIQNGLIPV
2bwpB           -----HRRLEAEIAGLHQK--EAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHAIEGIKRNAGPKR
3e77C           HRSSDFAKIINNTENLVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGADYVVTGAWSAKEAKKFGTINIV
2dgmA           QSAAIDLRCVNMVADLWHAPAPKNGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELR
1agxA           AKNKGVMVLMNDSIFAARDVHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQ
1eghA           --------------------PARKHIALVAHDHCKQMLMSWVERHQPLLEQHVLYGTTGNLISRATGMNV
1bs0A           --------LEEELAEWLGY--SRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLR
3ecdD           YADEVEALAIERVKRLFN-AGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSR-------
3bn1A           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGPVLV
3dr4C           SVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGPVLV
1djeA           --------LEEELAEWLGY--SRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLR
1ei7A           ---------------------ELINLCTNAQQARTVVQRQFSE----------VWKPSPQVTVRFPDSDF
2cy8A           ----GHPRVNAAIAEALAASHPLEVRWAERIVAAFPSIRKLRTETTLLALRVARAFTGRRMILRFETANT
3d19E           ---------------------EIRFWSRIMKEHSFFLRLGFRCEDTQLIEEANQFYRLFHIEQIAHSYTN
1cj0A           --------CQKRALQAYGLDPQCNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLATSIFFESMAY
1cj0B           --------CQKRALQAYGLDPQCWVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKAY
3e6gD           --------YERCVAALEGG--TRAFAFASGMAATSTVME-LLDAGSHVVAMDDLYGGTFRLFERVRRRTA
3e6gB           --------YERCVAALEGG--TRAFAFASGMAATSTVME-LLDAGSHVVAMDDLYGGTFRLFERVRRRTA
3a2bA           --------LEEKLSAYVGK--EAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVI
3d46A           GIRKDAAMVADMR-EKCGPDFWLMLDCWMSQDNYATKLAHACAPFNLKWIEECLPPQQYEGYRELKRNAP
3cxmA           ---------DAVIQHLSQHHPNRLVFLLWGGYAQQKKRLIDANRHVVLENVHPSPLSANRGWFGCRCCNE
3bzsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2egyD           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2egyB           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
2egyC           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
3cbfA           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
3d6kC           VPTDEGPDGVVRELVK----DPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTL
3d6kB           VPTD----EGPDGVVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTL
3d6kD           VPTDEGPDGVVRELVK----DPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTL
3dc1A           NVASDESGIWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
3d6kA           VPTD----EGPDGVVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTL
3ei6A           FNTDVQKYGNENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
3ei8A           FNTDVQKYGNINGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
3ei6B           FNTDVQKYGNINGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
3dc1B           NVASDESGIWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
3dydA           LYNLLPEKSWEIDLKQLEYLIDEKTCLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVF
2douB           LIPLREDG-LADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVY
3ei9A           FNTDVQKYGNINGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
5bj4A           EVETLPEEGFVPDPERVRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
1cl1B           VTTSWFDPLIGADIVKHLQPNTK--IVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLF
1cl1A           VTTSWFDPLIGADIVKHLQPNTK--IVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLF
3ei7B           FNTDVQKYGNENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
2douA           LIPLREDG-LADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVY
3dc1D           NVASDESGIVPPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
1bw0B           FYNCRPENDWEADLDEIRRLKDDKKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVF
1djuA           EVPTYEEDEFRLNVDELKKYVTDKRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIY
3ei7A           FNTDVQKYGTPENGFFPDLSTVGRDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
3dydB           LYNLLPEKSWEIDLKQLEYLIDEKACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVF
3bmaD           NGDQLTSFLKHQSGDQASQYAATR-LLQQFPNVAMKDLVQKLASKEELSTIELLARFNERQASFFGQFGY
3bwnC           KWEGDAWGFDKK----------GPYIELVTSPNNPDGTIRETVVAKVIHDFAYYWPHYTPITRRQDH---
3e2yA           FIPLRSKPTDPRELES--KFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVY
5bj3A           EVETLPEEFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
3ei9B           FNTDVQKYGTPENGFFPDLSTVGRTIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
3e2fA           FIPLRSKPTDPRELES--KFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVY
2e7jA           LVPKTDYPITPENFAQTIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRM
3eiaA           FNTDVQKYGTPENGFFPDLSTVGRDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
1bjwA           EVETLPEEGFVPDPERVRRAITPRKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
1b8gB           SNGFQITETALEEAYQEAEKRNLRKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1aamA           EYAYYDAELDFDALINSLNEAQAGDVVFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
3cogB           LKISFVDCSKIKLLEAAITPETK--LVWIETPTNPTQKVIDIEGCAHIVH--KHGDIILVVDNTFMSPYF
1b8gA           VPIHCTSSNGLEEAYQEAEKRNLRKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAF
1bw0A           FYNCRPENDWEADLDEIRRLKDDKKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVF
3bwoC           KWEGDAWGFDKK----------GPYIELVTSPNNPDGTIRETVVAKVIHDFAYYWPHYTPITR-------
1d2fB           PVALEKQACDMGKLEAVLAKPECKI-MLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVW
1ajsA           RSYRYWDTEDLQGFLSDLEAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFAS
3eiaB           FNTDVQKYGNENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMS
3b46B           YVPINPPKEDFEQFEKAITS--KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF
1b5pA           EVETLPEEGFVPDPERVRRAITPRKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
1c7nA           ECELLEKDGDFQKLEKLSK-DKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIM
1aiaA           EYDAENHTLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
2drrA           PSYHLPHFANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPN--DEKGYGHFFSNSYRVAAN
1c4kA           VYLQTNRNPELAAKVDPERAKWKRFRLAVIQLGTYDGTIYNA---HEVVKRIGHLCDYIEFDSAWVGYEQ
3cq5A           AVSRGADFRIDMDVA---LEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSP
2cstA           RTYRYWDAADLQGLLDDMEKAPEFIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFAS
3b5oA           EGLGVAVKNTPSVATSKLLRTV--LSLFDRQVDYVLGATYAIEATSIPELTLIVKLVEWLHEGIPKDLQY
3dzzB           SDLIYENSKYSVNWADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVL
1ay4A           TYDAETRGVDFEGMKADLAAAKKGMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGD
1djuB           EVPTYEEDEFRLNVDELKKYVTDKRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIY
3drdA           RSESGDPDERDQCLRELAQEEIAALSIESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGR
1dtyA           GEWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGR
2e7uA           EYAKLTLYNDPEGLREVLKRRGEEAAIIFEPVVGNAGVLVPTEDFLKALHEAKAYGVLLIADEVMTGFRL
3cq6A           AVSRGADFRIDMDVAL---EEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSP
1b5oA           EVETLPEEGFVPDPERVRRAITPRKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
1bkgA           EVETLPEEGFVPDPERVRRAITPRKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLY
1c8nA           TTTSGTVAMCLSYDRNDVAP--GSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDK
1akaA           AYRYYDPKLDFTGAMEDISKIPEKIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFAS
2bwnD           KRIFRHNDVHLRELIAADDPAAPKLIAFES-VYSMDGDFGPI---KEICDIAEEFGALTYIDEVHAVGMY
3bwoA           KWEGDAWGFD----------KKGPYIELVTSPNNPDGTIRETVVAKVIHDFAYYWPHYTPITRRQ-----
7aatA           AYRPKTCSLDFTGAMEDISKIPEKIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFAS
1d2fA           PVALEKQADGWFCDMGKLEAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVW
3aatA           EYAYYDAENHTLDFDALINSLNGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
2aatA           EYAYENHTLDFDALINSLNEAQAGDVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1asfA           EYAYYDAENHTLDFDALINSLNGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAFQGFAR
1arsA           EYDAENHTLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1ay5B           TYDAETRGVDFEGMKADLAAAKKGMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGD
3bwnF           KWEGDAWG----------FDKKGPYIELVTSPNNPDG------------TIRETVVAKVIHDFAYYWPHY
2e54A           YQKPFEPLVPGFEYFEFNMSEDVCAVFLEPI-QGESGIVPATKEFLEEARKLCDEDALLVFDEVQCGMGR
3cogD           LKISFVDCSKIKLLEAAITPETK--LVWIETPTNPTQKVIDIEGCAHI--VHKHGDIILVVDNTFMSPYF
3dzzA           SDLIYENSKYSVNWADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVL
1ay4B           TYDAETRGVDFEGMKADLAAAKKGMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGD
2d64A           EYDAENHTLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1dgdA           NGAYDYLAYAFDLIDRQSS-GNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGR
2aeuA           YFESDKVGEILNKIDKDTL--------VIITGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVR
3cq4B           AVSRGADFRIDMDVA---LEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSP
1bqaA           EYAYYDAENHTLDFDALINSLNEAQVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1asbA           EYDAENHTLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFAFAYQGFAR
3bwnB           KWEGDAWGFD---------KKGPYIELVTSPNN------PDGTIRETVVNRPDDDEAKVIHDFAYYWPHY
3dxvA           PTGDAILTLLTEKLAAVP-AGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLAR
2eh6A           FHKGFEPLVKLNDIDSVYKLLDEETAGIIIEVIQGEGGVNEASELSKLQEICKEKDVLLIIDEVQTGIGR
3bwnE           KWEGDAWFDKKGP-----------YIELVTSPNNPDGTI-----------RETVVEAKVIHDFAYYWPHY
2d61A           YYDAENHTLDFDALINSLNEAQAGDVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
2bhxB           HIAASTKANSYQSIPDF------SEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSR
3cq5B           AVSRGADFRIDMDVAL---EEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSP
2aevA           --------FESDKVGEILNKIDKDTLVIIT-GSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVR
1e5eB           IQVDFINTAIPGEVKKHMKPNTK--IVYFETPANPTLKIIDMERVCKD--AHSQEGVLVIADNTFCSPMI
2d5yA           EYAYYDAELDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1e5eA           IQVDFINTAIPGEVKKHMKPNTK--IVYFETPANPTLKIID---MERVCKDAHSQEVLVIADNTFCSPMI
1ajrA           RSYRYWDTEDLQGFLSDLENAPEFIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFAS
1czcA           EYDAENHTLDFDALINSLNEAQAGDVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1ariA           EYAYYDAELDFDALINSLNEAQAGDVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1bqdA           EYAYYDATLDFDALINSLNEAQAGVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1aheA           EYDAENHTLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
1arhA           YYDAENHTLDFDALINSLNEAQAGVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQGFAR
3cq4A           AVSRGADFRIDMDVALEEIRAKQPDI---VFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSP
1ax4A           NIVTEKAFDDIKKLKENIAADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENA
1b4xA           EYAYYDAELDFDALINSLNEAQAGDVVLFGSCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
3b46A           YVPINPPKEDFEQFEKAITSKTK--AVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF
2dr1B           AVVLEYEAVKPEDLDDALRKNPDVEAVTITYNETSTGVLNPL---PELAKVAKEHDKLVFVDAVSAMGGA
2bwoD           KRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPI---KEICDIAEEFGALTYIDEVHAVGMY
2bwnA           KRIFRHNVAHLRELIAADDPAAPK-LIAFESVYSMDGDFGPIKEICDIAE---EFGALTYIDEVHAVGMY
3bwoE           KWE-------GDAWGFDKKGPY---IELVTSPNNPDG-------------TIRET----VVAKVIHDFAY
2bwpA           KRIFRHNDVHLRELIAADDPAAPK-LIAFESVYSMDGDFGPIKEICDIAE---EFGALTYIDEVHAVGMY
1eg5A           KYVPVDSRGKLEELEKLVDEDT---FLVSIAANNEVGTIQPVEDV---TRIVKKKNKETLVHVDAVQTIG
3bv0B           QVPRDYDPAYSAAFEAQLAAGELAAVVVEPVVQGAGGMRFHDPRYHDLRDICRRYEVLLIFDEIATGFGR
2bwoB           KRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAE---EFGALTYIDEVHAVGMY
1d7uA           NGAYDYLA-ELDYAFDLIDSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGR
3bwoD           KWE-----GDAWGFDKKGPY-----IELVTSPNNPDG-------------TIRET----VVAKVIHDFAY
2bwoA           KRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPI---KEICDIAEEFGALTYIDEVHAVGMY
3bwnA           KWEGDAWG----------FDKKGPYIELVTSPNNPDGTIRETV----------VDEAKVIHDFAYYWPHY
3bwoB           KWE-------GDAWGFDKKGPY---IELVTSPNNPDG-------------TIRET----VVAKVIHDFAY
2bwnE           KRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMY
3bwoF           -------MYKWEGDAWGFDKKGPYIEL-VTSPNNPDGTIRET-----------------VVAKVIHDFAY
3bwnD           KWE----------GDAWGFDKKGPYIELVTSPNNPDG-----------TIRETVVNAKVIHDFAYYWPHY
2d66A           EYAYYDAENHTLDFNSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAR
2dkjA           LYKVVSYGVRPDTELIDLEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLV
2dr1A           LEYEPGKAVKPEDLDDALRKNPDVEAVTITYNETSTGVLNPLPELAKVAK---EHDKLVFVDAVSAMGGA
3caeA           GLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYK------GSPTSYGEFCEKHGIKFADKLIPAEWIK
2bwnB           KRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAE---EFGALTYIDEVHAVGMY
1c7gA           IVRDEAHDASLTLIKE-KGAENIAYICLAVT-VNLAGGQPVSMANMRAVHEMASTGIKIFYDATRCVENA
3bn1D           LVDNDPRT-FNLDAAKLEALITPRTKAIMPV--HLYG---QICDMDPILEVARRHNLLVIEDAAEAVGAT
2c0rA           HVAASSEASNYMTLPKLQEI------QLQDNAAYLHLTSNETIEGAQFKAFPDTGSVPLIGDMSSDILSR
3bcaA           VIENVLEGDDLKAVEAKIQELGPE-HILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSS
1ecxB           KVKYVPVDSRLEELEKLVD-EDTFLVS-IMAANNEVGTIQPV---EDVTRIVKKKNKETLVHVDAVQTIG
1bj4A           SATSIFFESGYINYDQLEENARLFHPKLIIAGTSCYSRNLEY---ARLRKIADENGAYLMADMAHISGLV
2dgkC           EIPMRPGQMDPKRMIEACDENTI--GVVPTFGVTYTGNYEFPQPLHDALDKFTGIDIDMHIDAASGGFLA
3dr4A           LVDNDPRT-FNLDAAKLEALITPRTKAIMPVH--LYG---QICDMDPILEVARRHNLLVIEDAAEAVGAT
2dgmB           EIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQGIDIDMHIDAASGGFLA
3bcbA           VIENVLEGDDLKAVEAKIQELGPEH-ILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSS
2c44A           NVYIKEAFDDLEGLERGIEEVGPPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENA
2c44B           NVYIKEAFDDLEGLERGIEEVGPNNYIVATITSNSAGGQPVSLALKAMYSIAKKYDIPVVMDSARFAENA
2cfbA           L-------EAVSRLFEQYP-NDIAGVILEPV-VGNAGFIPPDAGFLEGLRELTKQGALLVFDEVMTGFRI
2dgmC           EIPMRPGQLDPKRMIEACDENTIGVV--PTFGVTYTGNYEFPQPLHDALDKFQGIDIDMHIDAASGGFLA
2cb1A           -VTVRYVDPEPEAVREALSAK--TRAVFVETVANPALLVPDLEA---LATLAEEAGVALVVDNTFGAAGA
2bieB           HIAASTKANSYQSIPDFSEF------QLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSR
3dr4B           LVDNDPRTFNLDAAK--LEALITPRTKAI----MPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGAT
1cs1A           YRVLFVDQGDEQALRAALAEKPKLVLVESPSN--PLLRVVDI---AKICHLAREVGAVSVVDNTFLSPAL
1b9iA           TVPAATYNLDPEAVAAAVTPR--------TKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGAR
2c81A           FVDVEADTYCIDPQLIK------SAITDKTKAIIPVHLFGSMANMDEINEIAQEHNLFVIEDCAQSHGSV
2dgmE           EIPMRPGQMDPKRMIEACDENTI--GVVPTFGVTYTGNYEFPQPLHDALDKFQGIDIDMHIDAASGGFLA
2c44C           NVYIKEAFDDLEGLERGIEEVGPPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENA
2ch1A           IEGPPDRPFSLETLARAIELHQPKCLF----LTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGV
2bieA           HIAASTKYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEI---------NHAPLIADMSSDILSR
1c0nA           VIPLNPDGTLQLETLPTLFDAATRLLA-ITHVSNVLGTENPL---AEMITLAHQHGAKVLVDGAQAVMHH
1b9hA           TVPAATYNLDPEAVAAAVTPR--------TKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGAR
3dr4D           LVDNDPRTFNLDAAK---LEALITPRTKAIMPVHLYGQICDMDPILEVAR---RHNLLVIEDAAEAVGAT
1dfoB           LYNIVPYGIDATDYADLEKQAKEHKPKMIIGGFSAYSGVVDW---AKMREIADSIGAYLFVDMAHVAGLV
3dxvB           DPTGDAILTLLTEKLAAVPAGSIGAAFIEP-IQSDGGLIVPPDGLRKFADICRAHGILVVCDEVKVGLAR
3caiA           EVDIETGELPTWQWESLIS-KSTR-LVAVNSASGTLGGVTDLRAMTKLVH---DVGALVVVDHSAAAPYR
3b8xA           FVDIDINTLNID------IESLKEAVTDSTKAILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMGAT
2d3jA           NAIFFKTCLQAE----------------------------------------------------------
1ejjA           TYGNAVAQPNFDRYWNEYPHTTLKACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRINIAIREGEFD
2dgkA           EIPMRPGQMDPKRMIEACDENTIGVV--PTFGVTYTGNYEFPQPLHDALDKFTGIDIDMHIDAASGGFLA
3bc8A           VIENVLEGDDLKAVEAKIQE-LGPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSS
3bcxB           FVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLFDL------AEVRRVADKYNLWLIEDCCDALGST
1bjnA           NVFD----AKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSR
3ecdC           ---------DYDQVEALAQQHKP---SLIIAGFSAYPRKLDF---ARFRAIADSVGAKLMVDMAHIAGVI
2c7tA           FVDVEADTYCIDPQLIK------SAITDKTKAIIPVHLFGSMANMDEINEIAQEHNLFVIEDCAQSHGSV
3bs8A           NTITVPYND-LESVKLAFQGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRV
3ecdB           ---------DYDQVEALAQQHKP---SLIIAGFSAYPRKLDFARFRAIAD---SVGAKLMVDMAHIAGVI
3e9kA           LNIEESMRMRIEDILEVIEKEGDSIAVILSGVHFYTGQHFNI---PAITKAGQAKGCYVGFDLAHAVGNV
3bb8A           FVDVDIPT-YNVNASLIEAAVSDKT--KAIMIAHTLGNLFDL---AEVRRVADKYNLWLIEDCCDALGST
2bkwA           RPLKIGESVPLELITEKLSQNSYG-AVTVTHVDTSTAVLSDLKAISQAI-KQTSPETFFVVDAVCSIGCE
3bn1C           LVD-NDPRTFNLDAAKLEALITPR-----TKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGAT
1bjoA           DAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDF-------GADVVVAADFSSTILSR
3b8xB           FVDIDINTLNIDIE------SLKEAVTDSTKAILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMGAT
1ejiA           TSIFFESPYKVYPEDQLEENASLFHPKLIIAGTSCYSRNLDY---ARLRKIADDNGAYLADAHISGLVAA
3dpnA           ---------------------SNTEALIIDQTNNPGGSVLYLYALLSMLTDRPLELPKHRMILTQDEVVW
3dr7B           LVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVAR------RHNLLVIEDAAEAVGAT
