[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80708.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1adjA.bssp"
#ERROR : Can't open dsspfile "1atiB.bssp"
#ERROR : Can't open dsspfile "1b76A.bssp"
#ERROR : Can't open dsspfile "3e9hA.bssp"
#ERROR : Can't open dsspfile "1atiA.bssp"
#ERROR : Can't open dsspfile "1e1oA.bssp"
#ERROR : Can't open dsspfile "1bbuA.bssp"
#ERROR : Can't open dsspfile "1asyA.bssp"
#ERROR : Can't open dsspfile "3bjuC.bssp"
#ERROR : Can't open dsspfile "2cimA.bssp"
#ERROR : Can't open dsspfile "2dq2A.bssp"
#ERROR : Can't open dsspfile "1bbwA.bssp"
#ERROR : Can't open dsspfile "2cimB.bssp"
#ERROR : Can't open dsspfile "2du5A.bssp"
#ERROR : Can't open dsspfile "2du3A.bssp"
#ERROR : Can't open dsspfile "1e1tA.bssp"
#ERROR : Can't open dsspfile "3cmqA.bssp"
#ERROR : Can't open dsspfile "11asA.bssp"
#ERROR : Can't open dsspfile "3bjuD.bssp"
#ERROR : Can't open dsspfile "2du3B.bssp"
#ERROR : Can't open dsspfile "2du5B.bssp"
#ERROR : Can't open dsspfile "2cjaB.bssp"
#ERROR : Can't open dsspfile "1eiyA.bssp"
#ERROR : Can't open dsspfile "2du7A.bssp"
#ERROR : Can't open dsspfile "2cjaA.bssp"
#ERROR : Can't open dsspfile "2du4A.bssp"
#ERROR : Can't open dsspfile "2d6fD.bssp"
#ERROR : Can't open dsspfile "2dq3A.bssp"
#ERROR : Can't open dsspfile "3dsqA.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "2e3cA.bssp"
#ERROR : Can't open dsspfile "3bamA.bssp"
#ERROR : Can't open dsspfile "2dq0A.bssp"
#ERROR : Can't open dsspfile "1c0aA.bssp"
#ERROR : Can't open dsspfile "2bamB.bssp"
#ERROR : Can't open dsspfile "1bhmB.bssp"
#ERROR : Can't open dsspfile "3cw4A.bssp"
#ERROR : Can't open dsspfile "2cjbA.bssp"
#ERROR : Can't open dsspfile "2cj9B.bssp"
#ERROR : Can't open dsspfile "3b6nA.bssp"
#ERROR : Can't open dsspfile "2cjbB.bssp"
#ERROR : Can't open dsspfile "3bjuB.bssp"
#ERROR : Can't open dsspfile "2eg5E.bssp"
#ERROR : Can't open dsspfile "3dsqB.bssp"
#ERROR : Can't open dsspfile "2bamA.bssp"
#ERROR : Can't open dsspfile "2cj9A.bssp"
#ERROR : Can't open dsspfile "1b8aA.bssp"
#ERROR : Can't open dsspfile "3bjuA.bssp"
#ERROR : Can't open dsspfile "1bhmA.bssp"
#ERROR : Can't open dsspfile "3d1tB.bssp"
#ERROR : Can't open dsspfile "2d32C.bssp"

## Summary of PDB Search
:421
    4e-64 100%  1adjA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    7e-34  16%  1atiB  [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
    3e-32  15%  1b76A  [d.104.1 - c.51.1] PROTEIN (GLYCYL-TRNA SYNTHETASE)
    4e-32  13%  3e9hA  [x.x.x] LYSYL-TRNA SYNTHETASE
    3e-31  18%  1atiA  [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
    1e-30  14%  1e1oA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    3e-30  10%  1bbuA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    1e-29  12%  1asyA  [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
    7e-29  14%  3bjuC  [x.x.x] LYSYL-TRNA SYNTHETASE
    6e-28   8%  2cimA  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-27  14%  2dq2A  [x.x.x] SERYL-TRNA SYNTHETASE
    2e-27  12%  1bbwA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    3e-27  10%  2cimB  [x.x.x] SERYL-TRNA SYNTHETASE
    4e-27  11%  2du5A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    4e-27  11%  2du3A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    6e-27  12%  1e1tA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    7e-27  11%  3cmqA  [x.x.x] PHENYLALANYL-TRNA SYNTHETASE, MITOCHONDRIAL
    8e-27   9%  11asA  [d.104.1] ASPARAGINE SYNTHETASE
    1e-26  15%  3bjuD  [x.x.x] LYSYL-TRNA SYNTHETASE
    1e-26  12%  2du3B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    4e-26  11%  2du5B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    8e-26  12%  2cjaB  [x.x.x] SERYL-TRNA SYNTHETASE
    6e-23  15%  1eiyA  [a.2.7 - d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    1e-22  12%  2du7A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-22  13%  2cjaA  [x.x.x] SERYL-TRNA SYNTHETASE
    6e-22  14%  2du4A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    6e-22  12%  2d6fD  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    1e-21  17%  2dq3A  [x.x.x] SERYL-TRNA SYNTHETASE
    3e-20  16%  3dsqA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    8e-20  14%  1b70A  [d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    1e-19  17%  2e3cA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    5e-19   9%  3bamA  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BAMHI)
