[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80551.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2byuA.bssp"
#ERROR : Can't open dsspfile "2bolA.bssp"
#ERROR : Can't open dsspfile "2bolB.bssp"
#ERROR : Can't open dsspfile "1ejfA.bssp"
#ERROR : Can't open dsspfile "2cg9X.bssp"

## Summary of PDB Search
:136
    2e-17  33%  2byuA  [x.x.x] HEAT SHOCK PROTEIN 16.9B
    7e-16  16%  2bolA  [x.x.x] SMALL HEAT SHOCK PROTEIN
    7e-15  16%  2bolB  [x.x.x] SMALL HEAT SHOCK PROTEIN
    7e-14   9%  1ejfA  [b.15.1] PROGESTERONE RECEPTOR P23
    3e-09  14%  2cg9X  [x.x.x] CO-CHAPERONE PROTEIN SBA1
:136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEPAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
2byuA           -------------------------------------ARMDWKETPEAHVFKADLPGVKKEEVKVVEDGN
2bolA           ------------------------------KNKEGLEIVTAEDGSKKIHLELKVDPHFAPKDVKVWAKGN
2bolB           -----------------------------------LEIVTAEDGSKKIHLELKVDPHFAPKDVKVWAKGN
1ejfA           -----------------------------------QPASAKWYDRRDYVFIEFCVEDSKDVNVNF--EKS
2cg9X           -------------------------------------RSSTTDPERNYVLITVSIAD--CDAPELTIKPS


                         .         .         *         .         .         .         .:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPAxxxxxxxx
2byuA           VLVVSGERTKEKDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAAI--------
2bolA           KVYVHG------------VTGHREFYKAFVTPEVVDASKTQAEIVDGLMVVEAPL-----------
2bolB           KVYV--------------HGVTREFYKAFVTPEVVDASKTQAEIVDGLMVVEAPL-----------
1ejfA           KLTFSCLG----------GSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGES--------
2cg9X           YIELKA------------QSKVHHYQLHIDLYKEIIPEKTMHKVANGYFLKLYKK-----------