[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80912.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "3du4A.bssp"
#ERROR : Can't open dsspfile "3dodB.bssp"
#ERROR : Can't open dsspfile "3dodA.bssp"
#ERROR : Can't open dsspfile "3drdB.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "2cinA.bssp"
#ERROR : Can't open dsspfile "2bylA.bssp"
#ERROR : Can't open dsspfile "3clzB.bssp"
#ERROR : Can't open dsspfile "3clzD.bssp"
#ERROR : Can't open dsspfile "3bv0A.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "3clzA.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "3aatA.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "2d64A.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "1czcA.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "1bqdA.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "1btcA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "1bybA.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "1aheA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1akaA.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "1cliB.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "3ca8B.bssp"
#ERROR : Can't open dsspfile "1bjoA.bssp"
#ERROR : Can't open dsspfile "2bhgA.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "3dwkA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2bieA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "2c0rA.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "1dfoA.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "2cdmA.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "3c3jC.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "3ca8A.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "3blvH.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "3d1rA.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "3blxD.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3blvD.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "1dkrA.bssp"
#ERROR : Can't open dsspfile "2dqxA.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "2a8iB.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"

## Summary of PDB Search
:427
    1e-61  85%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    3e-61  19%  3du4A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-54  20%  3dodB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-54  20%  3dodA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    4e-54  20%  3drdB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-48  47%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-47  20%  2cinA  [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE
    3e-45  22%  2bylA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    3e-40  13%  3clzB  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    3e-39  13%  3clzD  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    2e-38  20%  3bv0A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-37  22%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    1e-36  20%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-35  12%  3clzA  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    3e-35  43%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    8e-35  21%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    9e-34  18%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-33  20%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    3e-33  19%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    8e-32  13%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-31  10%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-31  12%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-31  10%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-31  10%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-31  27%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    8e-31   9%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-30  12%  3aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-30  29%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    2e-30  21%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    2e-30  13%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    2e-30   9%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    3e-30  13%  2d64A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-30  20%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    9e-30  13%  1czcA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    9e-30  11%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-29  10%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-29  13%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-29  11%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    5e-29  10%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    8e-29  11%  1bqdA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-28  11%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    2e-28  10%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-28  10%  1btcA  [x.x.x] BETA-AMYLASE
    4e-28  11%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    7e-28   9%  1bybA  [x.x.x] BETA-AMYLASE
    9e-28   9%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    9e-28  13%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-27   9%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-27  13%  1aheA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-27  11%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-27  12%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-27  10%  1c7nA  [c.67.1] CYSTALYSIN
    1e-26  11%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-26  10%  1akaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-26  10%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    3e-26   9%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    5e-26  13%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-26   9%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    6e-26  10%  1cliB  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    9e-26  11%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-25  11%  1d2fB  [c.67.1] MALY PROTEIN
    1e-25   9%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-25   9%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-25  10%  2c44A  [x.x.x] TRYPTOPHANASE
    5e-25  12%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    7e-25  11%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    9e-25  11%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    2e-24  16%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-24  12%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-24  13%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    3e-24  13%  1ax4A  [c.67.1] TRYPTOPHANASE
    3e-24  19%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    4e-24  14%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-24  11%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-24  10%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    5e-24  11%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-24   9%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    6e-24   7%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    8e-24  17%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-23   9%  2c44B  [x.x.x] TRYPTOPHANASE
    1e-23  12%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-23  12%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-23  12%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-23  12%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    4e-23  13%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-23  13%  3e9kA  [x.x.x] KYNURENINASE
    6e-23   9%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    6e-23  12%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    9e-23  12%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-22  14%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-22  12%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-22  16%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-22  14%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-22  15%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-22   9%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    3e-22  12%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-22  14%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    4e-22   9%  2c44C  [x.x.x] TRYPTOPHANASE
