[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80903.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bd0A.bssp"
#ERROR : Can't open dsspfile "1b4uB.bssp"

## Summary of PDB Search
:370
    4e-11  19%  3bd0A  [x.x.x] PROTEIN MEMO1
    8e-04  18%  1b4uB  [c.56.6] PROTOCATECHUATE 4,5-DIOXYGENASE
:370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bd0A           ----------------------------------------------------------------------
1b4uB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGLSYPXXXXXXXXXXXXXXXSYPGEGEEARVL
3bd0A           -------------------------------------AGSWYTASGPQLNAQLEGWLSQVQSTKRPARAI
1b4uB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGXXXXXXXXXXXXXX
3bd0A           IAPHAGYTYCGSCAAHAYKQVDP-SITRRIFILGPSHHVPLSRCALSSVIYRTPLYDLRIDQKIYGELWK
1b4uB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSH
3bd0A           TGMFERMSL-QTDEDEHSIEMHLPYTAKAMEEFTIIPVLVGALSEEFGKLFSKYLADPSNLFVVSSDFCH
1b4uB           -----------QMDVDHGCTVPLSMIFGEPEEWKVIPFPVGKRCFALGDSIRAAVESFPEHVWGTGGMSH


                         .         *         .         .         .         .         +:350
query           VGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLA
3bd0A           WGQRFRYSYYDESQGEIIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMN
1b4uB           QLQGPRAGLINKEFDLNFIDKLISDPEELSKMPHIQYLRESGSEG------VELVMWLIMRGALPEKVRD


                         .         .         .         .         *         .         .:420
query           HRLDLEAPTLSAVGAGTLVL
3bd0A           MSFSFLNYAQS---------
1b4uB           LYTFYHIPA-SNTALGAMIL