[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80689.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e3aB.bssp"
#ERROR : Can't open dsspfile "3c5wP.bssp"
#ERROR : Can't open dsspfile "1cqzB.bssp"
#ERROR : Can't open dsspfile "2dstA.bssp"
#ERROR : Can't open dsspfile "1a8qA.bssp"
#ERROR : Can't open dsspfile "3bf7A.bssp"
#ERROR : Can't open dsspfile "3e0xB.bssp"
#ERROR : Can't open dsspfile "3c5vA.bssp"
#ERROR : Can't open dsspfile "2d0dA.bssp"
#ERROR : Can't open dsspfile "3bwxA.bssp"
#ERROR : Can't open dsspfile "1cv2A.bssp"
#ERROR : Can't open dsspfile "3cxuB.bssp"
#ERROR : Can't open dsspfile "2cjpB.bssp"
#ERROR : Can't open dsspfile "3bf8A.bssp"
#ERROR : Can't open dsspfile "3e0xA.bssp"
#ERROR : Can't open dsspfile "1a8sA.bssp"
#ERROR : Can't open dsspfile "1bn6A.bssp"
#ERROR : Can't open dsspfile "3dyvA.bssp"
#ERROR : Can't open dsspfile "1brtA.bssp"
#ERROR : Can't open dsspfile "1dwoB.bssp"
#ERROR : Can't open dsspfile "1edeA.bssp"
#ERROR : Can't open dsspfile "3bf8B.bssp"
#ERROR : Can't open dsspfile "3e3aA.bssp"
#ERROR : Can't open dsspfile "1c4xA.bssp"
#ERROR : Can't open dsspfile "3bf7B.bssp"
#ERROR : Can't open dsspfile "1a88A.bssp"
#ERROR : Can't open dsspfile "2cjpA.bssp"
#ERROR : Can't open dsspfile "1eb8B.bssp"
#ERROR : Can't open dsspfile "1ehyA.bssp"
#ERROR : Can't open dsspfile "1dwoA.bssp"
#ERROR : Can't open dsspfile "3bdiA.bssp"
#ERROR : Can't open dsspfile "3bdvA.bssp"
#ERROR : Can't open dsspfile "1b6gA.bssp"
#ERROR : Can't open dsspfile "1be0A.bssp"
#ERROR : Can't open dsspfile "3cxuA.bssp"
#ERROR : Can't open dsspfile "2cb9A.bssp"
#ERROR : Can't open dsspfile "1broA.bssp"
#ERROR : Can't open dsspfile "2e3jA.bssp"
#ERROR : Can't open dsspfile "1e89B.bssp"
#ERROR : Can't open dsspfile "1dwqB.bssp"
#ERROR : Can't open dsspfile "3bdvB.bssp"
#ERROR : Can't open dsspfile "1azwA.bssp"
#ERROR : Can't open dsspfile "1eh5A.bssp"
#ERROR : Can't open dsspfile "3ds8A.bssp"
#ERROR : Can't open dsspfile "2b61A.bssp"
#ERROR : Can't open dsspfile "2dsnA.bssp"
#ERROR : Can't open dsspfile "1eb8A.bssp"
#ERROR : Can't open dsspfile "1cuaA.bssp"
#ERROR : Can't open dsspfile "3dyiA.bssp"
#ERROR : Can't open dsspfile "2dhdA.bssp"
#ERROR : Can't open dsspfile "3dqzB.bssp"
#ERROR : Can't open dsspfile "3dqzA.bssp"
#ERROR : Can't open dsspfile "3eblC.bssp"
#ERROR : Can't open dsspfile "3d2aA.bssp"
#ERROR : Can't open dsspfile "1beeA.bssp"
#ERROR : Can't open dsspfile "1a7uA.bssp"
#ERROR : Can't open dsspfile "1cuuA.bssp"
#ERROR : Can't open dsspfile "2czqA.bssp"
#ERROR : Can't open dsspfile "1cqwA.bssp"
#ERROR : Can't open dsspfile "3d59A.bssp"
#ERROR : Can't open dsspfile "1e89A.bssp"
#ERROR : Can't open dsspfile "3d5eB.bssp"
#ERROR : Can't open dsspfile "1cubA.bssp"
#ERROR : Can't open dsspfile "3dkrA.bssp"
#ERROR : Can't open dsspfile "1cuhA.bssp"
#ERROR : Can't open dsspfile "1cugA.bssp"
#ERROR : Can't open dsspfile "1cvlA.bssp"
#ERROR : Can't open dsspfile "1cexA.bssp"
#ERROR : Can't open dsspfile "3d2cA.bssp"
#ERROR : Can't open dsspfile "3bxpA.bssp"
#ERROR : Can't open dsspfile "3d2bA.bssp"
#ERROR : Can't open dsspfile "3dcnA.bssp"
#ERROR : Can't open dsspfile "3b5eB.bssp"
#ERROR : Can't open dsspfile "1cufA.bssp"
#ERROR : Can't open dsspfile "1auoA.bssp"
#ERROR : Can't open dsspfile "1dwqA.bssp"
#ERROR : Can't open dsspfile "1cuxA.bssp"
#ERROR : Can't open dsspfile "2cutA.bssp"
#ERROR : Can't open dsspfile "2cbgA.bssp"
#ERROR : Can't open dsspfile "1agyA.bssp"
#ERROR : Can't open dsspfile "3dltA.bssp"
#ERROR : Can't open dsspfile "3b5eA.bssp"
#ERROR : Can't open dsspfile "3deaA.bssp"
#ERROR : Can't open dsspfile "3c8hA.bssp"
#ERROR : Can't open dsspfile "1bu8A.bssp"
#ERROR : Can't open dsspfile "1cqzA.bssp"
#ERROR : Can't open dsspfile "3deaB.bssp"
#ERROR : Can't open dsspfile "3dnmD.bssp"
#ERROR : Can't open dsspfile "3c8hB.bssp"
#ERROR : Can't open dsspfile "1cuyA.bssp"
#ERROR : Can't open dsspfile "3d3nB.bssp"
#ERROR : Can't open dsspfile "1cuvA.bssp"
#ERROR : Can't open dsspfile "1ek1A.bssp"
#ERROR : Can't open dsspfile "1cuzA.bssp"
#ERROR : Can't open dsspfile "3dd5C.bssp"
#ERROR : Can't open dsspfile "3dd5A.bssp"
#ERROR : Can't open dsspfile "2dxcC.bssp"
#ERROR : Can't open dsspfile "3bjrA.bssp"
#ERROR : Can't open dsspfile "3bxpB.bssp"
#ERROR : Can't open dsspfile "1cuwA.bssp"
#ERROR : Can't open dsspfile "3d3nA.bssp"
#ERROR : Can't open dsspfile "3ed1A.bssp"
#ERROR : Can't open dsspfile "1cujA.bssp"
#ERROR : Can't open dsspfile "1ac5A.bssp"

## Summary of PDB Search
:257
    2e-18  22%  3e3aB  [x.x.x] POSSIBLE PEROXIDASE BPOC
    2e-15  13%  3c5wP  [x.x.x] PP2A-SPECIFIC METHYLESTERASE PME-1
    6e-15  19%  1cqzB  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    1e-14  20%  2dstA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1544
    3e-14  23%  1a8qA  [x.x.x] BROMOPEROXIDASE A1
    7e-14  16%  3bf7A  [x.x.x] ESTERASE YBFF
    9e-14  10%  3e0xB  [x.x.x] LIPASE-ESTERASE RELATED PROTEIN
    2e-13  13%  3c5vA  [x.x.x] PROTEIN PHOSPHATASE METHYLESTERASE 1
    2e-13  18%  2d0dA  [x.x.x] 2-HYDROXY-6-OXO-7-METHYLOCTA-2,4-DIENOATE
    2e-13  14%  3bwxA  [x.x.x] ALPHA/BETA HYDROLASE
    2e-13  14%  1cv2A  [c.69.1] HALOALKANE DEHALOGENASE
    3e-13  19%  3cxuB  [x.x.x] EPOXIDE HYDROLASE
    3e-13  19%  2cjpB  [x.x.x] EPOXIDE HYDROLASE
    4e-13  16%  3bf8A  [x.x.x] ESTERASE YBFF
    7e-13  12%  3e0xA  [x.x.x] LIPASE-ESTERASE RELATED PROTEIN
    9e-13  19%  1a8sA  [x.x.x] CHLOROPEROXIDASE F
    1e-12  18%  1bn6A  [c.69.1] HALOALKANE DEHALOGENASE
    4e-12  21%  3dyvA  [x.x.x] ESTERASE D
    6e-12  15%  1brtA  [x.x.x] BROMOPEROXIDASE A2
    1e-11  11%  1dwoB  [c.69.1] HYDROXYNITRILE LYASE
    2e-11  16%  1edeA  [x.x.x] HALOALKANE DEHALOGENASE
