[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80819.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bedA.bssp"
#ERROR : Can't open dsspfile "3dvxA.bssp"
#ERROR : Can't open dsspfile "1a2lA.bssp"
#ERROR : Can't open dsspfile "3bckA.bssp"
#ERROR : Can't open dsspfile "3dksB.bssp"
#ERROR : Can't open dsspfile "3bd2A.bssp"
#ERROR : Can't open dsspfile "3dvwA.bssp"
#ERROR : Can't open dsspfile "3bciA.bssp"
#ERROR : Can't open dsspfile "2b6mB.bssp"
#ERROR : Can't open dsspfile "3dksD.bssp"
#ERROR : Can't open dsspfile "2b6mA.bssp"
#ERROR : Can't open dsspfile "1ac1A.bssp"
#ERROR : Can't open dsspfile "1bq7A.bssp"
#ERROR : Can't open dsspfile "3dksA.bssp"
#ERROR : Can't open dsspfile "3dvxB.bssp"
#ERROR : Can't open dsspfile "1a23A.bssp"
#ERROR : Can't open dsspfile "3c7mA.bssp"
#ERROR : Can't open dsspfile "1acvA.bssp"
#ERROR : Can't open dsspfile "2b3sA.bssp"
#ERROR : Can't open dsspfile "2aytB.bssp"
#ERROR : Can't open dsspfile "3d4tA.bssp"
#ERROR : Can't open dsspfile "1cqgA.bssp"
#ERROR : Can't open dsspfile "3d5jA.bssp"
#ERROR : Can't open dsspfile "2c1yB.bssp"
#ERROR : Can't open dsspfile "2b1lA.bssp"
#ERROR : Can't open dsspfile "2aytA.bssp"
#ERROR : Can't open dsspfile "2b5eA.bssp"
#ERROR : Can't open dsspfile "2b1lB.bssp"
#ERROR : Can't open dsspfile "2e0qA.bssp"
#ERROR : Can't open dsspfile "1aiuA.bssp"
#ERROR : Can't open dsspfile "2eiqA.bssp"
#ERROR : Can't open dsspfile "1a0rP.bssp"
#ERROR : Can't open dsspfile "2dmlA.bssp"
#ERROR : Can't open dsspfile "1a8lA.bssp"

## Summary of PDB Search
:211
    3e-22  20%  1bedA  [x.x.x] DSBA OXIDOREDUCTASE
    4e-20  17%  3dvxA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    1e-18  14%  1a2lA  [c.47.1] DISULFIDE BOND FORMATION PROTEIN
    5e-18  25%  3bckA  [x.x.x] DISULFIDE BOND PROTEIN A
    6e-18  14%  3dksB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    3e-17  25%  3bd2A  [x.x.x] DISULFIDE BOND PROTEIN A
    1e-16  19%  3dvwA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    5e-16  25%  3bciA  [x.x.x] DISULFIDE BOND PROTEIN A
    2e-15  13%  2b6mB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    2e-15  15%  3dksD  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    4e-15  13%  2b6mA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    1e-14  14%  1ac1A  [c.47.1] DSBA
    1e-14  14%  1bq7A  [c.47.1] PROTEIN (DISULFIDE OXIDOREDUCTASE)
    5e-14  14%  3dksA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    5e-14  12%  3dvxB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    1e-13  14%  1a23A  [x.x.x] DSBA
    2e-12  12%  3c7mA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA-LIKE
    4e-12  14%  1acvA  [c.47.1] DSBA
    1e-11  14%  2b3sA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
    8e-05   9%  2aytB  [x.x.x] GLUTAREDOXIN-LIKE PROTEIN
    1e-04  23%  3d4tA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-04  18%  1cqgA  [c.47.1] THIOREDOXIN
    2e-04  18%  3d5jA  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    2e-04  15%  2c1yB  [x.x.x] WINDBEUTEL PROTEIN
    3e-04  30%  2b1lA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    4e-04   9%  2aytA  [x.x.x] GLUTAREDOXIN-LIKE PROTEIN
    5e-04  16%  2b5eA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    6e-04  30%  2b1lB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    7e-04  26%  2e0qA  [x.x.x] THIOREDOXIN
    7e-04  19%  1aiuA  [x.x.x] THIOREDOXIN
    7e-04  28%  2eiqA  [x.x.x] THIOREDOXIN 1
    9e-04  10%  1a0rP  [c.47.1] PHOSDUCIN
    0.001  28%  2dmlA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE A6
    0.001  12%  1a8lA  [x.x.x] PROTEIN DISULFIDE OXIDOREDUCTASE
:211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPR
1bedA           -----------------------------------AQFKEGEHKTPAVVSEFFSFYCPHCN-TFEPIIAQ
3dvxA           -----------------------YALTEGEDYLVLDKPIPQEQSGKIEVLEFFGYFCVHCH-HFDPLLLK
1a2lA           ---------------------------------------EKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
3bckA           --------------------------------------------GKPLVVVYGDYKCPYCKELDEKVMPK
3dksB           -------------------------------------TLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
3bd2A           --------------------------------------------GKPLVVVYGDYKCPYCKELDEKVMPK
3dvwA           ----------------------------------LANPIPQQQAGKVEVLEFFGYFCPHCA-HLEPVLSK
3bciA           --------------------------------------------GKPLVVVYGDYKCPYCKELDEKVMPK
2b6mB           -------------------------------------TLEKPVAGAPQVLEFFSFFCAHAYQFEEVLHIS