2btwA           IVLNSLGINPYRVFTQDNFFSNEKTKAVIA--PEVVARQGTLDELGRLIA---SYGVKVKVNHASDTNIE
3banA           -------KKDPVTLEEIKAIPGMQGIVTA-VYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHED
3ecdA           ---------DYDQVEALAQQHKP---SLIIAGFSAYPRKLDF---ARFRAIADSVGAKLMVDMAHIAGVI
2a7vA           RIMKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDY---ARMREVCDEVKAHLLADMAHISGLV
2btwB           IVLNSLGISPYRVFTQDNFFSNEKTKAVIA--PEVVAKQGTLDELGRLIA---SYGVKVKVNHASDTNIE
3e77A           HPKLGSYTKIPDPS-TWNLNPDASYVYYCAN-ETVHG--------VEFDFIPDVKGAVLVCDMSSNFLSK
2cinA           DAPYMRPGLDEPAMAEALRQARAAFCFVAEPIQGEGGDRHFRPEFFAMRELCDEFDALLIFDEVQTG--C
3d19A           ET-------DPEQIKRFNAEVQQA----ATNIWGFKRKILGLILTCKLPG---QNNFPLLVDHTSREADY
3bcxA           FVDVDIPTYNVNASLIEAAVSDKTK---AIMIAHTLGNLFDLAEVRRVAD---KYNLWLIEDCCDALGST
2bwpB           IFRHN----DVAHLRELIAADDPAALIAFESVYSMDGDFGPIKE---ICDIAEEFGALTYIDEVHAVGMY
3e77C           HPKLGSYTKIPDPSTWNL-NPDASYVYYCANETVHGVEFDFIPDVKGAV---------LVCDMSSNFLSK
2dgmA           EIPMRPGQLFMDRMIEACDENT--IGVVPTFGVTYTGNYEFPQDALDKFQADTGIDIDMHIDAASGGFLA
1agxA           IVYGSDN-MMPDAYQAFAKAGVK--AIIHAGTGNGSMANYLV---PEVRKLHDEQGLQIVRSSRVAQGFV
1eghA           NAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDV---KALLRLATVWNIPVATNVAT-----
1bs0A           RFAHN----DVTHLARLLASPCPGQMVVTEGVFSMDGDSAPL---AEIQQVTQQHNGWLMVDDAHGTGVI
3ecdD           ------DTMLID-YDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIAD---SVGAKLMVDMAHIAGVI
3bn1A           DNDPRTFNLDAAKLEALI-TPRTKAIMPV----HLYGQICDM---DPILEVARRHNLLVIEDAAEAVGAT
3dr4C           DNDPRTFNLDAAKLEALIT-PRTKAIMPVHLYGQICD-------MDPILEVARRHNLLVIEDAAEAVGAT
1djeA           RFAHN----DVTHLARLLASPCPGQMVVTEGVFSMDGDSAPL---AEIQQVTQQHNGWLMVDDAHGTGVI
1ei7A           KVYRYNAVPLVTALLGA--FDTRNRIIEVENQANPTTAETLDATRRVDDATVAIRINNLIVELIRGTGSY
2cy8A           LLIRPDDIEGMREVFANH-GSDIAAFIAEPVG-SHFGVTPVSDSFLREGAELAQYGALFILDEVISGFRV
3d19E           ETDPE----QIKRFNAEVQQA-------ATNIWGFKRKILGL---ILTCKLPGQNNFPLLVDHTSREADY
1cj0A           KVNPDTGYIDYDRLEENARLFHPKLIIAGTSC---YSRNLDY---GRLRKIADENGAYLMADMAHISGLV
1cj0B           KVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDY------GRLRKIADENGAYLMADMAHISGLV
3e6gD           GLDFSFDLTDPAAFKAAIR-ADTKMVW-IETPTNPMLKLVDI---AAIAVIARKHGLLTVVDNTF-----
3e6gB           GLDFSFDLTDPAAFKAAIR-ADTKMVW-IETPTNPMLKLVDI---AAIAVIARKHGLLTVVDNTF-----
3a2bA           KYGH----NNMEDLRAKLSRLPEDSAKLICGIFSMEGDIVNLPE---LTSIANEFDAAVMVDDAHSLGVI
3d46A           AGMMVTSGEHHGT-LQSFRTLAETGIDIMQPDVGWCGGLTTL---VEIAALAKSRGQLVV----------
3cxmA           ALQRMSHLPHWQLPLN------------------------------------------------------
3bzsA           ----------------LANNIKKSTV-IVKDPTHIAICLYYKLGETPLPLVIELYDIPVIEDIPLARSLY


                         .         .         .         +         .         .         .:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2egyD           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2egyB           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
2egyC           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
3cbfA           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
3d6kC           SDEFPIVHNVIEFAQGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3d6kB           SDEFPIVHNVIEFAQGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3d6kD           SDEFPIVHNVIEFAQGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3dc1A           NKFRVPTFLSM----DVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
3d6kA           SDEFPIVHNVIEFAQGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQ
3ei6A           DDNPRSIFEIPGA---EEVAMETASFSKYAGTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
3ei8A           DDNPRSIFEIPGA---EEVAMETASFSNYAGTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
3ei6B           DDNPRSIFEIPGA---EEVAMETASFSKYAGTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
3dc1B           NKFRVPTFLSM----DVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
3dydA           SDCKYEPLATLST---DVPILSCGGLAKRWVPGWRLGWILIHDRRDIFGNEIRDGLVKLPCTIVQGALKS
2douB           EGEAPSPLALPGA---KERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVE
3ei9A           DDNPRSIFEIPGA---EEVAMETASFSNYAGTGVRLGWTVIPKKLLYSDGFPVAKDFNGASNISQAGALA
5bj4A           EGEHFSPGR----VAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
1cl1B           ------------KALDFGIDVSIQAATYLVGSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSR
1cl1A           ------------KALDFGIDVSIQAATYLVGSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSR
3ei7B           DDNPRSIFEIPGA---EEVAMETASFSKYAFTGVRLGWTVIPKKLLYSDGFPICTCFNGASNISQAGALA
2douA           EGEAPSPLALPGA---KERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVE
3dc1D           NKFRVPTFLSM----DVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMIHE
1bw0B           KGKDPNATFTSVADFETTVRVILGGTANLVVPGWRLGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVGE
1djuA           DDARHYSIASLD--GMFERTITVNGFSKTFATGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAK
3ei7A           DDNPRSIFEIPGA---EEVAMETASFSKYAGTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
3dydB           SDCKYEPLATL---STDVPILSCGGLAKRWLPGWRLGWILIHDRRDIFGNEIRDGLVKLPCTIVQGALKS
3bmaD           VNYD------------KHVAKYLKILPDQFSQAIEDVVKAD-----------------------------
3bwnC           -------------------DIMLFTFSITGHAGSRIGWALVKDKEVAKKMEYIIVNSIGVSKESQVRTAK
3e2yA           TGHTHVKIATLPGM--WERTITIGSAGKTFSTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAE
5bj3A           E----GEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
3ei9B           DDNPRSIFEIPGA---EEVAMETASFSNYAGTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
3e2fA           TGHTHVKIATLPGMWE--RTITIGSAGTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAFWID
2e7jA           P----------VSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSEKYKLLGCTARGATIIT
3eiaA           DDNPRSIFEIPGA---EEVAMETASFSQYAGTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
1bjwA           EGEHFSPGRVAPEH-----TLTVNGAAAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
1b8gB           SSPSFISVMEVLKDRNCQRVHVVYSLSKDLGPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAM
1aamA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKAAIDANYSNPPAI
3cogB           -----------QRPLALGADISMYSATKYMNHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLC
1b8gA           SSPSFISVMEVLKDEVWQRVHVVYSLSKLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAM
1bw0A           KGKDPNATFTSVADFETTVRVILGGTANLVVPGWRLGWLLYVDPHGNGPSFLEGLKRVGPCTVVQAALGE
3bwoC           ---------------RQDHDIMLFTFSITGHAGSRIGWALVKDKEVAKKMVEYIIVSIGVSKESQVRTAK
1d2fB           GEQPHIPWSNVARGD---WALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALHI
1ajsA           GNLEKDAWAIRYFVSEGFELFCAQSFSKNFGYNERVGNLTVVAKEPDSILRVLSQMQSNPPAQGARIVAR
3eiaB           DDNPRSIF---EIPGAEEVAMETASFSQYAGFGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALA
3b46B           TDSFTR--IATLSPEIGQLTLTVGSAGSFAATGWRIGWVLSLNAELSYAAKAHTRICFASPSPLQEACAN
1b5pA           E----GEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLE
1c7nA           PGYEHTVFQSIDEQL-ADKTITFTAPSKTFNAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKCE
1aiaA           GLEEDAEGLRAFAAM-HKELIVASSYSHNFGYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPATI
2drrA           IGLDAEWFGGSEWS--AEEINKIQAFFADKEEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDG-P
1c4kA           FIPMMRNSSIDDLGPEDPGIIVVQSVHKQQAGFSQTSQIHKKDSHIKGQLRYCDHKHFTSPFYPMYALDV
3cq5A           SPSATTLL-----EKYPTKLVVSRTMSKAFDAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVAL
2cstA           GSLDKDAWAVRYFVSEGFELFCAQSFSKNFLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPRIV
3b5oA           FFSKHLDAGLRTSV---AAYIQPEEFGEF-AAGFRAIDAQVWWQELAQEAI-------------------
3dzzB           TDEDITPAFTVDWD--AKNWVVSLISPTFNLAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAA
1ay4A           GLEEDAAGTRLI-ASRIPEVLIAASCSKNFGYRERTGCLLALCADAATRELAQGAMAFLNRQTYTVLTTP
1djuB           DDARHYSIASLDGMFE--RTITVNGFSKTFMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAK
3drdA           TGKMFACEH-------ENVQPDLMAAGKGITGYLPIAVTFATEDIYKAFYDDYHGHSYTGNQLGCAVALE
1dtyA           TGKLFACEH-------AEIAPDILCLGKALTGTMTLSATLTTREVAETISDGEAGCFMHGPTFMGPLACA
2e7uA           AFGGATEL--------LGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAE
3cq6A           SPSATTLLEKYPTK-----LVVSRTMSAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVAL
1b5oA           EGEHFSPGRVAP----EHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
1bkgA           EGEHFSPG----RVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
1c8nA           AWYSTIGTAAFAAL--TAFDQNQFCPCTVHISDGGPAVAVPPGDIFFKY---------------------
1akaA           GDINRDAWALRHFIEQGIDVVLSQSYAHNMLYGERAGAFTVICRDAEEAKRVESQLKINPPMNGARIASL
2bwnD           GPRGAGVAER------DGLMHRIDIFNGTLAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPQASIAF
3bwoA           -----------------DHDIMLFTFSITGHAGSRIGWALVKDKEVAKKMVYIIVNSIGVSKESQVRTAK