    2e-11  16%  3bf8B  [x.x.x] ESTERASE YBFF
    2e-11  20%  3e3aA  [x.x.x] POSSIBLE PEROXIDASE BPOC
    2e-11  18%  1c4xA  [c.69.1] PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-
    4e-11  16%  3bf7B  [x.x.x] ESTERASE YBFF
    5e-11  20%  1a88A  [c.69.1] CHLOROPEROXIDASE L
    5e-11  19%  2cjpA  [x.x.x] EPOXIDE HYDROLASE
    9e-11  11%  1eb8B  [c.69.1] (S)-ACETONE-CYANOHYDRIN LYASE
    9e-11  14%  1ehyA  [c.69.1] PROTEIN (SOLUBLE EPOXIDE HYDROLASE)
    1e-10  12%  1dwoA  [c.69.1] HYDROXYNITRILE LYASE
    3e-10  13%  3bdiA  [x.x.x] UNCHARACTERIZED PROTEIN TA0194
    3e-10  12%  3bdvA  [x.x.x] UNCHARACTERIZED PROTEIN DUF1234
    3e-10  14%  1b6gA  [x.x.x] HALOALKANE DEHALOGENASE
    4e-10  20%  1be0A  [c.69.1 (1cijA)] HALOALKANE DEHALOGENASE
    6e-10  19%  3cxuA  [x.x.x] EPOXIDE HYDROLASE
    6e-10   9%  2cb9A  [x.x.x] FENGYCIN SYNTHETASE
    1e-09  19%  1broA  [c.69.1] BROMOPEROXIDASE A2
    2e-09  21%  2e3jA  [x.x.x] EPOXIDE HYDROLASE EPHB
    2e-09  10%  1e89B  [c.69.1] HYDROXYNITRILE LYASE
    2e-09  10%  1dwqB  [c.69.1] HYDROXYNITRILE LYASE
    2e-09  13%  3bdvB  [x.x.x] UNCHARACTERIZED PROTEIN DUF1234
    2e-09  20%  1azwA  [c.69.1] PROLINE IMINOPEPTIDASE
    2e-09   9%  1eh5A  [c.69.1] PALMITOYL PROTEIN THIOESTERASE 1
    7e-09  14%  3ds8A  [x.x.x] LIN2722 PROTEIN
    1e-08  14%  2b61A  [x.x.x] HOMOSERINE O-ACETYLTRANSFERASE
    2e-08  11%  2dsnA  [x.x.x] THERMOSTABLE LIPASE
    2e-08  11%  1eb8A  [c.69.1] (S)-ACETONE-CYANOHYDRIN LYASE
    3e-08   6%  1cuaA  [x.x.x] CUTINASE
    3e-08  21%  3dyiA  [x.x.x] ESTERASE D
    3e-08  19%  2dhdA  [x.x.x] HALOALKANE DEHALOGENASE
    4e-08  21%  3dqzB  [x.x.x] ALPHA-HYDROXYNITRILE LYASE-LIKE PROTEIN
    4e-08  21%  3dqzA  [x.x.x] ALPHA-HYDROXYNITRILE LYASE-LIKE PROTEIN
    4e-08  13%  3eblC  [x.x.x] GIBBERELLIN RECEPTOR GID1
    6e-08  11%  3d2aA  [x.x.x] LIPASE
    9e-08  20%  1beeA  [x.x.x] HALOALKANE DEHALOGENASE
    9e-08  20%  1a7uA  [c.69.1] CHLOROPEROXIDASE T
    1e-07   7%  1cuuA  [x.x.x] CUTINASE
    1e-07   8%  2czqA  [x.x.x] CUTINASE-LIKE PROTEIN
    1e-07  20%  1cqwA  [c.69.1] HALOALKANE DEHALOGENASE 1-CHLOROHEXANE
    1e-07   9%  3d59A  [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    3e-07  16%  1e89A  [c.69.1] HYDROXYNITRILE LYASE
    4e-07   9%  3d5eB  [x.x.x] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    5e-07   6%  1cubA  [c.69.1 (1cudA)] CUTINASE
    1e-06  22%  3dkrA  [x.x.x] ESTERASE D
    1e-06   6%  1cuhA  [x.x.x] CUTINASE
    1e-06   6%  1cugA  [x.x.x] CUTINASE
    1e-06  12%  1cvlA  [x.x.x] TRIACYLGLYCEROL HYDROLASE
    1e-06   7%  1cexA  [c.69.1 (1xzkA)] CUTINASE
    2e-06  11%  3d2cA  [x.x.x] LIPASE
    2e-06  11%  3bxpA  [x.x.x] PUTATIVE LIPASE/ESTERASE
    2e-06  11%  3d2bA  [x.x.x] LIPASE
    2e-06   6%  3dcnA  [x.x.x] CUTINASE
    3e-06  16%  3b5eB  [x.x.x] MLL8374 PROTEIN
    3e-06   5%  1cufA  [x.x.x] CUTINASE
    4e-06  10%  1auoA  [c.69.1] CARBOXYLESTERASE
    4e-06  11%  1dwqA  [c.69.1] HYDROXYNITRILE LYASE
    7e-06   6%  1cuxA  [x.x.x] CUTINASE
    7e-06   7%  2cutA  [x.x.x] CUTINASE
    9e-06  10%  2cbgA  [x.x.x] FENGYCIN SYNTHETASE
    9e-06   5%  1agyA  [x.x.x] CUTINASE
    1e-05  20%  3dltA  [x.x.x] ESTERASE D
    1e-05  17%  3b5eA  [x.x.x] MLL8374 PROTEIN
    2e-05   6%  3deaA  [x.x.x] CUTINASE
    2e-05  20%  3c8hA  [x.x.x] ENTEROCHELIN ESTERASE
    2e-05  12%  1bu8A  [c.69.1 - b.12.1] PROTEIN (PANCREATIC LIPASE RELATED PROTEIN
    3e-05  16%  1cqzA  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    3e-05   6%  3deaB  [x.x.x] CUTINASE
    3e-05  14%  3dnmD  [x.x.x] ESTERASE/LIPASE
    3e-05  22%  3c8hB  [x.x.x] ENTEROCHELIN ESTERASE
    3e-05   5%  1cuyA  [x.x.x] CUTINASE
    5e-05  13%  3d3nB  [x.x.x] PUTATIVE LIPASE/ESTERASE
    7e-05   7%  1cuvA  [x.x.x] CUTINASE
    8e-05  16%  1ek1A  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    8e-05   7%  1cuzA  [x.x.x] CUTINASE
    8e-05   7%  3dd5C  [x.x.x] CUTINASE
    1e-04   5%  3dd5A  [x.x.x] CUTINASE
    1e-04   6%  2dxcC  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT GAMMA
    1e-04   8%  3bjrA  [x.x.x] PUTATIVE CARBOXYLESTERASE
    2e-04  12%  3bxpB  [x.x.x] PUTATIVE LIPASE/ESTERASE
    2e-04   7%  1cuwA  [c.69.1] CUTINASE
    2e-04  11%  3d3nA  [x.x.x] PUTATIVE LIPASE/ESTERASE
    3e-04  15%  3ed1A  [x.x.x] GIBBERELLIN RECEPTOR GID1
    7e-04   7%  1cujA  [x.x.x] CUTINASE
    7e-04  19%  1ac5A  [x.x.x] KEX1(DELTA)P
:257

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPPRXXXXXXXXX
3e3aB           --NLAYDDNGTGDPVVFIAGRGGAGRTWHPVPAFLAGYRCITFDNRGIGATENAEG-FTTQTMVADTAAL
3c5wP           --FRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIIQCRIVALDLRSHGETKVKNPAETMAKDVGNVVEA
1cqzB           ----------SGPALCLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMV
2dstA           --NLVFDRVGKGPPVLLVAEEASRWPEALPE-----GYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFAV
1a8qA           --EIFYKDWGQGRPVVFIHGWPLNGDAWQDQLKAVVGYRGIAHDRRGHGHSTPVWDGYDFDTFADDLNDL
3bf7A           --AQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLNDHNIIQVDVRNHGLSPRE-PVMNYPAMAQDLVDT
3e0xB           LHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKPSTVYGYIDNVANFITNS
3c5vA           --FRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIIQCRIVALDLRSHGETKVKNPAETMAKDVGNVVEA
2d0dA           --LTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIKFYRVIAPDMVGFGFTDRPENYYSKDSWVDHIIGI
3bwxA           ----AYEGDISRPPVLCLPGLTRNARDFEDLATRLAGDWRVLCPERGRGDSDYAKDPTYQPQYLQDLEAL
1cv2A           --RMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCALGRLIACDLIGMGDSDKLDPSGPAEHRDYLDALW
3cxuB           --NMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGD
2cjpB           --NMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGD
3bf8A           --AQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVDHNIIQVDVRNHGLSPREP-VMNYPAMAQDLVDT
3e0xA           LHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQTVYGYIDNVANFITNS
1a8sA           --QIYYKDWGSGQPIVFSHGWPLNADSWESQMIFLAGYRVIAHDRRGHGRSSQPWSGNDMDTYADDLAQL
1bn6A           --RMHYVDVGPGTPVLFLHGNPTSSYLWRNIIPHVASHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAF
3dyvA           -----FEYEGTDTGVVLLHAYTGSPNDMNFMARALQGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESS
1brtA           --DLYYEDHGTGQPVVLIHGFPLSGHSWERQSAALAGYRVITYDRRGFGQSSQPTTGYDDTFAADLNTVL
1dwoB           ------------AHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQIEQSFDEYSEPLLTFL
1edeA           --RAHYLDEGNSDVFLCLHGEPTWSYLYRKMIPVFSGARVIAPDFFGFGKSPVDEEDYTFEFHRNFLLAL
3bf8B           --AQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVDHNIIQVDVRNHGLSPRE-PVMNYPAMAQDLVDT
3e3aA           --NLAYDDNGTGDPVVFIAGRGGAGRTWHPQVPAFLGYRCITFDNRGIGATE-NAEGFTTQTMVADTAAL
1c4xA           --ASHALVAGDPPAVVLLHGAAHAASNWRPIIPDLANFFVVAPDLIGFGQSEYPETYSWVGMRVEQILGL
3bf7B           --AQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVDHNIIQVDVRNHGLSPREP-VMNYPAMAQDLVDT
1a88A           --NIFYKDWGDGLPVVFHHGWPLSADDWDNQMLFFLGYRVIAHDRRGHGRSDPSTGHDMDTYAADVAALT
2cjpA           --NMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGD
1eb8B           ------------AHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQIINSFDEYSEPLLTFL
1ehyA           --KIHYVREGAGPTLLLLHGWPGFWWEWSKVIGPLEHYDVIVPDLRGFGDSEKPDLNDLSKKAADDQAAL
1dwoA           --------KMVTAHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQIEQSFDEYSEPLLTFL
3bdiA           --RVFQRKVTDRRSIALFHGYSFTSDWDKADLFNNIGYNVYAPDYPGFGRSASSEKYGIDRGDLKHAAEF
3bdvA           --EIDLRLTESQQLTVLVPGLRDSDDEH--------WQSHWERRFPHWQRIRQREWYQADLDRWVLAIRR
1b6gA           --RAHYLDEGNSDVFLCLHGEPTWSYLYRKMIPVFAGARVIAPDFFGFGKSDKPVDEEDYTFEFHRNFLL
1be0A           --RAHYLDEGNSDVFLCLHGEPTWSYLYRKMIPVFAGARVIAPDFFGFGKSDKPVDDYTFEFHRNFLLAL
3cxuA           --NMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAGYRAVAPDLRGYGDTTGAPLNDPSKVGDVVALLE
2cb9A           --HVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNKAAVYGFHFIEEDSRIEQYVSRITEIQP------
1broA           --DLYYEDHGTGQPVVLIHGFPLSGHSWERQSAALLGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
2e3jA           --RIHAVADQQGPLVVLLHGFPESWYSWRHQIPALAGYRVVAIDQRGYGRSSKYQKAYRIKELVGDVVGV
1e89B           ------------AHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLT
1dwqB           -----------TAHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQIEQNSFDEYSEPLLTF
3bdvB           --EIDLRLTVSQQLTVLVPGLRDSDDEH--------WQSHWERRFPHWQRIRQREWYQADLDRWVLAIRR
1azwA           --TLYFEQCGNPKPVVMLHGGPGGGCNDKMRRFHDPKYRIVLFDQRGSGTPHADLVDNTTWDLVADIERL
1eh5A           ---------PAPLPLVIWHGMGDSCCNPLSMGAIKKGIHVLSLEIGKTLREDVENSFFLNQVTTVCQILA
3ds8A           ----------DQIPIILIHGSGGNASSLDKADQLNESSNEALTTVNSEGKIKFEQATPDDWSKWLKIAED
2b61A           --NVAYQTYGTNNAVLICHALTGDAEPYFDDGRDGWRYFFISSNVLGGCKGTTGPSSINPQTGKPYGSQF
2dsnA           --------RANDAPIVLLHGFTGWGREEMFGFKYWGGYRTYTLAVGPLSSNWDRACEAYARFGRTYPGLL
1eb8A           --------KMVTAHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQQINSFDEYSEPLLTFL
1cuaA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLPRGTSSAAIREMLGLFQQA
3dyiA           -----FEYEGTDTGVVLLHAYTGSPNDMNFMARALQGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESS
2dhdA           --RAHYLDEGNSDVFLCLHGEPTWSYLYRKMIPVFAGARVIAPDFFGFGKSDPVDEEDYTFEFHRNFLLA
3dqzB           ---------------VLVHNAYHGAWIWYKLKPLLEGHRVTAVELAASGIDPRPIQAVETEYSKPLIETL
3dqzA           ---------------VLVHNAYHGAWIWYKLKPLLEGHRVTAVELAASGIDPRPIQAVETEYSKPLIETL
3eblC           --GLEVRIYRAFPVIIFFHGGSFVHSSASSTIYDSLLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVM
3d2aA           ------------NPVVMVHGIGGASFNFAGIKSYLVGWSRDKLYAVDFWDKTGTN-YNNGPVLSRFVQKV
1beeA           --RAHYLDEGNSDVFLCLHGEPTWSYLYRKMIPVFAGARVIAPDFFGFGKSDKPVDEEDFEFHRNFLLAL
1a7uA           --DLYYEDHGAGQPVVLIHGFPLSGHSWERQSAALLGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
1cuuA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
2czqA           --------ACPQYVLINTRGTGEPQGQSAGFRTMNSTAALSGGTIYNTVYTADFSQNSAAGTADIIRRIN
1cqwA           --RMHYVDVGPGTPVLFLHGNPTSSYLWRNIIPHVASHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAF
3d59A           ---------EKYPLVVFSHGLGAFRTLYSAIGIDLAGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWL
1e89A           --------KMVTAHFVLIHTICHGAWIWHKLKPALEGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLT
3d5eB           -----LRPGEKYPLVVFSHGLGAFRTLYSAIGIDLAGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWL
1cubA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
3dkrA           -----FEYEGTDTGVVLLHAYTGSPNDMNFMARALSGYGVYVPLFSGHGTVILTKGNPDIWWAESSAAVA
1cuhA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLPRGTSSAAIREMLGLFQQA
1cugA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
1cvlA           -----DTYAATRYPVILVHGLAGTDKFANVVDYWYGGAKVYVANLSGFQSD--DGPNGRGEQLLAYVKQV
1cexA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
3d2cA           ------------NPVVMVHGIGGSSSNFEGIKSYLVGWSRDKLYAVDFWDKTGT-NYNNGPVLSRFVQKV
3bxpA           -DQISDFETAVDYPIIICPGGGFTYHSGREEAPIATAGHTVVLNYQLIVGDQSVYPWALQQLGATIDWIT
3d2bA           ------------NPVVMVHGIGGASSNFAGIKSYLVGWSRDKLYAVDFWDKTGT-NYNNGPVLSRFVQKV
3dcnA           --ETGSSSACPKVIYIFARASTEPGNMGISAGPIVADVWVQGVGGPYLADLASNFLPAAINEARRLFTLA
3b5eB           --PYRLLGAGKEECLFLLHGSGVDETTLVPLARRIATATLVAARGRIPQEDGFRWFERIDPTRFEQKSIL
1cufA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
1auoA           --------KPADACVIWLHGLGADRYDFMPVAEALQLLTTRFVLPQAPTRVTINGGYEMPSWYDIKAMSP