3dksD           -------------------------------------TLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
2b6mA           ------------------------------------TTLEKPVAGAPQVLEFFSFFCAHAYQFEEVLHIS
1ac1A           -------------------------------------TLEKPVAGAPQVLEFFSFFCPLCYQFEEVLHIS
1bq7A           --------------------------------GKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
3dksA           ------------------------------------TTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
3dvxB           ---------------------------------VLDKPIPQEQSGKIEVLEFFGYFCVHCH-HFDPLLLK
1a23A           ------------------------------------TTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
3c7mA           ---------------------------------DYMVLEKPIPNADKTLIKVFSYACPFCYKYD-KAVTG
1acvA           ------------------------------------TTLEKPVAGAPQVLEFFSFFCPSCYQFEEVLHIS
2b3sA           -------------------------------------TLEKPVAGAPQVLEFFSFFCGHAYQFEEVLHIS
2aytB           ----------------------------------KELAQKEFKEPVSIKLFSQAIGCESCQTGEAVGQDK
3d4tA           ----------------------------------------------------------------------
1cqgA           -----------------------------IESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIK-PFFHS
3d5jA           ----------------------------------------------KEVFVAAKTYCPYSKA-TLSTLFQ
2c1yB           ----------------------------------ELSFEKTVERFPYSVVKFDIAYPKGEKHEA-FTAFS
2b1lA           ----------------------------------------------------------------------
2aytA           ----------------------------------KELAQKEFKEPVSIKLFSQAIGCESCQTAE-ELLKE
2b5eA           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2e0qA           ----------------------------------------------------------------------
1aiuA           -----------------------------IESKTAFQEALDAAGDKLVVVDFSATWCGPCK-MIKPFFHS
2eiqA           ----------------------------------------------AILVDFWAEWCGPCK-MIAPILDE
1a0rP           ----------------------------------------------------------------------
2dmlA           ----------------------------------------------------------------------
1a8lA           ----------------------------------KEEFFSKMVNPVKLIVFVRKDHCQYCDQLK-QLVQE


                         .         .         *         .         .         .         .:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRXXXXXXXXXXQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
1bedA           LKQQLPEGAKFQKNHVSFMGGNMGQ--AMSKAYATMIALEVEDKMVPVMFNRIHTLRK--PPKDEQELRQ
3dvxA           LGKALPSDAYLRTEHVVWQPELGLARAA------AVNLSGLKYQANPAVFKAVYEQKI-RLENRSVAGKW
1a2lA           DNVKKKLPEGVKMTKYHVNFMGGDLGKD---LTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRD
3bckA           LRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLD-K
3dksB           DNVKKKLPEGVKMTKYHVNFMGGDLGKD---LTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRD
3bd2A           LRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDQNKEWLTKELLD-K
3dvwA           HAKSFKDDMYLRTEHVVWQMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQNP-----EVLKKW
3bciA           LRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLD-K
2b6mB           DNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSAS---DIRD
3dksD           DNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIR---D
2b6mA           DNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAV---AMALGVEDKVTVPLFEGVQKTQTIRSASDIRD
1ac1A           DNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAV---AMALGVEDKVTVPLFEGVQKTQTIRSASDIRD
1bq7A           DNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRD---
3dksA           DNVKKKLPEGVKMTKYHVNFMGGDLGKD-LTQAWAVAMALGVEDKVTVPLFEGVQKT--QTIRSASDIRD
3dvxB           LGKALPSDAYLRTEHVVWQPELGLARAAAVNLSGLKYQANPAVFKA---------VYEQKIRLENRSVAG
1a23A           DNVKKKLPEGVKMTKYHVNFMGGDLGKD---LTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRD
3c7mA           PVSEKVKDIVAFTPFHLETKGEYGSEVFAVLINKDKAAGISLFDANSQFKKAKFAYRWSDGKDPAAFIKT
1acvA           DNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIR---D
2b3sA           DNVKKKLPEGVKMTKYHVNFMGGDLGKD-LTQAWAVAMALGVEDKVTVPLFEG--VQKTQTIRSASDIRD
2aytB           IKLDIYSPFTHKEETEKYGVDRVPTIVIEGDKDYGIRYIGLPAGLEFTTLINGIFHVSQRKPQLSEKTLE
3d4tA           ----------------------------------------------------------------------
1cqgA           LSEKYSNVIFLEVDVDDAQDVASEAEVK------------------------------------------
3d5jA           ELNVPKSKALVLELDEM-----------------------------------------------------
2c1yB           KSAHKATKDLLIATVGVKDYGELEN---------------------------------------------