    1e-18  17%  2dq0A  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-18  17%  1c0aA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
    3e-18  10%  2bamB  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    4e-17   9%  1bhmB  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    6e-17   9%  3cw4A  [x.x.x] POLYMERASE BASIC PROTEIN 2
    7e-17  11%  2cjbA  [x.x.x] SERYL-TRNA SYNTHETASE
    8e-17  12%  2cj9B  [x.x.x] SERYL-TRNA SYNTHETASE
    8e-17  11%  3b6nA  [x.x.x] 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE
    4e-16  12%  2cjbB  [x.x.x] SERYL-TRNA SYNTHETASE
    7e-16  15%  3bjuB  [x.x.x] LYSYL-TRNA SYNTHETASE
    5e-14  20%  2eg5E  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    5e-14  19%  3dsqB  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    1e-13  10%  2bamA  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    2e-13  10%  2cj9A  [x.x.x] SERYL-TRNA SYNTHETASE
    4e-10  14%  1b8aA  [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
    3e-09  11%  3bjuA  [x.x.x] LYSYL-TRNA SYNTHETASE
    1e-07  10%  1bhmA  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    1e-07  10%  3d1tB  [x.x.x] UPF0343 PROTEIN NGO0387
    4e-04   6%  2d32C  [x.x.x] GLUTAMATE--CYSTEINE LIGASE
:421

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
1adjA           -TARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
1atiB           --YGGLQGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYSGH--EATFADPMVDWTP
1b76A           EIYGGLQGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYHEATFADPMVDNAKARYW
3e9hA           ---YLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAA---------ARPFITHHN
1atiA           EIYGGLQGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYS--GHEATFADPMVDNWT
1e1oA           ------LIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGA---------SARPFITHHN
1bbuA           RQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAA---------ARPFITHHN
1asyA           LDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGG-----------SSVFEVT
3bjuC           RQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAV---------AKPFITYHN
2cimA           LKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKS--GHAKGVYPEIYYVCP
2dq2A           ---VSGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEE-----GSTSFEDFEDVIYK
1bbwA           RQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQ------------VIPAARPFITHHN
2cimB           -----SRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKS--GHAKGVYPEIYYVCP
2du5A           KPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKVFPEFKELK
2du3A           KPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKVFPEFKELK
1e1tA           RQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGAS---------ARPFITHHN
3cmqA           ------RVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNFDSLLIPADHP
11asA           -----------------RQISFVKSHSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAE--KAVQVKVKA
3bjuD           RQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVA---------KPFITYHN
2du3B           -----------FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALALATLPKPNLK
2du5B           -----------FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALALATLPKPNLK
2cjaB           ----SSRGQWIHGPQSARIFRTFEKIVLEELLEPLGYREIFPKLVTWEVWKSGIYYVCPPQTRDPDYWEE
1eiyA           ------LPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFW
2du7A           ---------------------ETIERLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLAG
2cjaA           ----SSRGQWIHGPQSARIFRTFEKIVLEELLEPLGYREIFPKLVTWEVWKSGIYYVCPPQTRDPDYWEE
2du4A           -----------FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREAYLATLPKFKELK
2d6fD           LNMRVVDEFHTMRKQVIDGSNTGGFQRTGLVATDGHLETPQGTVKIENLCLEEDAARRIRETGDGVVFRL
2dq3A           ---LSGSRFTVIAGWGARLERALIN-FLDLHTKKGYKEICPPHLVKPEILI-----GTGQLPKFEEDLYK
3dsqA           ----------------------------KALHQQGFVQVVTPTIITKSALAKMTIG--EPLFSQVFWLDG
1b70A           ------PGASLFSGGL-HPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFW
2e3cA           -----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT----ELSKQIF
3bamA           GVVPIKELCYTLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKR-----VGMEFETGNISSAH
2dq0A           ----------YLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGS--TSFEDFEDVIYKVED
1c0aA           LKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGA---------RDYLVPSRV
2bamB           GVVPIKELCYTLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVG-----MEFETGNISSAH
1bhmB           ---PIKELCYTLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKR-----VGMEFETGNISSAH
3cw4A           ------------------------------------------------------------VNTYQW---I
2cjbA           LKRGSSRGQWIHGPQSARIFRTFEKIVLELLEPLGYREMIFPKLVTWEVWMKSGH--AKGVYPEIYYVCP
2cj9B           LKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSGH--AKGVYPEIYYVCP
3b6nA           ----------------------------------------------------------------------
2cjbB           LKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSGH--AKGVYPEIYYVCP
3bjuB           ------LILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAV---------AKPFITYHN
2eg5E           ----------------------------------------LPVYIPSAEEVKIVEEEGSFEILYLETFKD
3dsqB           ----------------------------KALHQQGFVQVVTPTIITKSALAK--------MTHPLFSQVF
2bamA           -----------------WYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVG-----MEFETGNISSAH
2cj9A           LKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSEIYYVCPPQTRDPDYWE
1b8aA           ----------------------------------------------------------------------
3bjuA           ----------------------------------------------------------------------
1bhmA           --------------------------------------------------------VGMEFETGNISSAH
3d1tB           --SRFVALEQHTEVLDFAQLHRLTAEVALLDSRAGKISVSFPFFRKKTAPVSGI---RSLLDYDVSLTGE
2d32C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
1adjA           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
1atiB           PRYFNMMFQDPETAQGIFVNFKNVLDATSRGFGIAQIGKAFRNERNFIFRVREFEQMEIEYFVRPGEDEY
1b76A           TPPRYFNMMFQETAQGIFVNFKNVLDATKLGFGIAQIGKAFRNEITPIFRVREFEQMEIEYFVRPGEDEY
3e9hA           ALDMTLYMRIAIELHLKRLIVGG-------LEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIM
1atiA           RGGRGLLLRPETAQGIFVNFKNVLDATSRKGFGIAQIGKAFRNERNFIFRVREFEQMEIEYFVRPGEDEY
1e1oA           ALDLDMYLRIAPELYLKRLVVGG-------FERVFEINRNFRNEGIS-VHNPEFTMMELYMAYADYHDLI
1bbuA           ALDLDMYLRIAPELYLKRLVVGG-------FERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLI
1asyA           YFKGKAYLAQSPQFNKQQLIVAD-------FERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYHEV
3bjuC           ELDMNLYMRIAPELYHKMLVVGG-------IDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLM
2cimA           PQTRDPDMCYAQCPPFWMYVAGETLPNEEIPVKVFDRSGTSHRYGGIHGIERVDEFHRIEIVWIGTKEEV
2dq2A           VEDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGKDHQFHKVEQFVYSRPEESWH
1bbwA           ALDLDMYLRIAPELYLKRLVVGG-------FERVFEINRNFRNEGISV-HNPEFTMMELYMAYADYKDLI
2cimB           PQTRDYKVTHEVPTKLIKEKIAEPIGGMCYPVKVFDRSGTSHRYGGIHGIERVDEFHRIEIVWIGTKEEV
2du5A           PISSTLTLRSHMTTGWFITLSHI-ADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCV--LVDEELSV
2du3A           PISSTLTLRSHMTTGWFITLSHI-ADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCV--LVDEELSV
1e1tA           ALDLDMYLRIAPELYLKRLVVGG-------FERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLI
3cmqA           SRKKGDNYYLNRTHMLRAHTSAHQWDLLHALDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFA
11asA           LPDAQFEVVHSLAKWKRQTLGQHDFS---AGEGLYTHMKALRPDEDRLSPLHSVDQWDWERVMGDGERQF
3bjuD           ELDMNLYMRIAPELYHKMLVVGG-------IDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLM
2du3B           PISSTLTLRSHMTTGWFITL-SHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCV--LVDEELSV
2du5B           PISSTLTLRSHMTTGWFITL-SHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCV--LVDEELSV
2cjaB           VADYYKVTHEVPTKLIKEKIAEPILPNEEIPVKVDRSGTSHRYEIHGIERVDEFHRIEIVWIGTKEEVLK
1eiyA           LTGEGLLLRTHTSPMQVRYMVAHTP-----PFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGE--GIAM
2du7A           LPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDD-LVFEIAKALNVSNEMGLKVLET
2cjaA           VADYYKVTHEVPTKLIKEKIAEPIGPNEEIPVKVFRSGTSHRYEIHGIERVDEFHRIEIVWIGTKEEVLA
2du4A           PISSTLTLRSHMTTGWFITLSHI-ADKLPLPIKLFSIDRCFRREGEDATRLYTYFSA--SCVLVDEELSV
2d6fD           DRLGIPLVEI-TTDPSMSDPQQL-------REVAYQIGQILRSTRVK--RGLGTIRQDLNISIRDGARVE