1dwqA           --------KMVTAHFVLIHTICHGAWIWHKLKPALAGHKVTALDMAASGIPRQIEQINSFDEYSEPLLTF
1cuxA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
2cutA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
2cbgA           --HVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNKAAVYGFHFIEEDSRIEQYVSRITEIQPE-----
1agyA           --INGNSASCRDVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
3dltA           -----FEYEGTDTGVVLLHAYTGSPNDMNFMARALQGYGVYVPLFSGHGTVEPLDILTKGWWAESSAAVA
3b5eA           --PYRLLGAGKEECLFLLHGSGVDETTLVPLARRIATLVAARGRIPQEDGFRWFERIDPTRFEQKSILAE
3deaA           ----GSSSACPKVIYIFARASTEPGNMGISAGPIVADVWVQGVGGPYLADLASNFLPDGTSSAAINEARR
3c8hA           ---------VERPLAVLLDGEFWAQSPVWPVLTSLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELL
1bu8A           ---------LDRKTRFIVHGFIDKGEDGWLLDMCKEKVNCICVDWRRGSRTEYTQASYNTRAFLVQVLST
1cqzA           ----------------------------------------------------------------------
3deaB           --ETGSSSACPKVIYIFARASTEPGNMGISAGPIVADVWVQGVGGPYLADLASNFLPDGINEARRLFTLA
3dnmD           ---------AGAAHILYFHGGGYISGSPSTHLVLTTQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALL
3c8hB           -----------RPLAVLLDGEFWAQSPVWPVLTSLTPAVYVLIDAIDTTHRAHELPCNADELLPLVKVIA
1cuyA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLPRGTSSAAIREMLGLFQQA
3d3nB           --WLDQISDFEAYPIIICPGGGFTYHSGREEAPIATAGHTVVLNYQLIVGDQSVYPWALQQLGATIDWIT
1cuvA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNFLPRGTSSAAIREMLG
1ek1A           ----------------------------------------------------------------------
1cuzA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATGGDNALPRGTSSAAIREMLG
3dd5C           --ETGSSSACPKVIYIFARASTEPGNMGISAGPIVADVWVQGVGGPYLADLASNFLPDGTSSAAINEARR
3dd5A           --ETGSSSACPKVIYIFARASTEPGNMGISAGPIVADVWVQGVGGPYLADLASNFLPDGTSSAAINEARR
2dxcC           --KAVGVNWVTSPPTQFGTPSDYCNLRVLADSPT-LKHVVVCTLSYPRPILGQSPEWYRSPNYRRRLVRW
3bjrA           --QLTGYLHTNLPAIIIVPGGSYTHIPVAQAESLAAGYQAFYLEYTLLTDQQPLAPVLDLGRAVNLLRQH
3bxpB           ---------AVDYPIIICPGGGFTYHSGREEAPIATAGHTVVLNYQLIVGDQSVYPWALQQLGATIDWIT
1cuwA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLADNFLPRGTSSAAIREMLG
3d3nA           ----DQISDAVDYPIIICPGGGFTYHSGREEAPIATAGHTVVLNYQLIVGDQSVYPWLGATIDWITTQAS
3ed1A           --------AEPFPVIIFFHGGSFVHSSASSTIYDSLKGVVVSVNYRRAPEHRYPCAYDDGKWVMSQPFMR
1cujA           --INGNSASCADVIFIYARGSTETGNLGTLGPSIASGVWIQGVGGAYRATLGDNALPRGTSSAAIREMLG
1ac5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRAKVESWLHALKTGGTVLRLRV
3e3aB           IETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLYDARA
3c5wP           MYGDLPPPIMLIGHAMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENA
1cqzB           TFLDKLPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPFMPPDPDVSPMKVIRSIPVFNYQLYFQEP
2dstA           MMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAEVLS----------------------------
1a8qA           LTDLDLRDVTLVHSMGGGELARYVGRHGTGRLRSAVLLSAIPP---------------------------
3bf7A           LDALQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAV--SESDAQTR
3e0xB           EVTKHQKNITLIGYSGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFEKIYHNQLDNNYLLECIGGI
3c5vA           MYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENA
2d0dA           MDALEIEKAHIVGNSFGGGLAIATALRYSERVDRMVLMGAVGTRFDVTEGLNAVWGYTP--SIENMRNLL
3bwxA           LAQEGIERFVAIGTSLGGLLTLLAAANPARIAAAVLNDVGPEVSPEGLERIRGYVGQGRNFETWHAARAL
1cv2A           EALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELV
3cxuB           VVALLEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIFGEDHYISRFQV
2cjpB           VVALLEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIY-----------
3bf8A           LDAQQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYHVRRHDEIFAAIN------AVSESD
3e0xA           EVTKHQKNITLIGYSGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFEKIYHNQLDNNYLLECIGGI
1a8sA           IEHLDLRDAVLFGFSTGGGEVARYIGRHGTARVAKAGLISAVPPLMLKTEANPGGLPME-----------
1bn6A           IEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGREL
3dyvA           AAVAHMAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPIL----------------------------
1brtA           ETLDLQDAVLVGFSTGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDNPDGAAPQEFFDGIVAAVKA
1dwoB           EKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLES-----FPDWRD
1edeA           IERLDLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNACLMTDPVTQPAFSAFVTQPADGFTAWKYDL
3bf8B           LDAQQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQ
3e3aA           IETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYD
1c4xA           MNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPELIH
3bf7B           LDALQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYHVRRHDEIFAAINAV------SESD
1a88A           EALDLRGAVHIGHSTGGGEVARYVARAEPGRVAKAVLVSAVPPVMVKSDTNPDGLPLE------------
2cjpA           VVALLEAIAFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIY-----------
1eb8B           EKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLES-FPDARDTEYF
1ehyA           LDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPIQPDFESWYSQFHQLDMAVEVVGSSREVKK
1dwoA           EKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTYTVEKLLESFPDWRDTGETITTMKL
3bdiA           IRDYLKANGVARSVIGASGGGVITTLQYPDIVDGIIAVAPAWV---------------------------
3bdvA           ELSVCTQPVILIGHSFGALAACHVVQQGQEGIAGVLVAPAEPRFEIDDRIQASPLSVPTLTFASHNDPLS
1b6gA           ALIERLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNALMTDPVTQPAFSAFVTQPADGFTAWKYDLV
1be0A           IERLDLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNACLMTDPVTQPAFSAFVTQP-----------
3cxuA           AIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIF-----------