7aatA           GDINRDAWALRHFIEQGIDVVLSQSYAKNMGYGERAGAFTVICRDAEEAKRVESQLKILIRPMYLILNTP
1d2fA           GEQPHIPWSNVARGD---WALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALAH
3aatA           GLEEDAEGLRAFAAM-HKELIVASSYSKFGLYNERVGACTLVAADSETVDRAFSQMKANPPAHGASVVAT
2aatA           GLEEDAEGLRAFAAM-HKELIVASSYSANFGYNERVGACTLVAADSETVDRAFSQMKAAPPAHGASVVAT
1asfA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKAAIRANYTILSND
1arsA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFLYNERVGACTLVAADSETVDRAFSQMKAAPPAHGASVVAT
1ay5B           GLEEDAAGTRLIAS-RIPEVLIAASCSKNFGYRERTGCLLALCADAATRELAQGAMAFLNRQTYTVLTTP
3bwnF           ----------TPITRRQDHDIMLFTFSKITGAGSRIGWALVKDKEVAKMVEYIIVNSIGVSKESQVRTAK
2e54A           TGKLFAYQK-------YGVVPDVLTTAKGLGGGVPIGAVIVNERANVLEPGDHGTTFGGNPLACRAGVTV
3cogD           Q-----------RPLALGADISMYSATKYMNHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLC
3dzzA           TDEDITPAFTVDWD--AKNWVVSLISPSTFNAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAA
1ay4B           GLEEDAAGTRLIASR-IPEVLIAASCSKNFGYRERTGCLLALCADAATRELAQGAMAFLYSFPPFHGAKI
2d64A           GLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAPPAHGASVVAT
1dgdA           TGTMFACQR-------DGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTSDPLPAAVGLR
2aeuA           LLFNQPPALKLGA------DLVVTSTDKLM-EGPRGGLLAGKKELVDKIYIEGTKFGLEAQPPLLAGIKN
3cq4B           SPSATTL-----LEKYPTKLVVSRTMSKAFFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVAL
1bqaA           GLEEDAEGLRAFAAMHK--ELIVASSYSNFGYNERVGACTLVAADSETVDRAFSQMKAAIRANYTILSND
1asbA           GLEEDAEGLRAFAAM-HKELIVASSYSKFGLYNERVGACTLVAADSETVDRAFSQMKANPPAHGASVVAT
3bwnB           TP----------ITRRQDHDIMLFTFSKITGAGSRIGWALVKDKEVAKKMVYIIVNSIGVSKESQVRTAK
3dxvA           SGRLHCFEH-------EGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPISAAAGLAV
2eh6A           TGEFYAYQH-------FNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTV
3bwnE           ----------TPITRRQDHDIMLFTFSKITGAGSRIGWALVKDKEVAKKMVEIIVNSIGVSKESQVRTAK
2d61A           GLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKASPPAHGASVVAT
2bhxB           PLKVNQFGMIYAG---AQKNLGPSGVTVVIVKKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNV
3cq5B           SPSATTLL-----EKYPTKLVVSRTMSKAFDAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVAL
2aevA           LLFNQPPALKLGA------DLVVTSTDL--MEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPPLLAGIYR
1e5eB           T-----------NPVDFGVDVVVHSATKYINHTDVVAGLICGKADLLQQIRMVGIKDITGSVISPHDAWL
2d5yA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKAAPPAHGASVVAT
1e5eA           T-----------NPVDFGVDVVVHSATKYINHTDVVAGLICGKADLLQQIRMVGIKDITGSVISPHDAWL
1ajrA           GNLEKDAWAIRYFVSEGFELFCAQSFSNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIWSNPPAQGARI
1czcA           GLEEDAEGLRAFAAMHKE-LIVASSYSKFGLYNERVGTCTLVAADSETVDRAFSQMKAAPPAHGAILGND
1ariA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKANPPAHGASVVAT
1bqdA           GLEEDAEGLRAF-AAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYTILSND
1aheA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKASPPAHGASVVAT
1arhA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKANPPAHGASVVAT
3cq4A           SPSATTLLEK-----YPTKLVVSRTMSKAFDAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVAL
1ax4A           YFIKARDPKYKNATI-KEVIFDMYKYADALTSAKDPLLNIGGLVAIRDNEEIFTLARQRYGGLAGRDMAA
1b4xA           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKAAIRANYSILSND
3b46A           TDSFTRIATLSPEIGQL--TLTVGSAGSFAATGWRIGWVLSLNAELSYAAKAHTRICFASPSPLQEACAN
2dr1B           DIKFDKWGLDVVFSSGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYL-KEKESTPSTPPMPQVFGINV
2bwoD           GPRGAGVAERDGLMHRI--DIFNGTLAKAYVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAQASIAF
2bwnA           GPRGAGVAER------DGLMHRIDIFNGTLAYGVFGGYIAASARMVDAVRSYAPGFIFSTS--LPPAIAA
3bwoE           YWPHYTPI-----TRRQDHDIMLFTFSITGHAGSRIGWALVKDKEVAKKMVEYIVNSIGVSKESQVRTAK
2bwpA           GPRGAGVAERDGLMHRI--DIFNGTLAKAYGFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAQASIAF
1eg5A           KIP--------FSLEKLEVDYASFSAHKFHGPKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIV
3bv0B           TGALFAADH-------AGVSPDIMCVGKALTGYLSLAATLCTADVAHTISAGPTFMANPLACAVSVASVE
2bwoB           GPRGAGVAERDGLMHRI--DIFNGTLAKAYGFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAQASIAF
1d7uA           TGTMFACQR-------DGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAADV
3bwoD           YWPHYTPI-----TRRQDHDIMLFTFSITGHAGSRIGWALVKDKEVKKMVEYIIVNSIGVSKESQVRTAK
2bwoA           GPRGAGVAER------DGLMHRIDIFNGTLAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPQASIAF
3bwnA           TPI----------TRRQDHDIMLFTFSKITGAGSRIGWALVKDKEVAKKMVEYIIVNSIGVILNVLKETC
3bwoB           YWPHYTPI-----TRRQDHDIMLFTFSITGHAGSRIGWALVKDKEVAKKMVEYIVNSIGVSKESQVRTAK
2bwnE           GPRGAGVAERDGL------MHRIDIFNGTLAAGVFGGYIAASARMVDAVRSYAPGFIFSTS--LPPAIAA
3bwoF           YWPHYTPITRR-----QDHDIMLFTFSITGHAGSRIGWALVKDKEVKKMVEYIIVNSIGVSKESQVRTAK
3bwnD           TP----------ITRRQDHDIMLFTFSKITGAGSRIGWALVKDKEVKKMVEYIIVNSIGVSKESQVRTAK
2d66A           GLEEDAEGLRAFAAM-HKELIVASSYSKNFGYNERVGACTLVAADSETVDRAFSQMKASPPAHGASVVAT
2dkjA           AAGLHPNPLPYA-------HVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKA
2dr1A           DIKFDKWGLDFGVPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVFGINVA
3caeA           EPKKEVPFDRLKRK--------------------------------------------------------
2bwnB           GPRGAGVAER------DGLMHRIDIFNGTLAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGA
1c7gA           YFIKEQEAGYKDIVHEMFSYADGCTMSGKKDLVNIGGFLCMNDEEMFSAAKELVVVYEGLAGRDMEAMAI
3bn1D           YRGKKSGSLGDCATFSFFGNIITGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIG
2c0rA           PFDLNQFGLVYAGAQKNLGPSGVTV-VIVREDLVAESPKHLPTMLRYDTYVKNNSLYNTPPSFGIYMVNE
3bcaA           KCMHLIQQGARVGRI----DAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLL
1ecxB           KIPFSLEKLEV--------DYASFSAHKFHGKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVG
1bj4A           AAGVVPSPFEHCHKTLRGCRAGMIFYRKGVKSVDPATGKEILYNLESLINSAVFPGLQGGPHNHAIAVAV
2dgkC           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAFLRLG
3dr4A           YRGKKSGSL-------GDCATFSFFGNAIITDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIG
2dgmB           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIVIAQYYEFL
3bcbA           KCMHLIQQGARVGRI----DAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLL
2c44A           YFIKQREAEYKDITRETYKYADMLAMSAKKDMVPMGGLLCMKDDSFFDVYLCVVQEGFPTYGGLEGAMER
2c44B           YFIKQREAEYKDWTIEQYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLCVVQEGAMERLAVGL
2cfbA           AYGGAQEKFGV--------TPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPTLSGNPLAMTAGIKTL
2dgmC           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAIYEFL
2cb1A           L----------CRPLAWGAHVVVESLTWASHGSVLGGAVLSRETELWRNYPQFLQPWEALRARCFPERVR
2bieB           PLKVNQFGMI---YAGAQKNLGPSGVTVVIVKKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNV
3dr4B           YRGKKSGSL-------GDCATFSFFGNAIITDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIG
1cs1A           QNPLA-----------LGADLVLHSCTYLNGSDVVAGVVIAKDPDVTELAWWANNIGVTGGAFDSYLLLR
1b9iA           WQGKRVGELDS-------IATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPRDDRRYFHKI
2c81A           WNNQRAGTIGDIG-------AFSCQQGKVLTAGEGGIIVTKNPRLFELIQQLRADSRVYCDDSSELMHGD
2dgmE           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAYEFLR
2c44C           YFIKQREAEYKDITRETYKYADMLAMSAKKDMVPMGGLLCMKDDSFFDVYTECRTLCVVQEAMERLAVGL
2ch1A           PFYMDKWEIDAVYTGITPISISPKALDVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKHTVASNLIFALRE
2bieA           PLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQ-YATHIKSDSLYNTPPTFSIYMLRN
1c0nA           PVDVQ----------ALDCDFYVFSGHKLYPTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTK
1b9hA           WQGKRVGELDSI-------ATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPRDDRRYFHKI
3dr4D           YRGKKSGSL-------GDCATFSFFGNAIITDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIG
1dfoB           AAGVYPN------PVPHAHVVTTTTHKTLAGRGGLILAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKA
3dxvB           SGRLHCFEHEG-------FVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPISAAAGLAV
3caiA           LL----------DIRETDADVVTVNAHAWG-GPPIGAMVFRDPSVMNSFGSVSTNPYATGPARLEIGVHQ
3b8xA           FNNKC---------AGTFGLMGTFSSFYSNHATMEGGCIVTDDEEIYHILLCIRAHGWTRNLPKKNKVTG
2d3jA           ----------------------------------------------------------------------
1ejjA           RNETFLAAMNHVKQH-GTSLHLFGLLSDGGVSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGP-----
2dgkA           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIVIAQYYEFL
3bc8A           KCMHLIQQGARVGRI----DAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLL
3bcxB           YDGKMAGTF--------GDIGTVSFYPAHHITMGEGGAVFTQSAELKSIIESFRDWGRDCLGSLPFGYDH