2dq3A           CERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIQFDKVELVKIVHPDTSYD
3dsqA           KKC----LRPMLAPNLYTLWRELERLW-DKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERH
1b70A           LTGEGFRLEPLGEETHTSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAH
2e3cA           RVDKNFCLRPMLAPNLYNYLRKL-DRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGS--GCTR
3bamA           RSMNKLLLGLKHGEIDLAIILMPIKQ---LAYYLTDRVTNFEELEPYFEEGQPFIFIGFNAEAYNSNVPL
2dq0A           ED---LYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGRVHQFHKVEQFVYSRPEESWE
1c0aA           HKGKFYALPQSPQLFKQLLMMSG-------FDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVR
2bamB           RSMNKLLLGLKHGEIDLAIILMPIKQ---LAYYLTDRVTNFEELEPYFEEGQPFIFIGFNAEAYN---SN
1bhmB           RSMNKLLLGLKHGEIDLAIILMPIKQ---LAYYLTDRVTNFEELEPYFEEGQPFIFIGFNAEAYNSNVPL
3cw4A           IRNWETVKIQWSQNPTMLYNKMEFEPFQSLPKAIRGQYSGFVRTLFQQMDTAQIIKLLPFAAAPPKQ--S
2cjbA           PQTRYYKVTHEVPTKLIKEKIAEPIAGETLPVKVFDRSGTSHRYIHGIERVDEFHRIEIVWIGTKEEVLK
2cj9B           PQTPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRSGTSHRYGGIHGRVDEFHRIEIVWIGTKEEVLK
3b6nA           ---------------------------------------QIRVGPPEKQSFKRLTIGGVPVETISHSDGD
2cjbB           PQTRDYKVTHEVPTKLIKEKIAEPPNEEIPVKVFDRSGTSHRYEGGIHGIERVDEFHRIEIVWIGTKEEV
3bjuB           ELDMNLYMRIAPELYHKMLVVGG-------IDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLM
2eg5E           AGFSIDHIKAEYVASSVRAVYEPILASHFGEAIIPFAKHAAKVLPLGKGFYNNLIIS-------------
3dsqB           WLDGKKCLRPMLAPNLYTLWRELERLW-DKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERH
2bamA           RSMNKLLLGLKHGEIDLAIIL-MPIKQLA--YYLTDRVTNFEELEPYFEEGQPFGFNAEAYNSNVPLIPK
2cj9A           EVADYYKVTHEVPTKLIKEKIAEPIGGMEIPVKVFDRSGTSHRYGGIHGIERVDEFHRIEIVWIGTKEEV
1b8aA           -------------------QLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIEDEEEV
3bjuA           ---------------------------------------QFRNEGIDLTHNPEFTTCEFYMAYADYHDLM
1bhmA           RSMNKLLLGLKHGEIDLAIILMPIKQ---LAYYLTDRVTNFEELEPYFEEGQPFIFIGFNAEAYNS---N
3d1tB           KD---GAYGHSKVIPVTSLCPCSKE--------------ISQYGA---HNQRSHVTVSLT----------
2d32C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKS
1adjA           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLEENPMRILDSKS
1atiB           RYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKA------TVDILYRFPHGSLELEG----------
1b76A           RYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYA--------------------------------KAT
3e9hA           KLTENLIAHIATEVLGTQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPH
1atiA           RYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAATVDILYRFPHGSLELEG-----------------
1e1oA           ELTESLFRTLAQEV-LGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPEMADLDNFDAAKALAESIGITV
1bbuA           ELTESLFRTLAQDILGKTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEK
1asyA           LDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLST
3bjuC           EITEKMVSGMVKHI-TGSYKVTYHPDGPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKA
2cimA           LKCHDRYMHIFNDILDIEWRKARVT-NTVGTTDYEACLPYRGPDLEFQNVSINGDKYPKGFNVKLQSGDE
2dq2A           EKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFR
1bbwA           ELTESLFRTLAQDI-LGKTEVTYGDVTLDFGKPFEKLTMREAIKKYETDMADLDNFDSAKAIAESIGIHV
2cimB           LKCHDRYMHIFNDILDIEWRKARVTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQSGDE
2du5A           DDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTA
2du3A           DDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTA
1e1tA           ELTESLFRTLAQEVLGTTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEK
3cmqA           GIKDGESLQLFEQSSKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINF
11asA           STLKSTVEAIWAGIKATAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGI
3bjuD           EITEKMVSGMVKHI-TGSYKVTYHPDGPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKA
2du3B           DDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTA
2du5B           DDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTA
2cjaB           CELHDRYHIFNDILDIEWRKARVNTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQSGDE
1eiyA           AHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRER
2du7A           AFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLMSYHSAS---