2cb9A           -----EGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADAYLPEA-----------
1broA           LETLDLQDAVVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDNPDGAAPQEFFDGIVAAVKA
2e3jA           LDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGP
1e89B           FLEKLPEKVIIVGEACAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLES-FPDWRDTEYF
1dwqB           LEKLPQGEKVIIVGESAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLES-----FPDWRD
3bdvB           ELSVCTQPVILIGHSFGALAACHVVQQGQEGIAGVLVAPAEPRFEIDDRI--------------------
1azwA           RTHLGVDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFELEWFYQEGASRL-----------
1eh5A           KDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAG
3ds8A           LKSRYGFTQDGVGHSNGGLALTYYAEDYAGDKTVPTL---------------------------------
2b61A           PNIVGISHLKAIIGGSFGGQANQWAIDYPDFDNIVNLCSSIYFSAE------------------------
2dsnA           PELKRGGRIHIIAHSQGGQTARMLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVL------------
1eb8A           EKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLES-----FPDARD
1cuaA           NTKCPDATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTV------------------------------
3dyiA           AAVAHMTAKFVFGLSLGGIFAMKALETLPGITAG------------------------------------
2dhdA           LIERLDLRNITLVVQWGGFLGLTLPMADPSRFKRLIIMNACLMT--------------------------
3dqzB           KSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNA------------------------------
3dqzA           KSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNA------------------------------
3eblC           SQPFMRARVFLSGDSSGGNIAHHVAVRAADEGVKVCGNILLNAM--------------------------
3d2aA           LDETGAKKVDIVAHSMGGANTLYYILDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDM
1beeA           IERLDLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNACLMTDPVTQPAFSAFVT-------------
1a7uA           LETLDLQDAVVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDNPDGAAPKE-----------
1cuuA           LFQQANTKLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLQNRGRIPNYPADRTKVFCNTGDLVCTGSL
2czqA           SGLAANVCYILQGYSQGAAATVVALQQLGTSGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNG
1cqwA           IEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIP-------------------------
3d59A           YLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLK---------------
1e89A           FLEKLPEKVIIVGEACAGLNIAIAADRYVDKIAAGVFHNSLLPDTV------------------------
3d5eB           YLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLK---------------
1cubA           LFQQANATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFG---------------------------
3dkrA           HMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSS-------------------------------
1cuhA           NTKCPDATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFG---------------------------
1cugA           LFQQANATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFG---------------------------
1cvlA           LAATGATKVNLIGHSQGGLTSRYVAAVAPQLVASVTTIGHRGSEFADFVQDVLKTDPTGLSSTVIAAFVN
1cexA           LFQQANATLIAGGYSQGAALAAASIEDLDSAIRDKIAGT-------------------------------
3d2cA           LDETGAKKVDIVAHSMGGANTLYYIKYGGNKVANVVTLGGANRLTTDKAPPGTDPNQKI-----------
3bxpA           TQASACQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVID-------------
3d2bA           LDETGAKKVDIVAHSMGGANTLYYILDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDM
3dcnA           NTKCPNAAIVSGGYSQGTAVMAGSISGLSTTIKNQIKGV-------------------------------
3b5eB           AETANLDHATFLGYSNGANLVSSLLLHPGIVRLAALLRPPVLD---------------------------
1cufA           LFQQANTTLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGYTKNLQNLGRIPNYPADRTKVFCNTGD
1auoA           ARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFSQGGA---------------------------
1dwqA           LEKLPQGEKVIIVGESAGLNIAIAADRYVDKIAAGVFHNTVHSPSYTVEKLLESFPDWRDTEYFTFTNIT
1cuxA           LFQQPDATYIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFG---------------------------
2cutA           LFQQPDATLIAGGYSQGAALAAASIEDLDSAIRDKIAG--------------------------------
2cbgA           ------GPYVLLGYSAGGNLAFEVVQQKGLEVSDFIIVDAYKKDQSITADLPEAVRETV-----------
1agyA           LFQQANATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGD
3dltA           HMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAE-------------
3b5eA           TAAFALDHATFLGYSNGANLVSSLLLHPGIVRLAALLRPPVLDHVPA-----------------------
3deaA           LFTLANAAIVSGGYSQGTAVMAGSISGLSTTIKNQIKG--------------------------------
3c8hA           PLVKVIAPFSDAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLE-------------
1bu8A           EMGYSPENVHLIGHSLGAHVVGEAGRRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSA
1cqzA           ----------------------------------------------------------------------
3deaB           NTKCPNAAIVSGGYSQGTAVMAGSISGLSTTIKNQIKGVVLFGYTKNLQNLGRIP---------------
3dnmD           KTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSN---------------
3c8hB           PFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLE-------------
1cuyA           NTKCPDATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGD
3d3nB           TQASAHQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQG--------------------------
1cuvA           LFQQANATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGIPNYPADRTKVFCNTGDLVCTGSLIVA
1ek1A           ----------------------------------------------------------------------
1cuzA           LFQQANATLIAGGYSQGAALAAASIEDLDSAIRDKIA---------------------------------
3dd5C           LFTLPNAAIVSGGYSQGTAVMAGSISGLSTTIKNQIKGVNLGRIPNFETSKTEVYCDIADAVCYGTLFIL
3dd5A           LFTLANTAIVSGGYSQGTAVMAGSISGLSTTIKNQIKGVVLFGYTKNLQNLGRIPNFETSKTEVYCDIAD