1bjnA           PIDVSRYGVIYAGAQNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGFKW
3ecdC           AAGRHANPVEHA-------HVVTSTTHKTL-RGPRGGFVLTNDEEIAKKINSAVGPLMHVIAGKAVAFGE
2c7tA           WNNQRAGTIGDI-------GAFSCQQGKVL-TAGEGGIIVTKNPRLFELIQQLRADSRVYCDDSSELMHG
3bs8A           DYNCAQGYFGV--------TPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTA
3ecdB           AAGRHANPVEHA-------HVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGPLMHVIAGKAVAFG
3e9kA           ELYLHDWGVDFACWCSYKIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCS
3bb8A           Y---------DGKMAGTFGDIGTVSFYPAKHTMGEGGAVFTQSAELKSIIESFRDWGRDCQLGSLPFGGL
2bkwA           EFEFDEWGVDFAAGLSISLCSSDYALNDSKNGHVHGYFSSLRRWTPIENYEAGKGAYFATPPVQLINSLD
3bn1C           YRGKKSGSLDCATFSFFGNIITTGEGGMITTDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAGL
1bjoA           ------------PIDVSRYGVIYAGAQKNI-GPAGLTIVIVREDLLGKANIACPSILDYPPTFAWYLSGL
3b8xB           FNNKCAGTFGLM-------GTFSSFYSNHI-ATMEGGCIVTDDEEIYHILLCIRAHGWTRNLPKKNKVTG
1ejiA           GVVPSPFVVTTTTHKTLRGCRAGIFYRKGVRSVDPKTGKETYYELESLINSAVFPGLQGGPHNHAIAGVA
3dpnA           LTLLENVDTNVES------RLALGDNMEGYTDLQVAEYLKSFGRQVLNCWSKGDIELSTPIPLFGEKIHP
3dr7B           YRGKKSGSLGDCATSFFGNIITTGEGGMITTDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQIGL
2btwA           DFRKQVAENLKQDGNF----VIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIDVSRYKYPPVWVKTTD-
3banA           IKQGKPNRDALIENYVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGST----------------------
3ecdA           AAGRHANPVEHA-------HVVTSTTHKTL-RGPRGGFVLTNDEEIAKKINSAVFGPLMHVIAGKAVAFG
2a7vA           AAKVIPSPF-------KHADIVTTTTHKTLRGA-RSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFP
2btwB           DFRKQVAENLKQDGN----FVIVNYLRKEI-GQERGGHISPLAAYNEQTDRFLIDVSRYKYPPVWVKTTD
3e77A           PVDVSKFGV---IFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQNSSLYNTPPCFSIYVMGL
2cinA           GLTGTAWAYQQ-----LDVAPDIVAFGKKTQVCVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARR
3d19A           FRKRLIQLNEGKLDAL--PDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSNDFDELMYQAI
3bcxA           YDGKMAGTFGHHITMGEGGAVFTQSIIESFRDWGRDCYCLGSLPFGYDHKYTYSHLGYNLKITDMQAACG
2bwpB           GPAGVAERDGLMHRI----DIFNGTLAKAYGV--FGGYIAASARMVDAVRSYAPGFIFSTSL--PPAIAA
3e77C           PVDVSKFGVIFAGAQKNVGSAGVTVVIVR-DDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGL
2dgmA           PFVAPDIVWDFRL---PRVKSISASGHKFGLPLGCGWVIWRDEEALPQELVFNVDYLGGQIVIAQYYEFL
1agxA           LRNAEQPDDKY-----GWIAAHDLNPQKARLMALALTKTNDAKEIQNMF---------------------
1eghA           ADFIIQSPHFN-----DAVDILIPDYQRYLAD--------------------------------------
1bs0A           G----EQGRGSCWLQKVKPELLVVTFGKGF--GVSGAAVLCSSTVADYLLQFARHLIYSTSMP--PAQAQ
3ecdD           AAGRHANPVEHA-------HVVTSTTHKTLRGP-RGGFVLTNDEEIAKKINSAVGPLMHVIAGKAVAFGE
3bn1A           ----------------------------------------------------------------------
3dr4C           ----------------------------------------------------------------------
1djeA           G----EQGRGSCWLQKVKPELLVVTFGKGFGVSGA---AVLCSSTVADYLLQFARHLIYSTSMPPAQAQA
1ei7A           NRSSFESSSGL-----------------------------------------------------------
2cy8A           GNHGMQALLDV--------QPDLTCLAKASAGGLPGGILGGREDVMGVLSRGSFTGNPITAAAAIAAIDT
3d19E           FRKRLIQLNEGKLDAL--PDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSNDFDELMY---
1cj0A           VAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRGVRSVDILYNLSLINSAVFPGLQGGPHNHAIAGVA
1cj0B           VAGVVPSPFEHCHTTTTHKTLRGCRAGMIFYRRGVRSVDKEILYNLESLINSAVFPGLQGGPHNHAIAKQ
3e6gD           ------ASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQ------------------
3e6gB           ------ASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQAFLQNSIGGVQGPFDSFL
3a2bA           GHAGTASHFGLNDDV----DLIMGTFSK------------------------------------------
3d46A           ----------------------------------------------------------------------
3cxmA           ----------------------------------------------------------------------
3bzsA           KNIHKGQ---YITEDFFEPVAQLIRI--------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2egyD           LLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2egyB           LLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
2egyC           LLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
3cbfA           LLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
3d6kC           FFGDVAGLKAHLKHAASLAPKFERVLEILDSRLSEAKWTSPTGGYFISVDVVPGTASRVVELAKEAGIAL
3d6kB           FFGDVAGLKAHLKHAASLAPKFERVLEILDSRLSEAKWTSPTGGYFISVDVVPGTASRVVELAKEAGIAL
3d6kD           FFGDVAGLKAHLKHAASLAPKFERVLEILDSRLSEAKWTSPTGGYFISVDVVPGTASRVVELAKEAGIAL
3dc1A           LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVGINDVKELIEEKAVKMGVL
3d6kA           FFGDVAGLKAHLKHAASLAPKFERVLEILDSRLSEAKWTSPTGGYFISVDVVPGTASRVVELAKEAGIAL
3ei6A           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
3ei8A           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
3ei6B           CLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYG---GKNAPYVWVHFPNQSSWDVFAEILEKTHVV
3dc1B           LLHEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVGINDVKELIEEKAVKMGVL
3dydA           ILCRTPGEFYHNTLSFLKSNADLCYGALAAIPG--LRPVRPSGAMYLMHFPEFENDVEFTERLVAEQSVH
2douB           ALKTP-----KEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVA
3ei9A           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
5bj4A           ALTNQ-EASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1cl1B           GLRTL--GVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFDNFSLFSMA
1cl1A           GLRTL--GVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSELANYLDNFSLFSMA
3ei7B           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
2douA           ALKTP-----KEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVA
3dc1D           WGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVGINDVKELIEEKAVKMGVL
1bw0B           ALLNTPQEHLDQIVAKIEESAMYLYNHIGECIG--LAPTMPRGAMYLMSRIDIKTDVEFFEKLLEEENVQ
1djuA           ALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPT--VKPKGAFYIFPRITGLTSKKFSELMLKEARVA
3ei7A           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
3dydB           ILCRTPGEFYHNTLSFLKSNADLCYGALAAI--PGLRPVRPSGAMYLMVGIEMEHFPEFFTERLVAEQVH
3bmaD           ----------------------------------------------------------------------
3bwnC           ILNVLKETCKSESESENFFKYEKLREVVKESDAFTLPKYPEAFCNYFGKSLEGTKEETDLVSELRRHKVM
3e2yA           AFWIDIKRMDDPECYFNSLPKEVKRDRMVRLLNSGLKPIVPDGGYFIIADVSSPYDYKFVKWMTKHKKLT
5bj3A           ALTNQEASRAFVEMAREAYRRRRDL-LLEGLTALGLKAVRPSGAFYVLDTSPIAPDEVRAAERLLEAGVA
3ei9B           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
3e2fA           IKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIV--PDGGYFIIADSDEPYDYKFVKWMTKHKKLT
2e7jA           LMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKLGDNPHNHDLMFFHAEVLYEISKKAKGGRFFLYRE
3eiaA           CLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYG---GKNAPYVWVHFPNQSSWDVFAEILEKTHVV
1bjwA           ALTNQ-------EASRAFVEMAREAYRRRRDLLLELKAVRPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
1b8gB           LSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSG--ISCLNGNAGLFCWVDMRFEAEMELWKKIVYEVHLN
1aamA           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
3cogB           NRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLA
1b8gA           SDKKLTKNYIAENHKRLKQRQKKLVSGLQ---KSGISCLNGNAGLFCWVDMRFEAEMELWKKIVYEVHLN
1bw0A           ALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAP--TMPRGAMYLMSRIDIKTDVEFFEKLLEEENVQ
3bwoC           ILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYKEETDLVSELRRHKVM
1d2fB           AAYQQGAPWLDALRIYLKDNLTYIADKM-NAAFPELNWQIPQSTYLAWLDLPLNIDDNALQKALIEQKVA
1ajsA           TLSDP---ELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHGMFSFTGLNPKQVEYLINQKHIY
3eiaB           CLTPEGLEAMHKVIGFYKENTNIIIDTFTS---LGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVV
3b46B           SINALKIGYFEKMRQEYINKFKIFTSIFDE---LGLPYTAPEGTYFVLVDFSKGKDFRISHWLINELGVV
1b5pA           ALTNQ-------EASRAFVEMAREAYRRRRDLLLELKAVRPSGAFYVLDTSPIAPDEVRAAERLLEAGVA
1c7nA           ICYKECGKWLDGCIKVIDKNQRIVKDFF-EVNHPEIKAPLIEGTYLQWFRALKMDHKAMEEFMIHKAQIF
1aiaA           LSNDALRAIWEQELTDMRQRIQRMRQLFVNTLNRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
2drrA           YAKAN--VDLFWNTPVRTGNRRYYDNCL-----YLFAMLALSGNFKIWF---------------------
1c4kA           NAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAK
3cq5A           RHSADT----LGTVEKLSVERVRVAARLEELGYAVV---PSESNFVFF---GDFSDQHAAWQAFLDRGVL
2cstA           ATTLTSPQLFAEWKDNVKTMADRVL-LMRSELRSRLESLGTPGTWNHIMFSFTGLNPKQVEYMIKEKHIY
3b5oA           ----------------------------------------------------------------------
3dzzB           IAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLDSNASYLAWVDIALGNAEDFCKYLREKTGLI
1ay4A           ELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDFGFVAEHRGMFSRLGA-----TPEQVKRIKEEFGI