2cjaA           EELHDRYHIFNDILDIEWRKARVNTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQS---
2du4A           DDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTA
2d6fD           VKGVQDLDLIPEIVERE--------VKRQLSLVEIRDTLQERGA-VVEDKIFDVSEVFADTESRIISSAE
2dq3A           EKLVKDAEEVLQLLGLPYRVVELCTGDKTYDIEVWFPSQNKYREISSCSNCEDFQARRNTRFKDSKTGKN
3dsqA           QRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPH-FLDEKWEIFDPWVGLGFGL
1b70A           LKGAIYQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPP
2e3cA           ENLESIITDFLNHLGIDFKIVGVGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIK-
3bamA           IPKGS-----------------------------------------------------------------
2dq0A           WKIIRNAEELFQELEIPYRVVNICT---------------------------------------------
1c0aA           EVMEALVWLEVKGVDLGDFPVMTFA---------------------------------------------
2bamB           VPLIPKGSDGMSKRSIKKWKDKV-----------------------------------------------
1bhmB           IPKGSRSIKKWKD---------------------------------------------------------
3cw4A           RMQFSSFTVNVRGSGMRLVRGNSPVFNYNKATKRLTVLGKDAGTLTEDPDEGTAGVESAVLRGFLILGKE
2cjbA           CELHDRYMHIFNDILDIEWR-----KARVTPWFMAQEGLLGLAEENTVGTTDYEACL-PYRGPDGEWLEF
2cj9B           CELHDRYMHIFNDILDIEWR-----KARVTPWFMAQEGLLGLAEENTVGTTDCLPYRGPDGEWLEFQNVS
3b6nA           VIFHALVDALLGGMSCSKNSLSFLRYARLLLYKRIVIAEVPKISPIREEIVRNISSALGISESQVKGKTH
2cjbB           LKCAEELHDRYMHIFNDILDIEW-RKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGEWLEFQ
3bjuB           EITEKMVSGMVKHI-TGSYKVTYHPDGPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKA
2eg5E           ----------------------------------------------------------------------
3dsqB           QRLEDMARWVLEAAG-------------------------------------------------------
2bamA           SDGMSKRSI-------------------------------------------------------------
2cj9A           LKCAEELHDRYMHIFNDILDIEWRKARVTPWFMAQEGL--------------------------------
1b8aA           MSFLELVAHAINYVREHILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLG------
3bjuA           EITEKMVSGMVKHITGSYGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKA
1bhmA           VPLIPKGSDGM-----------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2d32C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
1adjA           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
1atiB           ----------------IAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPS
1b76A           VDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPS
3e9hA           MTFGHIVNEFFEQKVISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGN
1atiA           ----------------IAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPS
1e1oA           EKSWGLGRIVT--EIFDEVAEAHLIQPTFITEYPAEVSPLARRNGGREIGNGFSELNDAEDQAERFQEQV
1bbuA           SWGLG-RIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELDAG
1asyA           ENEKFLGKLV--RDKYDTDFYILDKFPLEIRPFYTMPDPANPKYRGEEILSGAQRIHDHALLQERMKAHG
3bjuC           VECPLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLF
2cimA           LWSGCSG--VGLERWAAVFLAQKGLDPANWPEEFRNRVGE------MPKGIRF-----------------
2dq2A           DRTDEKPRYVHTLN--STAIATSRAIVAILENHQETVRIPKVLWKYTG----------------------
1bbwA           EKSWGLGRIVTEIF--EEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFIGNGFSELNDAEDQAQ
2cimB           LWSGCS--GVGLERWAAVFLAQKGLDPANWPEEFRNRVGE------MPKGIRF-----------------
2du5A           LAE----YDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAVGLK
2du3A           LAE----YDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAVGLK
1e1tA           SWGEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDAKAAG
3cmqA           HGEW--LEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNIN
11asA           GGKLS--DGHRHDVRAPDYDDWSTPSEL---GHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLA
3bjuD           VECPPPRT--TARLLDKLVGEFLEVTCSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQAG
2du3B           LAEYDIPYPVMNLGMILYGYDDVRKMVYPQIHGEIKLSDLVKEVPQTAVGLKIAQSIVETAE--KHASEP
2du5B           LAEYDIPYPVMNLGMILYGYDDVRKMVYPQIHGEIKLSDLVKEVPQTAVGLKIAQSIVETAE--KHASEP
2cjaB           LWSGC-----------------------------------------------------------------
1eiyA           LGLPPAYRG-----VTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQ--------------------
2du7A           ----------CVVVGEDVSVDDGKVVAEGLLAQF--GFTKFKFKPDEKKSKYYTPETQTEVYHPKLGEWI
2cjaA           ----------------------------------------------------------------------
2du4A           LAEPVMNLGLGVEAMILYGYDDVRKMVYPQIHGEIKLSIKVKEVPQTAVGLKIAQSIVETA--EKHASEP
2d6fD           SVLAVKLRGFD-----GLIGVEIQPGRRLGTEMADYAKKRGVSGIFHTDELPAYGITEEEVRG-------
2dq3A           RFVHTLNGS--GLAVGRTLAAILENYQQEDGSVV----VPEVLRDYVG----------------------
3dsqA           ERLLMIREGTQHVQSMARSLSYLDGV--------------------------------------------
1b70A           AYRGVTGFAFGLGVMLRYGIPDIRYFFGGRLKFLE-----------------------------------
2e3cA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3cw4A           DKRY--------GPALSINELSNLAKGEKANVLIGQGDVVL----VMKRKRDS-----------------
2cjbA           QNVSINGDKYPKGFNVKLQSGWSGCSGVGLERFLAQKGLDPANWPEEFR---------------------
2cj9B           INGDKYPKGFLQSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFR---------------------
3b6nA           EQLGPVGQKKAIECF-------------------------------------------------------
2cjbB           N---------------------------------------------------------------------
3bjuB           VECPPPRTTARLLDKLVGEFLEVTCINPTICDHPQIMSPLAERFELFVMKKEICNAYTELNDPMRQKAAG
2eg5E           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
1b8aA           ---KYMMENENAPLYFLYQYPSEAKPFYIMYDNKPEICRAFDL---EYRGVEISSGGQREHRHDILVEQI
3bjuA           VECPPPRTTARLLDINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRAKAAG
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2d32C           ----------------------------------------------------RYGALMQTISGVHYNFSL


                         .         *         .         .         .         .         +:350
query           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
1adjA           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
1atiB           AGVDRGVLALLAEAFTREELPNGEERIVLKLK--------PQLAPIKVAVIPLVKNRPEITEYA----KR
1b76A           AGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAP--------IKVAVIPLVKNRPEITEYA----KR
3e9hA           DE-AHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSP------------------------------
1atiA           AGVDRGVLALLAEAFTREELPNGEERIVLKL--------KPQLAPIKVAVIPLVKNRPEITEY----AKR
1e1oA           NAKAAGYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSH------------------------------
1bbuA           DDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSH------------------------------
1asyA           LSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYL---------------------------------
3bjuC           EEQAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSN------------------------------
2cimA           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------
1bbwA           RFLDQVYDEDYVTALEHGLPPTAGLGIGIDRMVMLFT---------------------------------
2cimB           ----------------------------------------------------------------------
2du5A           IAQSIVETAEKHASEPSPCS--------------------------------------------------
2du3A           IAQSIVETAEKHASEPSPCS--------------------------------------------------
1e1tA           DDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSH------------------------------
3cmqA           QKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIG-------------GDLVEKVDLIDKFVHP-
11asA           LTGDEDRLEWHQALLRGEMPQTIGGGIGQSRLTMLL----------------------------------
3bjuD           DDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSN------------------------------
2du3B           SPCSFLAFEGEM------------MGRNVRVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTKKWRSF
2du5B           SPCSFLAFEGEM------------MGRNVRVYVVNENENTKLCGPAYANEVVVYKGDIYGIPKTKKWRSF
2cjaB           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
2du7A           EVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEYEYRLSDRDIAGMIRVDKVPILDEFYNFAN
2cjaA           ----------------------------------------------------------------------
2du4A           SPCSFLAFEG--EMMG-----------RNVRVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTKKWRS
2d6fD           LRDAVGASQGDAVVMVAHERVTAENALREVIRRAEMAI--------------------------------
2dq3A           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------------
1c0aA           -------FGFLLDALKYGTPPHAGLAFGLDRTMLLTGTDVIAFPKTTAACLMTEAPSFANPTALAELSIQ
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------
3b6nA           ----------------------------------------------------------------------
2cjbB           ----------------------------------------------------------------------
3bjuB           DDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSN------------------------------
2eg5E           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
1b8aA           KEKGLESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLP-NIRE-------------------------
3bjuA           DDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSN------------------------------
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2d32C           PMAFWQAKISGADAKEKISAGYFRVIRNYYRFGWVIPYLFGASPAISSSFSLPFEYLPYATSLRLSDLGY


                         .         .         .         .         *         .         .:420
query           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1adjA           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1atiB           LKARLLAVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDELEGFLRERL
1b76A           LKARLLAVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDELEGFLRERL
3e9hA           ----------------------------------------------------------------------
1atiA           LKARLLAVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDELEGFLRERL
1e1oA           ----------------------------------------------------------------------
1bbuA           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------
3bjuC           ----------------------------------------------------------------------
2cimA           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2du5A           ----------------------------------------------------------------------
2du3A           ----------------------------------------------------------------------
1e1tA           ----------------------------------------------------------------------
3cmqA           --------------KTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAV-------------------
11asA           ----------------------------------------------------------------------
3bjuD           ----------------------------------------------------------------------
2du3B           FE-----EGVPTGIRYIDGFAYYAARKVEEAAMREQEE---VKVKARIVENLSDINLYIHEN--------
2du5B           FE-----EGVPTGIRYIDGFAYYAARKVEEAAMREQEE---VKVKARIVENLSDINLYIHEN--------
2cjaB           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
2du7A           ELDICIANKDKESPCSVEVKREFNFNRRVIKVEIFENEPNKKLLGPSVLNEVYVYDGNIYGIPPTFEGV-
2cjaA           ----------------------------------------------------------------------
2du4A           FFEEGVPTG----IRYIDGFAYYAARKVEEAAMREQEEVKVKARIVENL---------------------
2d6fD           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------------
1c0aA           VV--------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------
3b6nA           ----------------------------------------------------------------------
2cjbB           ----------------------------------------------------------------------
3bjuB           ----------------------------------------------------------------------
2eg5E           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
3bjuA           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2d32C           TNSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELYAPIRPKRVTRSG--


                         .         .         +         .         .         .         .:490
query           G
1adjA           G
1atiB           -
1b76A           -
3e9hA           -
1atiA           -
1e1oA           -
1bbuA           -
1asyA           -
3bjuC           -
2cimA           -
2dq2A           -
1bbwA           -
2cimB           -
2du5A           -
2du3A           -
1e1tA           -
3cmqA           -
11asA           -
3bjuD           -
2du3B           -
2du5B           -
2cjaB           -
1eiyA           -
2du7A           -
2cjaA           -
2du4A           -
2d6fD           -
2dq3A           -
3dsqA           -
1b70A           -
2e3cA           -
3bamA           -
2dq0A           -
1c0aA           -
2bamB           -
1bhmB           -
3cw4A           -
2cjbA           -
2cj9B           -
3b6nA           -
2cjbB           -
3bjuB           -
2eg5E           -
3dsqB           -
2bamA           -
2cj9A           -
1b8aA           -
3bjuA           -
1bhmA           -
3d1tB           -
2d32C           -