2dxcC           PRQVLPSEVQIRVADSNQKTRYIVMPVRPEGTDGWTEDQLAE----------------------------
3bjrA           AAEWHIDPQQPAGFSVGGHIVALYNDYWATRVATELNVTPALKPNNVVLGYPVIS---------------
3bxpB           TQASAHQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVID-------------
1cuwA           LFQQANTTLIAGGYSQGAALAAASIEDLDSAIRDKIAGTNRGRIPNYPADRTKVFCNTGDLVCTGSLIIL
3d3nA           AHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVID-------------
3ed1A           SGGDAQARVFLSGDSSGGNIAHHVAVRAADEGVKVC----------------------------------
1cujA           LFQQANATLIAGGYCQGAALAAASIEDLDSAIRDKIAGTNRGRIPNYPADRTKVFCNTGDLVCTGSLIVA
1ac5A           ---------ILSGESYAGQYIPFFANAILNHNKFSKIDGDTYDLK-------------------------


                         +         .         .         .         .         *         .:210
query           ALPWVFGRGFLEAHPXXXXXXXXXXXXXXXPTKTAQERLLLGFLTLEDXXXXXXXXXXXXXXXYGTEDLL
3e3aB           RLLENFSRKTLNDDV--AVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVV
3c5wP           IEWSVKSGIRNLESARVSMVGQVKQCKPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRL
1cqzB           GVAEAELEKNMSRTF-------------------------------------------------------
2dstA           ----------------------------------------------------------------------
1a8qA           ----------------------------------------------------------------------
3bf7A           QQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEK----IPAWDHPALFIPGGNSPY
3e0xB           DNPLSEKYFETLEKDPDIINDLIACKLIDLVDNLKIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKI
3c5vA           IEWSVKSGQIRNLESARVSMVGQVKQCEPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDR
2d0dA           DIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQV
3bwxA           QESSGDVYPDWDITQWLRYAKRIVLGSSGRIAFDYDKIAPVGATPQVDWPLFDALATRPLLVLRGETSDI
1cv2A           LQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRADVVAIARDYAGWLSESPIPKLFINAEPGAL
3cxuB           PGEI------------------------------------------------------------------
2cjpB           ----------------------------------------------------------------------
3bf8A           AQTRQQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPY
3e0xA           DNPLSEKYFETLEKD-------------------PDIINDLIACKLIDLVDNLKNIDIPVKAIVAKDELL
1a8sA           ----------------------------------------------------------------------
1bn6A           IID-------------------------------------------------------------------
3dyvA           ----------------------------------------------------------------------
1brtA           DRYAFYTGFFNDFYNLDENLGTRISEEAVRNSWNTAASAAAPTTWYTDFRADIPRIDVPALILHGTGDRT
1dwoB           TEYFTFMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
1edeA           VWAPTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNGQTFMAIGMKDKL
3bf8B           AAAIMR------QHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPY
3e3aA           ARARLLENFSRKTLNDDVAVGDWIAMFSMWPKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVV
1c4xA           SFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRI
3bf7B           AQTRQQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPY
1a88A           ----------------------------------------------------------------------
2cjpA           ----------------------------------------------------------------------
1eb8B           TFTNITGKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
1ehyA           YFKHFFDHWSLLTEEELEVHVDNCMKPDNIHGGFNYYRANIRPDAALWTDLDHTMSDLPVTMIWGLGDTC
1dwoA           GFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEK---------GYGSIKKVYIWTDQDKI
3bdiA           ----------------------------------------------------------------------
3bdvA           ----------------------------------------------------------------------
1b6gA           TPSAPTLTEAEASAYAAPFPDTSYQAGVRKFPKMVAQRDQAIDISTEAISFWQNDWNGQTFMAIGMKDKL
1be0A           ----------------------------------------------------------------------
3cxuA           ----------------------------------------------------------------------
2cb9A           ----------------------------------------------------------------------
1broA           DRYAFYTGFFNDFYN-------------------------------------------------------
2e3jA           GRVW------------------------------------------------------------------
1e89B           TFTNITGKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
1dwqB           TEYFTFMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
3bdvB           ----------------------------------------------------------------------
1azwA           ----------------------------------------------------------------------
1eh5A           AYNKAIQERLVQAEY-------------------------------------------------------
3ds8A           ----------------------------------------------------------------------
2b61A           ---------------------------------------------------------------SVTTDQL
2dsnA           ----------------------------------------------------------------------
1eb8A           TEYFTFMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
1cuaA           ----------------------------------------------------------------------
3dyiA           ----------------------------------------------------------------------
2dhdA           ----------------------------------------------------------------------
3dqzB           ----------------------------------------------------------------------
3dqzA           ----------------------------------------------------------------------
3eblC           ----------------------------------------------------------------------
3d2aA           IVMNYLSRLDGARNV-------------------------------------------------------
1beeA           ----------------------------------------------------------------------