1djuB           ALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPT--VKPKGAFYIFPRIRDTGLTSKKFSELMEARVA
3drdA           NLALFESENIVEQVAEKSKKLHFLLQDLHALPH--VGDIRQLGFMCGAELVRSKEKEPYPADRRIGYKVS
1dtyA           AANASLAILESGDWQQQVADEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVW
2e7uA           LLEE--NPGYYAYLEDLGARLEAGLKEVLKEKGLPVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIY
3cq6A           RHSADT----LGTVEKLSVERVRVAARL-EELG--YAVVPSESNFVFF---GDFSDQHAAWQAFLDRGVL
1b5oA           ALTNQ-------EASRAFVEMAREAYRRRRDLLLELKAVRPSGAFYVLDTSPIAPDEVRAAERLLEAGVA
1bkgA           ALTNQ-------EASRAFVEMAREAYRRRRDLLLELKAVRPSGAFYVLDTSPIAPDEVRAAERLLEAGVA
1c8nA           ----------------------------------------------------------------------
1akaA           LNTPELRKEWLVEVKGMADRIISMRTQLKEGSSHNWQHITDQIGMFCF----TGLKPEQVERLTKEFSIY
2bwnD           LKTAEG----QKLRDAQQMHAKVLKMRLKALGMPII---DHGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
3bwoA           ILNVLKETCKSESESENFFKYGREMMKNRWEKAFTLPKYPEAFCNYFGKSLEGTKEETDLVSELRRHKVM
7aatA           ELRKEWLVEVKGMADRIISMRTQLVSNLKEGSSHNWQHITDQIGMFCF----TGLKPEQVERLTKEFSIY
1d2fA           IAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYWLDLRPLNIDDNALQKALIEQEKVA
3aatA           LSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
2aatA           ILNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1asfA           ALRAIWEQELTDMRQRIQRMRQLFVNTLEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1arsA           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1ay5B           ELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDFGFVAEHRGMFSRLGA-----TPEQVKRIKEEFGI
3bwnF           ILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGFAWLGTKEETDLVSELRRHKVM
2e54A           IKELTKEGFLEEVEEKGNYLMKKLQEMKEEY---DVVADVRGMGLMIGIQFREEVSNREVATKCFENKLL
3cogD           NRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTAEIFLKNLKLFTLA
3dzzA           IAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLDSNASYLAWDISALGNAEDFCKYLREKTGLI
1ay4B           VSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVMFSRLGATPE-QVKRIKEEFGI
2d64A           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFTIKQNGMFFF----GGLTKEQVLRLREEFGVY
1dgdA           VLDVVQRDGLVARANVMGDRLRRGLLDLMERFD-CIGDVRGRGEIVKDRRTKEPADGLGAKITRECMNLG
2aeuA           FNLERIRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPTGFVIKRVYKDDTINIIGFNLLKNYGI
3cq4B           RHSADT----LGTVEKLSVERVRVAARLEELGYAVV---PSESNFVFFGD------QHAAWQAFLDRGVL
1bqaA           ALRAIWEQELTDMRQRIQRMRQLFVNTLEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1asbA           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
3bwnB           ILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLEGTKEETDLVSELRRHKVM
3dxvA           LETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCEPARAETAKLIYRAYQLGLV
2eh6A           VVDE---------VEKLLPHVREVGNYF-KEKLKELGKGKVKGGLMLGLELER--ECKDYVLKALEKGLL
3bwnE           ILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPEETDLVSELRRHKVM
2d61A           ILNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
2bhxB           LDWIKDLGGAEAIAKQNEEKAKIIYDTIDES--NGFYVGHAEKGSRSLMNLRNEELNQQFLAKAKEQGFV
3cq5B           RHSADT----LGTVEKLSVERVRVAARLEELGYAVV---PSESNFVFF---GDFSDQHAAWQAFLDRGVL
2aevA           ALKERIRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPTGFVIKRVYKDDTINIIGFNLLKNYGI
1e5eB           ITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYQMRMYGSMITFILKSGFEGAKKLLDNLKLITLA
2d5yA           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFTIKQNGMFFF----GGLTKEQVLRLREEFGVY
1e5eA           ITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYQMRMYGSMITFILKSGFEGAKKLLDNLKLITLA
1ajrA           VARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHIMFSFTGLNPKQVEYLINQKHIY
1czcA           ALRAIWEQELTDMRQRIQRMRQLFVNTLEKGANRDFSFTIKQNGMFFF----GGLTKEQVLRLREEFGVY
1ariA           LSNDALRAIWEQELTDMRQRIQRMRQLFVNTLNRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1bqdA           ALRAIWEQELTDMRQRIQRMRQLFVNTLEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1aheA           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
1arhA           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
3cq4A           RHSADT----LGTVEKLSVERVRVAARLEELGYAVV---PSESNFVFF---GDFSDQHAAWQAFLDRGVL
1ax4A           MVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCIPGDQFPAQAVINALYLESGVR
1b4xA           ALRAIWEQELTDMRQRIQRMRQLFVNTLQEGANRDFSFIIKQNGMFSFS----GLTKEQVLRLREEFGVY
3b46A           SINDALKIGYFEKMRQEYINKFKIFTSIFDELGL--PYTAPEGTYFVLVDFSKGKDFRISHWLINELGVV
2dr1B           ALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHEPTITAVLTPPGIKGDEVYEAMRKRGFE
2bwoD           LKTAEG--------QKLRDAQQMHAKVLKMRLKAGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
2bwnA           GAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIDPVHTKAVSDMLLSDYGVY
3bwoE           ILNENFFKYGREMMKNRWEKLREVVKESDAFTLPKYGKSLESYPAFAWLGTK---EETDLVSELRRHKVM
2bwpA           LKTAEGQKLRDAQQM----HAKVLKMRLKALGMPIID---HGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
1eg5A           GAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPLEISLPNTLSVS-FPNIRGSTLQNLLSGYGIY
3bv0B           LLLGQ------DWRTRITELAAGLTAGLDRALPA-VTDVRVCGAIGVI-ECDRPVDLAVATPAALDRGVW
2bwoB           LKTAEG----QKLRDAQQMHAKVLKMRLKALGMPIID---HGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
1d7uA           VQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDRRTKEDGLGAKITRECMNLGLS
3bwoD           ILNENFFKYGREMMKNRWEKLREVVKESDAFTLPKYGKSLESYPAFAWLGTK---EETDLVSELRRHKVM
2bwoA           LKTAEG----QKLRDAQQMHAKVLKMRLKALGMPII---DHGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
3bwnA           KSESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLEGTKEETDLVSELRRHKVM
3bwoB           ILNVSESENFFKYGREMMKNRWEKLREVVKESDAFFGKSLESYPAFAWLGTK---EETDLVSELRRHKVM
2bwnE           GAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIDPVHTKAVSDMLLSDYGVY
3bwoF           ILNVLKETCKSESESENFFKYKNRWEKLREVVKESFGKSLESYPAFAWLGTK---EETDLVSELRRHKVM
3bwnD           ILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGFAWLGTKEETDLVSELRRHKVM
2d66A           LSNDALRAIWEQELTDMRQRIQRMRQLFEKGANRDFSFIIKQNGMFSF----SGLTKEQVLRLREEFGVY
2dkjA           VAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGIT
2dr1A           LRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITAVLTPPGIKGDEVYEAMRKRGFE
3caeA           ----------------------------------------------------------------------
2bwnB           --QASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDGSHIVPVVIGDPVHTKAVSDMLLSDYGVY
1c7gA           GLREAMQYEYIEHRVKQVRYLGDKLREAGVPIVEPTGVFLDARRFCPHLTQDQFPAQSLAASIYMETGVR
3bn1D           LAQERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGLSTTRDQVIKDLDALGIE
2c0rA           VLKWIEERGGLEGVQQANRKKASLIYDAIDQSGG-FYRGCVDVDSRSDMRLASEELEKEFVKASEQEGFV
3bcaA           SLGSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDDKAVTQLGSMLFTRQVS
1ecxB           AARMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYGIY
1bj4A           ALKQAMTLEFKVYQHQVVANCRALSEALTEL--GYKIVTGGSDNHLILVDLSKGTDGGRAEKVLEACSIA
2dgkC           REGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQ
3dr4A           LAQLERVDEHLAARERVVGWYEQKLARLNRVTKPHVALTGRHVFWMYTVRLGLSTTRDQVIKDLDALGIE
2dgmB           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGGYTLYDLSERLRLRGWQ
3bcbA           SLCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHAVTQLGSMLFTRQVS
2c44A           LAVGLYDGMNLDWLAYRIAQVQYLVDGLVCQQAGGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIR
2c44B           YDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIR
2cfbA           EILSR--PGSYEHLDRITGKLVQGLLDAAREFG-HEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFA
2dgmC           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGGYTLYDLSERLRLRGWQ
2cb1A           TLGLSLCGMALSPFNAYLLFQGRFLAERLQGHPKVKALRYPGLPEDPAHRNARLGDLERASRFLGAIRLL
2bieB           LDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFV
3dr4B           LAQERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGLSTTRDQVIKDLDALGIE
1cs1A           GLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPARQQKGFGAMLSFELDGDEQTLRRFLGGLSLFTLA
1b9iA           AGSNMEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLP
2c81A           MQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSRQTYY
2dgmE           LGREGYTKVQNASYQVAAYLADEIAKLGPYEFTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQ
2c44C           YDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIR
2ch1A           ALAQIAEEGLENQIKRRIECAQILYEGLKMGLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAMNNFSL
2bieA           VLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESN-GFYVGHAEKGSRSLMNLRNEELNQQFLAKAKEQGFV
1c0nA           APWRFEAGTPNTG-------GIIGLGAALEYVSALLTLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIA
1b9hA           AGSNMRLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAIPGLTEERRNALVDRLVEAGLP
3dr4D           LAQERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGLSTTRDQVIKDLDALGIE
1dfoB           VALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANIT
3dxvB           LETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCEPARAETAKLIYRAYQLGLV
3caiA           FGLLAGVVASIEYLAALDESARGSRRERLAVSMQSVMLIGRPEAQIPVVSFVHKVPADRVVQRLADNGIL
3b8xA           VKSDDQFEESFKFVLPGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDVQQETGES
2d3jA           ----------------------------------------------------------------------
1ejjA           ----------------------------------------------------------------------
2dgkA           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGGYTLYDLSERLRLRGWQ
3bc8A           SLCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDDKAVTQLGSMLFTRQVS
3bcxB           KYTYSHLGYNLKITDMQAACGLAQLERIEEFVEATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVG
1bjnA           LKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNR--SRMNVPFQLADSALDKLFLEESFAAGLH
3ecdC           ALTDDF----KTYIDRVLANAQALGDVL-KAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGIT
2c7tA           DMQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNALSKIDGIKVMKRPPQVSRQTYY
3bs8A           GLKQLTPDSYKNFIKKGDRLEEGISKAAEAHGI--PHTFNRAGSMIGFFFTNEPVINYETAKASDLKLFA
3ecdB           EALT---DDFKTYIDRVLANAQALGDVL-KAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGIT
3e9kA           LHAEIFKQATMKALRKKSVLLTGYLEYLIKHNYGVVNIITPSHVRGCQLTITFSVPNKDVFQELEKRGVV
3bb8A           AQLERIEEFVEKRKANFKYLKDALQSCADFIEEATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVG
2bkwA           VALKEILEEGLHKRWDLHRESDWFKDSLVNGLQLTS--VSRYPSNSAHGLTVYVADPPDVIAFLKSHGVV
3bn1C           AQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGESTTRDQVIKDLDALGIE
1bjoA           VFKWLKANGGVAEMDKINQQKAELLYGVIDNSDRNDVAKRNRSRMNVPFQLADSALDKLFLEESFAAGLH
3b8xB           VKSDDQ----------------------------------------------------------------
1ejiA           VALKQATTEFKIYQLQVLANCRALSDALTELGY--KIVTGGSDNHLILDLRSKGTDGGRAEKVLEACSIA
3dpnA           HPRVQYSKPICVLINEQDFACADFFPVVLKDNDRAL--IVGTRTAGAGVQFPNRTGIAVREHGAFIENIG
3dr7B           AQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGLSTTRDQVIKDLDALGIE
2btwA           ----------------------------------------------------------------------
3banA           ----------------------------------------------------------------------
3ecdA           EALT---DDFKTYIDRVLANAQALGDVL-KAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGIT
2a7vA           SLKQACTPMFREYSLQVLKNARAMADAL-LERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVITA
2btwB           LWKAN-----------------------------------------------------------------
3e77A           VLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQG-FYVCPVEPQNRSKMFRIGNAKGDDALEKRFLD-KA
2cinA           ILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRG-LMCAFSLPTTADRDELIRQLWQRAVI
3d19A           ---DLESMKPQSQTAPLLDQFLDQNRVS-VASLRDFKKTAR--DLIEQCKIKSIIHPLLAD-HVFREADR
3bcxA           LAQLERIEEFVEKRKANFKYLKDALQSCADFIEATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVG
2bwpB           GAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLSDYGV
3e77C           VLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQ-GFYVCPVEPQNRSKMRIGNAKGDDALEKRFLDKALE
2dgmA           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGGYTLYDLSERLRLRGWQ
1agxA           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1bs0A           ALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGC-
3ecdD           ALTDDF----KTYIDRVLANAQALGDVL-KAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGIT
3bn1A           ----------------------------------------------------------------------
3dr4C           ----------------------------------------------------------------------
1djeA           LR-ASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGC-
1ei7A           ----------------------------------------------------------------------
2cy8A           ILEDDVCAKINDLGQFAREAMNHLFARKGLNWL--AYGRFSGFHLMPGLPPNTTDTGSITRAEVARPKMI
3d19E           ----------------------------------------------------------------------
1cj0A           VALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIA
1cj0B           AMTPEF-----KEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIA
3e6gD           ----------------------------------------------------------------------
3e6gB           ALR-------------------------------------------------------------------
3a2bA           ----------------------------------------------------------------------
3d46A           ----------------------------------------------------------------------
3cxmA           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FVPGGPFFANGGGENTLRLSYATLDREGIAExxxxxxxxxxxxxxxx
2egyD           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2egyB           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
2egyC           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
3cbfA           FVPGGPFFANGGGENTLRLSYATLDREGIAE----------------
3d6kC           TGAGSSFPLHNPNNENIRLAPSL------------------------
3d6kB           TGAGSSFPLHNPNNENIRLAPSLPPVA--------------------
3d6kD           TGAGSSFPLHNPNNENIRLAPSLPPVA--------------------
3dc1A           MLPGNAFYVDSSPSPYLRASFSSASPEQMDV----------------
3d6kA           TGAGSSFPLHNPNNENIRLAPSLPPVA--------------------
3ei6A           TTPGSGF--GPGGEGFVRVSAFG------------------------
3ei8A           TTPGSGF--GPGGEGFVRVSAFG------------------------
3ei6B           TTPGSGF--GPGGEGFVRVSAFG-HRENILE----------------
3dc1B           MLPGNAFYVDSSPSPYLRASFSSASPEQMDV----------------
3dydA           CLPATCF----EYPNFIRVVITV-PEVMMLE----------------
2douB           LAPGRGF--GPGGKGFVRIALVR------------------------
3ei9A           TTPGSGF--GPGGEGFVRVSAFG------------------------
5bj4A           VVPGTDF----AAFGHVRLSYAT-SEENLRK----------------
1cl1B           YSWGGYESLILANQPEHIAAIRPQGEIDFSG----------------
1cl1A           YSWGGYESLILANQPEHIAAIRPQGEIDFSG----------------
3ei7B           TTPGSGF--GPGGEGFVRVSAFG------------------------
2douA           LAPGRGF--GPGGKGFVRIALVR------------------------
3dc1D           MLPGNAFYVDSSPSPYLRASFSSASPEQMDV----------------
1bw0B           VLPGTIF----HAPGFTRLTTTRPVEV--------------------
1djuA           VVPGSAF--GKAGEGYVRISYAT------------------------
3ei7A           TTPGSGF--GPGGEGFVRVSAFG------------------------
3dydB           CLPATCF----EYPNFIRVVITV-PEVMMLE----------------
3bmaD           -----------------------------------------------
3bwnC           SRAGERC---GSDKKHVRVSMLSREDV--------------------
3e2yA           AIPVSAFCSKPHFEKLVRFCFIK------------------------
5bj3A           VVPGTDF----AAFGHVRLSYAT-SEENLRK----------------
3ei9B           TTPGSGF--GPGGEGFVRVSAFG------------------------
3e2fA           AIPVSAFCDSKSPHFEKLVRCFIKKDSTLDA----------------
2e7jA           LKSRKIHGIKPGLTRYFKLSTYGLSDEEVDY----------------
3eiaA           TTPGSGF--GPGGEGFVRVSAFG------------------------
1bjwA           VVPGTDF----AAFGHVRLSYAT------------------------
1b8gB           ISPGSSCHC--TEPGWFRVCFANLPERTLDL----------------
1aamA           AVASGRV----------------------------------------
3cogB           ESLGGFESAELPSDTLIRLSVGLEDEEDLLE----------------
1b8gA           ISPGSSCHC--TEPGWFRVCFANLPERTLDL----------------
1bw0A           VLPGTIF----HAPGFTRLTTTR------------------------
3bwoC           SRAGERC---GSDKKHVRVSMLSREDV--------------------
1d2fB           IMPGYTY--GEEGRGFVRLNAGC-PRSKLEK----------------
1ajsA           LLPSGRINM--CGLTTKNLDYVATSHEAVT-----------------
3eiaB           TTPGSGF--GPGGEGFVRVSAFG------------------------
3b46B           AIPPTEFYHEKAAENLLRFAVCKDDAY--------------------
1b5pA           VVPGTDF----AAFGHVRLSYAT-SEENLRK----------------
1c7nA           FDEGYIF--GDGGIGFERINLAAPSSV--------------------
1aiaA           AVASGRV----------------------------------------
2drrA           -----------------------------------------------
1c4kA           WHAYEGYGDNQYYVDPNK-----------------------------
3cq5A           IRDVGIA-------GHLRTTIGV------------------------
2cstA           LMASGRINMCGLTTKNLDYVAKSIHE---------------------
3b5oA           -----------------------------------------------
3dzzB           ISAGNGYRG--NGHEFVRINLAC------------------------
1ay4A           YMVGD-----------SRINIAGLNDNTIPI----------------
1djuB           VVPGSAF--GKAGEGYVRISYAT------------------------
3drdA           LKMRELGMLTRPLGDVIAFLPLASTAEELSE----------------
1dtyA           IRPFGKLI-------YLMPPYII-LPQQLQR----------------
2e7uA           WPPSNF--------EAAFLSVA-HREEDVEK----------------
3cq6A           IRDVGIA-------GHLRTTIGV------------------------
1b5oA           VVPGTDF----AAFGHVRLSYAT------------------------
1bkgA           VVPGTDF----AAFGHVRLSYAT------------------------
1c8nA           -----------------------------------------------
1akaA           MTKDGRI----------------------------------------
2bwnD           VQPIN-FPTVPRGTERLRFTPPVHDLKQIDG----------------
3bwoA           SRAGERC---GSDKKHVRVSMLSREDV--------------------