2b1lA           ----------------------------------------------------------------------
2aytA           TVEVIYSPFTHKEETEKYGVDRVPTIVIEGDKDYGIRYIGLPAGLEFTTLINGIFHVSQRKPQLSEKTLE
2b5eA           ----------------------------------------------------------------------
2b1lB           ----------------------------------------------------------------------
2e0qA           ----------------------------------------------------------------------
1aiuA           LSEKYSNVIFLEVDVNDCQDVASECEVK------------------------------------------
2eiqA           IADEYQGKLTVAKLNID-----------------------------------------------------
1a0rP           ----------------------------------------------------------------------
2dmlA           ----------------------------------------------------------------------
1a8lA           LSELTDK---------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKA
1bedA           IFLDEGIDAAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRQGQSVKSLDEYFDLVNYLLTL-
3dvxA           ALSQKGFDGKKLRAYDSPEAAAAAL--KQKLTEQYRIDSTPTVIVGGKYRVFNNGFDGGVHTIKELVAKV
1a2lA           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKQGMDTSNMDVFVQQYADTVKYL
3bckA           HIKQLHLDKETENKIIKDYKTKDSKSWDKKIAKDNHIKTVPTAFINGEKVEDPYDYESYEKLL-------
3dksB           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGPQGMDTSNMDVFVQQYADTVKYL
3bd2A           HIKQLHLDKETENKIIKDYKTKDSKSWDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLL-------
3dvwA           LGEQTAFDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKV
3bciA           HIKQLHLDKETENKIIKDYKTKDSKSWDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKD-----
2b6mB           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNNPQGMDTSNMDVFVQQYADTVKYL
3dksD           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGPQGMDTSNMDVFVQQYADTVKYL
2b6mA           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKQGMDTSNMDVFVQQYADTVKYL
1ac1A           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGPQGMDTSNMDVFVQQYADTVKYL
1bq7A           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVAAMFVNGKQGMDTSNMDVFVQQYADTVKYL
3dksA           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPSNMDVFVQQYADTVKYL
3dvxB           KWALSQKGFDGKKLRAYDSPEAAAAALKQKLTEQYRIDSTPTVIVGKYRVIFNNGFDGGVHTIKELVAKV
1a23A           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPSNMDVFVQQYADTVKYL
3c7mA           GLDAAGMSQADFEAALKEPAVQETLEKWKASYDVAKIQGVPAYVVNGKYTKSIKSIDAMADLIRELASK-
1acvA           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVLNPQGMDTSNMDVFVQQYADTVKYL
2b3sA           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMQQYADTVKYLSEK-
2aytB           LLQVVDIPIEIWVYCPSAAVMAWDFALAQDLAEQFQVVGVPKINKGVAEFVGAQPENAFLGYIMAVYEKL
3d4tA           ---------------------------PPGLELARPVTFTPTFVLMAGRLEGYPGEDFFWPMLARLIGQA
1cqgA           ----------------------------------------------------------------------
3d5jA           ----------------------------------------------------------------------
2c1yB           ----------------------------------------------------------------------
2b1lA           ---------------------------DGMLGLDLGVYGAPETFLIDYRHAGDLNPRVWEEEIKPLWEKY
2aytA           LLQVVDIPIEIVTTSCGYCPSAAVMAENQDLAEQFQVVGVPKIVIGVAEFVGAQPENAFLGYIMAVYEK-
2b5eA           --------------------------HTENDVRGVVIEGYPTLYPGGKKYQGSRSLDSLFDFIKENGHFD
2b1lB           ---------------------------DGMLGLDLGVYGAPETFLIDYRHAGDLNPRVWEEEIKPLWEKY
2e0qA           ---------------------------NPDIAARYGVMSLPTVIFDGEEIIGAVPREEIEIRIKNLLGE-
1aiuA           ----------------------------------------------------------------------
2eiqA           ----------------------------------------------------------------------
1a0rP           -----------LAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLVGGENFISVTEQLAEEFFTGDVESF-
2dmlA           ---------------------------HQSLGGQYGVQGFPTIKIKPEDYQGGRTGEAIVDAALSALRSG
1a8lA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           E
1bedA           -
3dvxA           R
1a2lA           -
3bckA           -
3dksB           S
3bd2A           -
3dvwA           -
3bciA           -
2b6mB           -
3dksD           S
2b6mA           -
1ac1A           -
1bq7A           S
3dksA           -
3dvxB           R
1a23A           -
3c7mA           -
1acvA           -
2b3sA           -
2aytB           -
3d4tA           E
1cqgA           -
3d5jA           -
2c1yB           -
2b1lA           -
2aytA           -
2b5eA           V
2b1lB           -
2e0qA           -
1aiuA           -
2eiqA           -
1a0rP           -
2dmlA           -
1a8lA           -