1a7uA           ----------------------------------------------------------------------
1cuuA           IVAAPHLAYGPDARG-------------------------------------------------------
2czqA           LSVAYQGS--------------------------------------------------------------
1cqwA           ----------------------------------------------------------------------
3d59A           ----------------------------------------------------------------------
1e89A           ----------------------------------------------------------------------
3d5eB           ----------------------------------------------------------------------
1cubA           ----------------------------------------------------------------------
3dkrA           ----------------------------------------------------------------------
1cuhA           ----------------------------------------------------------------------
1cugA           ----------------------------------------------------------------------
1cvlA           VFGTLVSSSH------------------------------------------------------------
1cexA           ----------------------------------------------------------------------
3d2cA           ----------------------------------------------------------------------
3bxpA           ----------------------------------------------------------------------
3d2bA           IVMNYLSRLDGARNV-------------------------------------------------------
3dcnA           ----------------------------------------------------------------------
3b5eB           ----------------------------------------------------------------------
1cufA           LVCTGSLIVAA-----------------------------------------------------------
1auoA           ----------------------------------------------------------------------
1dwqA           GETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKI
1cuxA           ----------------------------------------------------------------------
2cutA           ----------------------------------------------------------------------
2cbgA           ----------------------------------------------------------------------
1agyA           LVCTGSLIVAA-----------------------------------------------------------
3dltA           ----------------------------------------------------------------------
3b5eA           ----------------------------------------------------------------------
3deaA           ----------------------------------------------------------------------
3c8hA           ----------------------------------------------------------------------
1bu8A           PIIPYLGFGMSQKV--------------------------------------------------------
1cqzA           ---------------------------------------------------------------TAEKDIV
3deaB           ----------------------------------------------------------------------
3dnmD           ----------------------------------------------------------------------
3c8hB           ----------------------------------------------------------------------
1cuyA           LVCTGSLIVAA-----------------------------------------------------------
3d3nB           ----------------------------------------------------------------------
1cuvA           APHLAYGPDARGPAP-------------------------------------------------------
1ek1A           ---------------------------------------------------------------TAEKDIV
1cuzA           ----------------------------------------------------------------------
3dd5C           PAHFLYQTDAAVAAP-------------------------------------------------------
3dd5A           AVCYGTLFILP-----------------------------------------------------------
2dxcC           ----------------------------------------------------------------------
3bjrA           ----------------------------------------------------------------------
3bxpB           ----------------------------------------------------------------------
1cuwA           APHFAYGPDARGPAP-------------------------------------------------------
3d3nA           ----------------------------------------------------------------------
3ed1A           ----------------------------------------------------------------------
1cujA           APHLAYGPDARGPAP-------------------------------------------------------
1ac5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FPKAYASNXXXXXXXXXXXXPAGHAAPIEAPLAFARAVRAFLEEVYA
3e3aB           TPPYLGVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASV--
3c5wP           DKDLTIGQMQGKFQMQVLPQ-CGHAVHEDAPDKVAEAVATFLIRH--
1cqzB           -----------------------------------------------
2dstA           -----------------------------------------------
1a8qA           -----------------------------------------------
3bf7A           VSEQYRDDAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRRYLND---
3e0xB           FETG------------------KHFLLVVNAKGVAEEIKNFI-----
3c5vA           LDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRH--
2d0dA           VPLSSSLRELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNE---
3bwxA           LSAQTAAKASRPGVELVTLPRIGHAPTLDEPESIA-AIGRLLERV--
1cv2A           TTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRL--
3cxuB           --------------------GAAHFVSQERPHEISKHIYDFIQK---
2cjpB           --------------------GAAHFVSQERPHEISKHIYDFIQK---
3bf8A           VSEQYRDDAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRRYLND---
3e0xA           TLVEYSEIKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI-----
1a8sA           ---------------------APHGLTDTHKDQLNADLLAFIK----
1bn6A           -----------------------------------------------
3dyvA           -----------------------------------------------
1brtA           LPIENTARKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLAK---