7aatA           MTKDGRI----------------------------------------
1d2fA           IMPGYTY--GEEGRGFVRLNAGC------------------------
3aatA           AVAS----------GFVNVAGMT------------------------
2aatA           AVASGRV----------------------------------------
1asfA           AVASGRV----------------------------------------
1arsA           AVASGRV----------------------------------------
1ay5B           YMVGD-----------SRINIAGLNDNTIPI----------------
3bwnF           SRAGERC---GSDKKHVRVSMLSREDV--------------------
2e54A           VVPAGNN--------TIRFLPLTVEYGEIDL----------------
3cogD           ESLGGFESLAELPAIMTHASVLKNDRDVLG-----------------
3dzzA           ISAGNGY--RGNGHEFVRINLAC------------------------
1ay4B           YMVGD-----------SRINIAGLNDNTIPI----------------
2d64A           AVASGRL----------------------------------------
1dgdA           LSMNIVQLPGMGGVFRIAPPLTVSEDE--------------------
2aeuA           ITITVAGM--PGASKSLRIDLTSRD----------------------
3cq4B           IRDVGIA-------GHLRTTIGV------------------------
1bqaA           AVASGRVNVAGMTPDNMAPLCEAIVA---------------------
1asbA           AVASGRV----------------------------------------
3bwnB           SRAGERC---GSDKKHVRVSMLSREDV--------------------
3dxvA           VYYVGMN----GNVLEFTPPLTITETD--------------------
2eh6A           INCTAGKVLR------FLPPLII-QKEHIDR----------------
3bwnE           SRAGERC---GSDKKHVRVSMLS------------------------
2d61A           AVASGRV----------------------------------------
2bhxB           GLNGHRS------VGGCRASYNAVPIDACIA----------------
3cq5B           IRD-------VGIAGHLRTTIGV------------------------
2aevA           ITITVAGM--PGASKSLRIDLTSRD----------------------
1e5eB           VSLGGCESLIQHPASMTHAVVPKEERAGITD----------------
2d5yA           AVASGRL----------------------------------------
1e5eA           VSLGGCESLIQHPASMTHAVVPKEERE--------------------
1ajrA           LLPSGRINMCGLTTKNLDYVATSIHE---------------------
1czcA           AVASGRL----------------------------------------
1ariA           AVASGRV----------------------------------------
1bqdA           AVASGRV----------------------------------------
1aheA           AVASGRV----------------------------------------
1arhA           AVASGAV----------------------------------------
3cq4A           IRDVGIA-------GHLRTTIGV------------------------
1ax4A           AVEIGSFLLGRDDMEFMRLTRRVYTNDHMDY----------------
1b4xA           AVASGRV----------------------------------------
3b46A           AIPPTEFYHEKAAENLLRFAVCKDDAY--------------------
2dr1B           LAKGYGS----VKEKTFRIGMGYMKFEDIQE----------------
2bwoD           VQPIN-FPTVPRGTERLRFTSPVHDLKQIDG----------------
2bwnA           VQPIN-FPTVPRGTERLRFTPPVHDLKQIDG----------------
3bwoE           SRAGERC---GSDKKHVRVSMLS-REDVFNV----------------
2bwpA           VQPIN-FPTVPRGTERLRFTSPVHDLKQIDG----------------
1eg5A           VSTHVLDAGVDRAQGAIRISLC-------------------------
3bv0B           LRPFRNLVY-------AMPPYICTPAE--------------------
2bwoB           VQPIN-FPTVPRGTERLRFTSPVHDLKQIDG----------------
1d7uA           MNIVQLPGMGGVF--RIAPPLTV-SEDEIDL----------------
3bwoD           SRAGERC---GSDKKHVRVSMLS------------------------
2bwoA           VQPIN-FPTVPRGTERLRFTSPVHDLKQIDG----------------
3bwnA           SRAGERC---GSDKKHVRVSMLSREDV--------------------
3bwoB           SRAGERC---GSDKKHVRVSMLS------------------------
2bwnE           VQPIN-FPTVPRGTERLRFTSPVHDLKQIDG----------------
3bwoF           SRAGERC---GSDKKHVRVSMLS-REDVFNV----------------
3bwnD           SRAGERC---GSDKKHVRVSMLSREDV--------------------
2d66A           AVASGRV----------------------------------------
2dkjA           VNKNAIPFKPPRVTSGIRIGTP-------------------------
2dr1A           LAKGYGS----VKEKTFRIG---------------------------
3caeA           -----------------------------------------------
2bwnB           VQPIN-FPTVPRGTERLRFTPPVHDLKQIDG----------------
1c7gA           SMERGIVSAGRSKLETVRLTIPRR-----------------------
3bn1D           SRPVFHPMHIMPPYAHLATDDLKIAEA--------------------
2c0rA           GLKGHRS------VGGLRASYNAVPYESCEA----------------
3bcaA           GARAVPL----------------------------------------
1ecxB           VSTRHVLDAMGVAQGAIRISCKYNTEEEVDY----------------
1bj4A           CNKNTCPGRSALRPSGLRLGPALTSRGLLEK----------------
2dgkC           VPAFT-LGGEATDIVVMRIMRRGFEMDFAEL----------------
3dr4A           SRPVFHPMHIMPPYAHLATDDLKIAEACGVD----------------
2dgmB           VPAFT-LGGEATDIVVMRIMCRGFEMDFAEL----------------
3bcbA           GARAVPLGNVQTVSGHTFR----------------------------
2c44A           AVEIGSFLQLPCPAELLRLTRATYTQTHMDF----------------
2c44B           AVEIGSFLLGRDPAELLRLTIPRA-----------------------
2cfbA           AFHRGGIYLAPSQFEAGFTSLAH------------------------
2dgmC           VPAFT-LGGEATDIVVMRIM---------------------------
2cb1A           KAANLGDARTLLV----------------------------------
2bieB           GLNGHRS----VGGCRASIYNAV-PIDACIA----------------
3dr4B           SRPVFHPMHIMPPYAHLATDDLKIAEA--------------------
1cs1A           ESLGGVESAAGISETLLRISGIEDGEDLIA-----------------
1b9iA           AFAAFRA----------------------------------------
2c81A           GYVFRFDPVKFGGLNADQFCEILREKLNMG-----------------
2dgmE           VPAFT-LGGEATDIVVMRIMRRGFEMDFAEL----------------
2c44C           AVEIGSFLLGRDPAELLRLTRATYTQTHMDF----------------
2ch1A           EVQGGLGPTFGKAWRVGIMGECSTVQK--------------------
2bieA           GLNGHRS------VGGCRASYNAVPIDACIA----------------
1c0nA           VRTGHHCAAYYNVPAMCRASLAYNTHEEVDR----------------
1b9hA           AFAAFRAIY--RTDAFWELGAPDESVDAIAR----------------
3dr4D           SRPVFHPMH--IMPPYAHLATDDLK----------------------
1dfoB           VNKNSVPNKSPFVTSGIRVGTP-------------------------
3dxvB           VYYVGMN----GNVLEFTPPLTITETD--------------------
3caiA           AIANTGSRVDVGGAVTVGLAHYSTMAE--------------------
3b8xA           SWFGFSFIIKKDSGVIRKQLVENLNSAGIEC----------------
2d3jA           -----------------------------------------------
1ejjA           -----------------------------------------------
2dgkA           VPAFT-LGGEATDIVVMRIMRRGFEMDFAEL----------------
3bc8A           GARAPLGNVQTVSGHTFRGFMSHADNYPCA-----------------
3bcxB           TRLLFAGNLTRQPYFHDVKYRVVGELT--------------------
1bjnA           ALKGHRV------VGGMRASYNAMPLEGVKA----------------
3ecdC           CNKNGIPFEKPTITSGIRLGPAGTTRGFGAA----------------
2c7tA           GYVFRFDPVKFGGLNADQFCEILREKLNMG-----------------
3bs8A           SYYKGNEGVFLPPSQFEGLFSTAHTDEDIEN----------------
3ecdB           CNKNGIPFEKPTITSGIRLGTAGTTRGFGAA----------------
3e9kA           CDKRNPN---GIRVAPVPLY---------------------------
3bb8A           TRLLFAGNLTRQPYFHDVKYRVVGELT--------------------
2bkwA           IAGGIHK---DIGPKYIRIGHG-------------------------
3bn1C           SRPVFHPMHIMPPYAHLATDDLKIAEA--------------------
1bjoA           ALKGHRV----VGGMRASIYNAM-PLEGVKA----------------
3b8xB           -----------------------------------------------
1ejiA           CNKNTCPGKSALRPSGLRLG---------------------------
3dpnA           VEPHIDLPF--TANDIRYKGYSEYLDKVKK-----------------
3dr7B           SRPVFHPMHIMPPYAHLATDDLKIAEA--------------------
2btwA           -----------------------------------------------
3banA           -----------------------------------------------
3ecdA           CNKNGIPFDPEKPTITSGI----------------------------
2a7vA           NKNTCPGDRSAITPGGLRLG---------------------------
2btwB           -----------------------------------------------
3e77A           LELNMLSLKGHRSVGGIRASYNAVTIEDVQK----------------
2cinA           VLPAGA--------DTVRFRPLTVSTAEIDA----------------
3d19A           FL---------------------------------------------
3bcxA           TRLLFAGNLTRQPYFHDVKYRVVGELT--------------------
2bwpB           YVQPINFPTVPRGTERLRFTPPVHDLKQI------------------
3e77C           LNMLSLK--GHRSVGGIRASYNAVTIEDVQK----------------
2dgmA           VPAFT-LGGEATDIVVMRIM---------------------------
1agxA           -----------------------------------------------
1eghA           -----------------------------------------------
1bs0A           WVTAIRPPTVPAGTARLRLTTAAHEMQDIDR----------------
3ecdD           CNKNGIPFEKPTITSGIRLGTAGTTRGFGAA----------------
3bn1A           -----------------------------------------------
3dr4C           -----------------------------------------------
1djeA           WVTGIRPPTVPAGIARLRLTTAAHEMQDIDR----------------
1ei7A           -----------------------------------------------
2cy8A           AAMRMALILEGVDGGRGSVF---------------------------
3d19E           -----------------------------------------------
1cj0A           CNKNTCPGKSALRPSGLRLG---------------------------
1cj0B           CNKNTCPGDKSLRPSGLRLGTP-------------------------
3e6gD           -----------------------------------------------
3e6gB           -----------------------------------------------
3a2bA           -----------------------------------------------
3d46A           -----------------------------------------------
3cxmA           -----------------------------------------------
3bzsA           -----------------------------------------------