[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dliA.bssp"
#ERROR : Can't open dsspfile "1dljA.bssp"
#ERROR : Can't open dsspfile "3ckyD.bssp"
#ERROR : Can't open dsspfile "3c7dB.bssp"
#ERROR : Can't open dsspfile "3c7aA.bssp"
#ERROR : Can't open dsspfile "1bg6A.bssp"
#ERROR : Can't open dsspfile "3cumA.bssp"
#ERROR : Can't open dsspfile "3cinA.bssp"
#ERROR : Can't open dsspfile "3dzbB.bssp"
#ERROR : Can't open dsspfile "3d0oA.bssp"
#ERROR : Can't open dsspfile "3ckyA.bssp"
#ERROR : Can't open dsspfile "3dafA.bssp"
#ERROR : Can't open dsspfile "3egoB.bssp"
#ERROR : Can't open dsspfile "3egoA.bssp"
#ERROR : Can't open dsspfile "1a5zA.bssp"
#ERROR : Can't open dsspfile "2d4aB.bssp"
#ERROR : Can't open dsspfile "3dzbA.bssp"
#ERROR : Can't open dsspfile "3ckyB.bssp"
#ERROR : Can't open dsspfile "1cetA.bssp"
#ERROR : Can't open dsspfile "3d0oB.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "3dl2B.bssp"
#ERROR : Can't open dsspfile "1ceqA.bssp"
#ERROR : Can't open dsspfile "3dttA.bssp"
#ERROR : Can't open dsspfile "2d4aA.bssp"
#ERROR : Can't open dsspfile "2cvzA.bssp"
#ERROR : Can't open dsspfile "3c24A.bssp"
#ERROR : Can't open dsspfile "2d4aC.bssp"
#ERROR : Can't open dsspfile "3ckyC.bssp"
#ERROR : Can't open dsspfile "2ahrA.bssp"
#ERROR : Can't open dsspfile "3dttB.bssp"
#ERROR : Can't open dsspfile "2c74A.bssp"
#ERROR : Can't open dsspfile "2b0jA.bssp"

## Summary of PDB Search
:443
    2e-55  20%  1dliA  [c.2.1 - a.100.1 - c.26.3] UDP-GLUCOSE DEHYDROGENASE
    3e-52  20%  1dljA  [c.2.1 - a.100.1 - c.26.3] UDP-GLUCOSE DEHYDROGENASE
    7e-31  20%  3ckyD  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    1e-27   9%  3c7dB  [x.x.x] OCTOPINE DEHYDROGENASE
    4e-25  11%  3c7aA  [x.x.x] OCTOPINE DEHYDROGENASE
    8e-23  15%  1bg6A  [x.x.x] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    7e-22  15%  3cumA  [x.x.x] PROBABLE 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    8e-22  11%  3cinA  [c.2.1 - d.81.1 (1vjpA)] MYO-INOSITOL-1-PHOSPHATE
    2e-20  10%  3dzbB  [x.x.x] PREPHENATE DEHYDROGENASE
    2e-20   7%  3d0oA  [x.x.x] L-LACTATE DEHYDROGENASE 1
    1e-19  18%  3ckyA  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    4e-19  13%  3dafA  [x.x.x] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    6e-19   8%  3egoB  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    1e-17   9%  3egoA  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    5e-17  13%  1a5zA  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-16  11%  2d4aB  [x.x.x] MALATE DEHYDROGENASE
    2e-16  10%  3dzbA  [x.x.x] PREPHENATE DEHYDROGENASE
    7e-15  18%  3ckyB  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    9e-15  10%  1cetA  [c.2.1 - d.162.1] PROTEIN (L-LACTATE DEHYDROGENASE)
    3e-14   8%  3d0oB  [x.x.x] L-LACTATE DEHYDROGENASE 1
    3e-14  13%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    8e-12  11%  3dl2B  [x.x.x] UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 3
    4e-11  12%  1ceqA  [c.2.1 - d.162.1] PROTEIN (L-LACTATE DEHYDROGENASE)
    2e-10  10%  3dttA  [x.x.x] NADP OXIDOREDUCTASE
    2e-10  11%  2d4aA  [x.x.x] MALATE DEHYDROGENASE
    1e-07  23%  2cvzA  [c.2.1 - a.100.1 (1j3vA)] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    4e-07  16%  3c24A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    5e-07  10%  2d4aC  [x.x.x] MALATE DEHYDROGENASE
    7e-06  20%  3ckyC  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    1e-05  12%  2ahrA  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    9e-05  14%  3dttB  [x.x.x] NADP OXIDOREDUCTASE
    4e-04  19%  2c74A  [x.x.x] 14-3-3 PROTEIN ETA
    9e-04  10%  2b0jA  [x.x.x] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
:443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPT
1dliA           ------------------------------------------NEVTIVDILPSKVDKINNGLSPIQDEYI
1dljA           ------------------------------------------NEVTIVDILPSKVDKINNGLSPIQDEYI
3ckyD           ----------------------------------------------------------------------
3c7dB           --------------------------------TLSGLAASRDGVEVRVLTFADEAERWTKALGADELTVI
3c7aA           --------------------------------TLSGLAASRDGVEVRLTLFADEAERWTKALGADELTVI
1bg6A           --------------------------------AFAAYLALKGQSVLAWDIDAQRI---KEIQDRGAIIAE
3cumA           ---------------------------------------------------------------NVFDLVQ
3cinA           ---------------------------------------------EIEPYGVPLARELPIGFEDIKIVGS
3dzbB           --------------------------------------DHPDYEILGYNRSDYSRNIALERGIVDRATGD
3d0oA           ----------------------------------------------------------------------
3ckyA           ----------------------------------------------------------------------
3dafA           ----------------------------------DPCFAEEPGLVVIDEFDPKEVMEAHLSGNPESIMPC
3egoB           --------------------------------LCAYYLSL-YHDVTVVTRRQEQAAAIQSEGIRLYKGGE
3egoA           -----------------------------------------YHDVTVVTRRQEQAAAIQSEGIRLYKGGE
1a5zA           --------------------------------STAFALLMKGFAREMVLIDVDKKRAEGDALDLIHGTPF
2d4aB           --------------------------------ATAVMLMMRGYDDLLLI---ARTPGKPQGEALLAHAAA
3dzbA           --------------------------------------DHPDYEILGYNRSDYSRNIALERGIVDRATGD
3ckyB           ----------------------------------------------------------------------
1cetA           ----------------------------------------------------------------------
3d0oB           ----------------------------------------------------------------------
3dojA           --------------------------------------------------------------------TL
3dl2B           ----------------------------------------------------------------------
1ceqA           ----------------------------------------------------------------------
3dttA           --------------------------------------------------------IGTRDPKATLARAP
2d4aA           --------------------------------ATAVMLMMRGYDDLLLIARTPGKP---QGEALLAHAAA
2cvzA           ---------------------------------------KVAF--IGLGAGYPAGHLARRFPTLVWNRTF
3c24A           ----------------------------------------------------------------------
2d4aC           --------------------------------ATAVMLMMRGYDDLLLIA--RTPGKPQGEALDLAHAAA
3ckyC           ----------------------------------------------------------------------
2ahrA           ------------------------------------------------------------HELIISGSSL
3dttB           --------------------------------------ADLGHEVTIGTRDPKATLARAEPPPFSQWLPE
2c74A           ----------------------------------------------------------------------
2b0jA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTY
1dliA           EYYLKSKQLSIKATLDSKAAYKEAELVIIATPTNYSRINYFDTQHVETVIKEVL-SVNSHATLIIKSTIP
1dljA           EYYLKSKQLSIKATLDSKAAYKEAELVIIATPTNYSRINYFDTQHVETVIKEV-LSVNSHATLIIKSTIP
3ckyD           -----------FIGLGAQKVAAASDIIFTSLPNA---------GIVETV---------MNTVIVDMSSVS
3c7dB           VNEKDGTQTEV-----KSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQA
3c7aA           VNEKDGTQTPKVITKDPEIAISGADVVILTVPA----------FAHEGYFQAMAPYVQDSALIVGLPSQA
1bg6A           GPGLAGTAHPDLLTSDIGLAVKDADVILIVVPEGQLIILNPGATGGALEFRKILRENGAPEVTIGETSSM
3cumA           SAVDGLVAAGASAARSARDAVQGADVVISLPASQHVE-------GLYLDDDGLLAHIAPGTLVLECSTIA
3cinA           YVDRAKIGKKLSESLTSDPEIRKGVHLGSVRNLPIEAEGLEDSMTLKEAVDTLVKEWTELDPDVIVNTCT
3dzbB           FK----------------EFAPLADVIILAVPI----------KQTAYLKELADLDLKDNVIITDAGSTK
3d0oA           -----------------------CAGAAQKPGETRLDLVSKNLKIFKSIVGEVMASKFDGIFLVATNPVD
3ckyA           -----VVAQGAQACENNQKVAAASDIIFTSLP------NAGIVETVMNGPGGVLSACKAGTVIVDMSSVS
