[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80664.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cu3A.bssp"
#ERROR : Can't open dsspfile "2cu3B.bssp"
#ERROR : Can't open dsspfile "3cwiA.bssp"
#ERROR : Can't open dsspfile "3dwgC.bssp"

## Summary of PDB Search
:64
    2e-19 100%  2cu3A  [x.x.x] UNKNOWN FUNCTION PROTEIN
    3e-14  97%  2cu3B  [x.x.x] UNKNOWN FUNCTION PROTEIN
    5e-06  28%  3cwiA  [x.x.x] THIAMINE-BIOSYNTHESIS PROTEIN THIS
    4e-05  18%  3dwgC  [x.x.x] 9.5 KDA CULTURE FILTRATE ANTIGEN CFP10A
:64

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG
2cu3A           -VWLNGEPRPLEGKTLKEVLEE-GVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVAL----
2cu3B           -VWLNGEPRPLEGKTLKEVLEE-GVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALQGG-
3cwiA           ---VNGKPSTVDSLNVTELLSALKVAQEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFGGG-
3dwgC           --------NYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG