[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c9dA.bssp"
#ERROR : Can't open dsspfile "2e6gH.bssp"
#ERROR : Can't open dsspfile "3c9bB.bssp"

## Summary of PDB Search
:195
    7e-09  11%  3c9dA  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 75
    3e-08  14%  2e6gH  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-07  10%  3c9bB  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 75
:195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MERVYQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
3c9dA           EGDFKEQQVTKVFQIKKDGILTSEPVPIEWPQSYDSINPDLIKDKRSPEGKKKYRQGMKTIFGWFRWTGL
2e6gH           ----------------------------------------------------------------------
3c9bB           ----------------------SEPVPIEWPQSYDSINPDLIKDKRSPEGKKKYRQGKTIFGWFRWTGLK


                         .         .         *         .         .         .         .:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKxxxxxxxxxxxxxxxxxxHALLRELLRRVGGHAAATSLNKS
3c9dA           KPGKEFPHGDSLFSEEIYPFCVKYYAE-------------------------------------------
2e6gH           -----------------------------------------------WALAEAASQFGEVFVAAPDTETI
3c9bB           PGKEFPHGDSLLFSEEIYPFCVKYYAEAQ-----------------------------------------


                         +         .         .         .         .         *         .:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGAIPKEALLAHxx
3c9dA           -------------------------------------------------------
2e6gH           AHPVRAYPHPSPLHAPHFPAYRRGTPADCVALGLHLFGDLVLSGVNLGSNLGH--
3c9bB           -------------------------------------------------------