3dafA           IHLVHPEDVGLKVTSDDREAVEGADIVITWLP---------KGNKQPDIIKKFADAIPEGAIVTHACTIP
3egoB           EFRA--------DCSADTSINSDFDLLVVTVKQH----------QLQSVFSSLERIGKTNILFLQNGMGH
3egoA           EFRA--------DCSADTSINSDFDLLVVTVKQH----------QLQSVFSSLERIGKTNILFLQNGMGH
1a5zA           TRRANIYAGDYADLKGSDVVIVAAGVP-QKPGETRLQLLGRNARVMKEIARNVSKYAPDSIVIVVTNPVD
2d4aB           ELGV----DIRISGSNSYEDMRGSDIVLVTAGIGEQLL-EANANTMADLAEKIKAYAKDAIVVITTNPVD
3dzbA           FK----------------EFAPLADVIILAVPI----------KQTAYLKELADLDLKDNVIITDAGSTK
3ckyB           -----VVAQGAQACENNQKVAAASDIIFTSLPNA------GIVETVMNGPGGVLSACKAGTVIVDMSSVS
1cetA           ----------------------------------------------------------------------
3d0oB           ----------------------------------------------------------------------
3dojA           SKCDELVEHGASVCESPAEVIKKCKYTIAMLSDP------CAALSVVFDKGGVLEQICEGKGYIDMSTVD
3dl2B           -----------------LSASAHSKVVIFTVNSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPV
1ceqA           ----------------------------------------------------------------------
3dttA           PFSQWLPEHPHVHLAAFADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIANPLDFSHGPPTLN
2d4aA           ELGV----DIRISGSNSYEDMRGSDIVLVTAGIGL---LEANANTMADLAEKIKAYAKDAIVVITTNPVD
2cvzA           EKALRHQEEFG-SEAVPLERVAEARVIFTCLPTT---------REVYEVAEALYPYLREGTYWVDATSGE
3c24A           -------------------------------------------NIIEKVAEDIVPRVRPGTIVLILDAAA
2d4aC           ELGV----DIRISGSNSYEDMRGSDIVLVTAGIG--RKLEANANTMADLAEKI-KAYAKDAIVVITTNPV
3ckyC           -----VVAQGAQACENNQKVAAASDIIFTSLPNA------GIVETVMNGPGGVLSACKAGTVIVDMSSVS
2ahrA           ERSKEIAEQLALPYASHQDLIDQVDLVILGIK--------------PQLFETVLKPLHFKQPIISAAGIS
3dttB           HPHVHLAAF--------ADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIANPLDFSHGPPTLN
2c74A           ----------------------------------------------------------------------
2b0jA           ---VHPEDVGLKVTSDDREAVEGADIVITWLP---------KGNKQPDIIKKFADAIPEGAIVTHACTIP


                         +         .         .         .         .         *         .:210
query           PGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKV
1dliA           IGFITEMRQKFQT---------DRIIFSPEFLRESKALYDNLYPSRIIVSCEENDSPKVKADAAKKNNVP
1dljA           IGFITEMRQKFQT---------DRIIFSPEFLRESKALYDNLYPSRIIVSCEENDSPKVKADAAKKNNVP
3ckyD           PSSTLKMAKVAAEKGIDYV--DAPVSGGTKGAEAG--------TLTIMVGASEAVFEKIQPVLSVIGKDI
3c7dB           GFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQHGAE
3c7aA           GFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHG
1bg6A           LFTCRSERPGQVTVNAIKGAMDFACLPAAKAGWALEQIGSVLPQYVAVENVLHTSLTNVNAVMHPLPNAA
3cumA           PTSARKIHAAARER------------GLALDAPVSGGTAGAAAGTLTFVGGDAEALEKARPLF-EAGRNI
3cinA           TEAFVEDLLKAINDKERLTATQVYAYAAALYANKRGGAAFVNVIPTFIAN-----DPAFVELAKENDDGA
3dzbB           REIVEAAERYLTGKNVQFV--GSHPAGSHAADVTLFENAYYIFTP--TSLTKETTIPELKDILSGLKSRY
3d0oA           ILAYATWKFSGLPKERIGSGTILDSARFRLLLSEAFDVAPRSVDAQIIGEHGDTELPVWSHANIAGQPLK
3ckyA           PSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTL----------TIMVGASEAVFEKIQPVLSVIGKDI
3dafA           TTKFAKIFKD------LGREDLNITSYHPGCVPEMKGQVYIAE-----GYASEEAVNKLYEIGKIARGKA
3egoB           IHDLKDWHVGHSIYVGIVEHGTAVDHTGLGAIKWSAFDDAEPDRLNILDFPIYYETDWYRLLTGKLIVNA
3egoA           IHDLKDWHVGHSIYVGIRKSDTAVDHTGLGAIKWSAFDDAEPDRLPIYYETDWYRLLTGKLIVNACI--N
1a5zA           VLTYFFL-----KESGMDPRKVFGSGTDTARLRTLIAQHCGFSPRSVHVYVIGEHGDSEVPVWSGAMIGG
2d4aB           AMTYV-----MYKKTGFPRERVIGFSGILDSARMAYGVSFKSVNAIVLGMHGQKMFPVPRLSSVGGVPLE
3dzbA           REIVEAAERYLTGKNVQFV--GSHPAGSAADVTLFENAYYIFT---PTSLTKETTIPELKDILSGLKSRY
3ckyB           PSSTLKMAKVAAEKGIDYVDAPVS--GGTKGAEAGTLTIMVGASEAVFEKIQP--------VLSVIGKDI
1cetA           ---------------------VLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVIPLQEF
3d0oB           ---------------------------------------------QIIGEHGDTELPVWSHANIAGQPLK
3dojA           AETSLKINEAITGKGGRFVEGPVS----------GSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRS
3dl2B           EIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTKEVWVIGEQGEDKVLTWSGQEEVVSHTS
1ceqA           -------------------------------ISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIQEF
3dttA           PVNTDSLGEQIQRTFPEAKVVKTLNTNASLVDPGRAAGGDHSVF--VSGNDA------------AAKAEV
2d4aA           AMTYV-----MYKKTGFPRERVIGFSGILDSARMAYGVSFKSVNAIVLGMHGQKMFPVPRLSSVGGVPLE
2cvzA           PEASRRLAERLREKGVTYLDAPVS--GGTSGAEAG--------TLTVLGG------PEEAVERVRPFKKV
3c24A           PYAGVPERADITYFIGHPCHPPLFNDETDPAARTHGGIAKQAIVCALQGPEEHYAIGADICETWSPVTRT
2d4aC           DAMTYV----MYKKTGFPRERVIGFSGILDSARMAYGVSFKSVNAIVLGMHGQKMFPVPRLSSVGGVPLE
3ckyC           PSSTLKMAKVAAEKGID------YVDAPVSGGTKGAEAGTL---TIMVGAS-EAVFEKIQPVLSVIGKDI
2ahrA           LQRLATFVGQDLPLLRIPNNAQILQSSTALTGNALVSQELQARVRDLTDSFGST----------------
3dttB           PVN----TDSLGEQIQRTFPEAKVVKTLNTNASLVDPGRAAGGDHSVFVSGNDAAAKAEVATLLKSLGHQ
2c74A           ----------------------------------------------------------------------
2b0jA           TTKFAKIF--------KDLGREDLNITSYHPGCVP---EMKGQVYIAEGYASEEAVNKLYEIGKIARGKA


                         .         .         .         +         .         .         .:280
query           VPVSSAKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIP
1dliA           VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDIGMHYNNPSFGYGGYCLP
1dljA           VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDIGMHYNNPSFGYGGYSLP
3ckyD           YHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSSGRIMSGDFAGGFAMDLQH
3c7dB           PVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGADMLTACSNECKDVANAIMAACPG
3c7aA           AEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQACSNECKDVANAIMAACPG
1bg6A           RCESGTPFQYYLEGITPSVGSLAEKVDAERIAIAKAFDLNVPSVCEWYPATIYEAV--QGNPAYRGIAGP
3cumA           FHAGPDGAGQVAKVCNNQLLAVLIGTAEAALGVANGLEAKVLAEIRRSSGGNWALEVYNPWPGVENAPAS
3cinA           TGATPFTADVLSHLAQRNRYVKDVAQFNIGGNMDFLALTDDGKNKSKEFTKSSIVK-DILGYDAPHYIKP
3dzbB           VEIDAAEHDRVTSQISHFPHLLASGLEQDYAQAHETNHFAAGGFRDTRIAESEPGWASGPAVLDRIEDFK
3d0oA           TLLQRPEGKAQIEQIFVQTRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTV--SALLEGEYEE
3ckyA           YHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSSGRSYAMDFAGGFAMDLQH
3dafA           FKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKGIANMEEA
3egoB           PLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGTKENRSSMLVDVIGGRQTE
3egoA           PLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVTKENRSSMLVDVIGGRQTEAD
1a5zA           IPLQNMCQSKILENFAEKTKRAAYEIIERKGATHYAIALAVADIVESEKRVLTLSVYLEDYLGVKDLCIS
2d4aB           HLMSKEEIEEVVSETVNAGAKITELRGYSSNYGPAAGLVLTVEAIKRD-SKRIYPYSLYLQGEYGYNDIV
3dzbA           VEIDAAEHDRVTSQISHFPHLLASGLEQAADYAQAHFAAGGFRDTRIAESEPGWASILTPAVLDRIEDFK
3ckyB           YHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSSGRSYAMEAAGGFAMDLQH
1cetA           INNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKLKKVLICSTLLEGQYGHSDIF
3d0oB           TLLEQRPEKAQIEQIFVQTRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTV--SALLEGEYEE
3dojA           FYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSLLDILDLGAMTNPMFKGSSYPPAFPLKHQQ
3dl2B           QVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLLPCILGTNGVV
1ceqA           INNKLISDAELEAIFDRTVNTALEIVNLHASPYVA-PAAAIIEMAESYLKDLKKVLICSTL--LEGQYGH
3dttA           ATLLKSLGHQDVIDLGDITTARGAELLPVWIRLWGALGTANFNFKIA-----------------------
2d4aA           HLMSKEEIEEVVSETVNAGAKITELRGYSSNYGPAAGLVLTVE---------------------------
2cvzA           VHVGPVGAGHAVKAINNALLAVNLWAAGEGLLALVKQGVSAEKALEV-----------------------