1dwoB           FLPDFQRWANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADA---
1edeA           LGPDVMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAET---
3bf8B           VSEQYRDDAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRRYLND---
3e3aA           TPPYLGREDALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA
1c4xA           VPLDTSLYKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHF-----
3bf7B           VSEQYRDDAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRRYLND---
1a88A           ---------------------LPHGMLSTHPEVLNPDLLAFVK----
2cjpA           --------------------GAAHFVSQERPHEISKHIYDFIQK---
1eb8B           FLFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADA---
1ehyA           VPYAPLVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR----
1dwoA           FLPDFQRWANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVAD----
3bdiA           -----------------------------------------------
3bdvA           -----------------------------------------------
1b6gA           LGPDVMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAET---
1be0A           ---------------------AGHFVQEFGEQVAREALKHFAET---
3cxuA           --------------------GAAHFVSQERPHEISKHIYDFIQK---
2cb9A           -----------------------------------------------
1broA           -----------------------------------------------
2e3jA           -----------------------------------------------
1e89B           FLPDFQRWANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADA---
1dwqB           FLPDFQRWANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADA---
3bdvB           -----------------------------------------------
1azwA           -----------------------------------------------
1eh5A           -----------------------------------------------
3ds8A           -----------------------------------------------
2b61A           FKPIDLEQSGVDLHFYEFPSDYGHDAFLVDYDQFEKRIRDGL-----
2dsnA           -----------------------------------------------
1eb8A           FLPDFQRWANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVAD----
1cuaA           -----------------------------------------------
3dyiA           -----------------------------------------------
2dhdA           ---------------------AGHFVQEFGEQVAREALKHFAET---
3dqzB           -----------------------------------------------
3dqzA           -----------------------------------------------
3eblC           -----------------------------------------------
3d2aA           -----------------------------------------------
1beeA           ---------------------AGHFVQEFGEQVAREALKHFAET---
1a7uA           -----------------------------------------------
1cuuA           -----------------------------------------------
2czqA           -----------------------------------------------
1cqwA           ---------------------GLHYLQEDNPDLIGSEIARWLPGL--
3d59A           -----------------------------------------------
1e89A           -----------------------------------------------
3d5eB           -----------------------------------------------
1cubA           -----------------------------------------------
3dkrA           -----------------------------------------------
1cuhA           -----------------------------------------------
1cugA           -----------------------------------------------
1cvlA           -----------------------------------------------
1cexA           -----------------------------------------------
3d2cA           -----------------------------------------------
3bxpA           -----------------------------------------------
3d2bA           -----------------------------------------------
3dcnA           -----------------------------------------------
3b5eB           -----------------------------------------------
1cufA           -----------------------------------------------
1auoA           -----------------------------------------------
1dwqA           FLPDFQRIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVAD----
1cuxA           -----------------------------------------------
2cutA           -----------------------------------------------
2cbgA           -----------------------------------------------
1agyA           -----------------------------------------------
3dltA           -----------------------------------------------
3b5eA           -----------------------------------------------
3deaA           -----------------------------------------------
3c8hA           -----------------------------------------------
1bu8A           -----------------------------------------------
1cqzA           LRPEMSKNMEKWIPFLKRGHDCGHWTQIEKPTEVNQILIKWLQT---
3deaB           -----------------------------------------------
3dnmD           -----------------------------------------------
3c8hB           -----------------------------------------------
1cuyA           -----------------------------------------------
3d3nB           -----------------------------------------------
1cuvA           -----------------------------------------------
1ek1A           LRPEMSKNMEKWIPFLKRGHDCGHWTQIEKPTEVNQILIKWLQT---
1cuzA           -----------------------------------------------
3dd5C           -----------------------------------------------
3dd5A           -----------------------------------------------
2dxcC           -----------------------------------------------
3bjrA           -----------------------------------------------
3bxpB           -----------------------------------------------
1cuwA           -----------------------------------------------
3d3nA           -----------------------------------------------
3ed1A           -----------------------------------------------
1cujA           -----------------------------------------------
1ac5A           -----------------------------------------------