3c24A           HRVTTEQLA--ILEPGLSEVAPFVETVHAVDECADRYGIDRQAALDFIGHLNVEIAWFGVAALRLEFAKD
2d4aC           HLMSKEEIEEVVSETVNAGAKITELR--------------------------------------------
3ckyC           YHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEI-----------------------
2ahrA           -FDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLA----------------
3dttB           DVITTARGAELLPVWIRLWGALGTANFNF-----------------------------------------
2c74A           ----------------------------------------------------------------------
2b0jA           FKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGA-------------------------------


                         .         *         .         .         .         .         +:350
query           IDPHYLEWKAKEYNFNTHFIALAGEINRKMPEFTVEKALRVLAEAGVPVRGAKVLVLGVAYKRDIPDYRE
1dliA           KDTKQLLANYNNIPQTLIEAIVSSNNVRKSYIA--KQIINVL--KEQESPVKVVGVYRLIMKSNSDNFRE
1dljA           KDTKQLLANYNNIPQTLIEAIVSSNNVRKSYIA--KQIINVL--KEQESPVKVVGVYRLIMKSNSDNFRE
3ckyD           KDLGLALEAGKEGNVPLPMTAMATQIFEGGGREDMSAVIKVWEQTGVSVSGG------------------
3c7dB           NDLSDVKDIYQWYLHDLYHAITTNKSYKGLVHPVKVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSN
3c7aA           NDLSDVKDIYQWYTTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIP---MGMIVFKGVAIAAGVAIPS-
1bg6A           INLNTRYFFEDVSTGLVPLSELGRAVNVPTPLIDVLDLISSLIDTDFRKEGRTLEKLGLS-GLTAAGIRS
3cumA           RDYSGGFAQLAKD---------------------------------------------------------
3cinA           TGYLAIHIEYVSFNGATDELMINGRINDSPAGLLVDLVRLGKIALDRKEFGTVYPVNAFYMKPGPAEEKN
3dzbB           KRLDHVADLIKAEDE-SAIWEFFDNGRKKRKE--------------------------------------
3d0oA           EDVYIGVPAVINRNGIRNVVEI--PLNDEEQS-KFAHSAKTLKD--------------------------
3ckyA           KDLGLALEAGKEGNVPLPMTAMATQIFEGGGREDMSAVIKVWEQTGVSVSGG------------------
3dafA           LDPAAL----------------------------------------------------------------
3egoB           ADAGYLLKEASLQGLDAVHLEFLYGSIKAL----------------------------------------
3egoA           AIIGYLLKEASLQGLDAVHLEFLYGSIKAL----------------------------------------
1a5zA           V-PVTLGKHGLELNLNEEFRKSASILKNAINEITAEE---------------------------------
2d4aB           A---------------------------------------------------------------------
3dzbA           KRLDHVADLIKAEDE-SAIWEFFDNGRKKRKEEIHKKG--------------------------------
3ckyB           KDLGLALEAGKEGNVPLPMTAMATQIFEGGGREDMSAVIKVWEQTGVSVSG-------------------
1cetA           GGTPVVLGANGVE--QVIELQLNSEEKAKF-----DEAIAETKR--------------------------
3d0oB           EDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSAKTLK------------------------------
3dojA           KDMRLALALGDENAVSMPVAAAANERSLGLGDLDFSAVIEAVKFS-------------------------
3dl2B           IKTLKDTVTEK-------LQSSASSIHSLQQQL-------------------------------------
1ceqA           SDIFGGTPVVLGANGVEQVIEL--QLNSEEKA-KFDEAIAETKR--------------------------
3dttA           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
2cvzA           ----------------------------------------------------------------------
3c24A           IV--------------------------------------------------------------------
2d4aC           ----------------------------------------------------------------------
3ckyC           ----------------------------------------------------------------------
2ahrA           ----------------------------------------------------------------------
3dttB           ----------------------------------------------------------------------
2c74A           ------------------------------------SAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRS
2b0jA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SPAIEVIRGLRRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR
1dliA           SAIKDVIDILKSKDIKIIIYEPMLNKLES-EDQSVLVNDLENFKKQANIIVTNRYDN--ELQDVKNKVYR
1dljA           SAIKDVIDILKSKDIKIIIYEPMLESEDQSVL----VNDLENFKKQANIIVTNRYDNELKNKVY----SR
3ckyD           ----------------------------------------------------------------------
3c7dB           DKLIMW---AQEKIGKEYLVDGALTGKDVA----TTRCPQRYGFNTLDAILTGKKHHHH-----------
3c7aA           ------NDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHH-----------
1bg6A           ----------------------------------------------------------------------
3cumA           ----------------------------------------------------------------------
3cinA           IPRIIAYEKMRIWAGLKP----------------------------------------------------
3dzbB           ----------------------------------------------------------------------
3d0oA           ----------------------------------------------------------------------
3ckyA           ----------------------------------------------------------------------
3dafA           ----------------------------------------------------------------------
3egoB           ----------------------------------------------------------------------
3egoA           ----------------------------------------------------------------------
1a5zA           ----------------------------------------------------------------------
2d4aB           ----------------------------------------------------------------------
3dzbA           ----------------------------------------------------------------------
3ckyB           ----------------------------------------------------------------------
1cetA           ----------------------------------------------------------------------
3d0oB           ----------------------------------------------------------------------
3dojA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
1ceqA           ----------------------------------------------------------------------
3dttA           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
2cvzA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
2d4aC           ----------------------------------------------------------------------
3ckyC           ----------------------------------------------------------------------
2ahrA           ----------------------------------------------------------------------
3dttB           ----------------------------------------------------------------------
2c74A           S--WRVISSIEQ-KTMADGNEKKLEKVKAYREKIEKETVCNDVLSLLDKFLIQYESKVFYLK--------
2b0jA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VLDARxxxxxxxxxxxxxxxxxx
1dliA           DIFGR------------------
1dljA           DIFGR------------------
3ckyD           -----------------------
3c7dB           -----------------------
3c7aA           -----------------------
1bg6A           -----------------------
3cumA           -----------------------
3cinA           -----------------------
3dzbB           -----------------------
3d0oA           -----------------------
3ckyA           -----------------------
3dafA           -----------------------
3egoB           -----------------------
3egoA           -----------------------
1a5zA           -----------------------
2d4aB           -----------------------
3dzbA           -----------------------
3ckyB           -----------------------
1cetA           -----------------------
3d0oB           -----------------------
3dojA           -----------------------
3dl2B           -----------------------
1ceqA           -----------------------
3dttA           -----------------------
2d4aA           -----------------------
2cvzA           -----------------------
3c24A           -----------------------
2d4aC           -----------------------
3ckyC           -----------------------
2ahrA           -----------------------
3dttB           -----------------------
2c74A           -----------------------
2b0jA           -----------------------