    6e-22  11%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    7e-22   9%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    8e-22  15%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-22  12%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-21  10%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    2e-21  12%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    2e-21  11%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-21  11%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    2e-21   9%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    2e-21  14%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    3e-21  14%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-21  12%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    4e-21  10%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    6e-21  12%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-21  13%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    1e-20   9%  3ca8B  [x.x.x] PROTEIN YDCF
    1e-20   9%  1bjoA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    1e-20  12%  2bhgA  [x.x.x] FOOT-AND-MOUTH DISEASE VIRUS 3C PROTEASE
    1e-20  12%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-20  12%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    4e-20   8%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    5e-20   9%  1d2fA  [c.67.1] MALY PROTEIN
    6e-20  14%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    6e-20   9%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-20   9%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    7e-20  10%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    7e-20  11%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    9e-20  15%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    9e-20  15%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-19   9%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-19  10%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-19  11%  3dwkA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    2e-19  11%  1ecxB  [c.67.1] AMINOTRANSFERASE
    3e-19  11%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    3e-19  12%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-19   6%  2bieA  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-19  10%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    5e-19  12%  1eg5B  [c.67.1] AMINOTRANSFERASE
    8e-19   6%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-18   5%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-18  10%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    1e-18  10%  2c0rA  [c.67.1 (1bt4A)] PHOSPHOSERINE AMINOTRANSFERASE
    1e-18  16%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-18  10%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    2e-18  11%  1eg5A  [c.67.1] AMINOTRANSFERASE
    2e-18  12%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    4e-18  11%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    5e-18  11%  1dfoA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    7e-18  10%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    8e-18  12%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    4e-17  10%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    7e-17  10%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    1e-16   9%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    1e-16  13%  1ecxA  [c.67.1] AMINOTRANSFERASE
    2e-16   8%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    2e-16   7%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    4e-16  10%  2cdmA  [x.x.x] TRWC
    1e-15  14%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    2e-15  12%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    4e-15  19%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    6e-15  13%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    8e-15   9%  3c3jC  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    1e-14   9%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-14   9%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    2e-14  19%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    2e-14  12%  3ca8A  [x.x.x] PROTEIN YDCF
    2e-14   9%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-14  12%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    4e-14   9%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-14  10%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    6e-14  11%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    7e-14  19%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    8e-13  13%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    1e-12  10%  3blvH  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    2e-12  14%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-12   7%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    3e-12  13%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    3e-11  13%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    8e-11  13%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    5e-10  13%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    7e-10   9%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    1e-09  11%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    1e-09  11%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-09  13%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    9e-09  14%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-08  10%  3d1rA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    9e-08  12%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    1e-07  12%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    4e-07  14%  3blxD  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    6e-07  14%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-06  15%  3blvD  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    3e-06  14%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-06  12%  1dkrA  [c.61.1 - c.61.1] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
    3e-06  12%  2dqxA  [x.x.x] BETA-AMYLASE
    7e-06   9%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    3e-05  16%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    1e-04  13%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-04  15%  2a8iB  [x.x.x] THREONINE ASPARTASE 1
    6e-04  16%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
:427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
2e7uA           ---MERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
3du4A           --------THDLIEKSKKHLW----LPFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHG
3dodB           ------------IEKSKKHLW----LPFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHG
3dodA           ------------IEKSKKHLW----LPFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHG
3drdB           ------------IEKSKKHLW----LPFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHG
3bs8A           MRSYEK--SKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILG
2cinA           -------------------TPDRVHEVLGRSMLVDGIVLDLTRSGGSYLVDATGRRYLDMFTFVASSALG
2bylA           ------PTSDDIFEREYKYGAHNAHPL----------PVALERGKGIYLWDVEGRKYFDFLSSISAVNQG
3clzB           ------IPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSG
3clzD           ------IPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSG
3bv0A           ------------------------------------SPVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHG
2byjA           ------PTSDDIFEREYKYGAHNYHPL----------PVALERGKGIYLWDVEGRKYFDFLSSISAVNQG
1dtyA           --------TTDDLAFDERHIWHPYTSMTSPLP-----VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHG
3clzA           ------IPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSG
2cfbA           -------------------------------------PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVG
1d7uA           ------NDDATFWRNARQHLVRYGGTF---------EPMIIERAKGSFVYDADGRAILDFTSGQMSAVLG
3drdA           --------THDLIEKSKKHLW----LPFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHG
1dgdA           ------NDDATFWRNARHHLVRYGGTFE---------PMIIERAKGSFVYDADGRAILDFTSGQMSAVLG
3dxvB           ---------KALYDRDGAAI-----GNLQKLR---FFPLAISGGRGARLIEENGRELIDLSGAWGAASLG
1asfA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
2dgmC           ------------TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGRQNLATFCQT
2d5yA           ------------------------------FENITTAPADPILGLADLFRADERPGKINLGIYKDETGKT
1ajrA           -------------------------APPSVFAEVPQAQPVLVFKLIADFREDPDPRKVN--LGVGAYRTD
1b8gA           -------------------LSRNATSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAK
2eh6A           -------------------------TYL--MNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLG
2dgmA           ------------TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGRQNLATFCQT
3aatA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
2cy8A           ------EGSVFWAQRARSVMPDGAFDPH---------GLFISDAQGVHKTDVDGNVYLDFFGGHGALVLG
3dxvA           ---------KALYDRDGAAIG--NLQKLRFF------PLAISGGRGARLIEENGRELIDLSGAWGAASLG
1arsA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
2dgmE           ---------KQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGRQNLATFCQT
2d64A           ------------------------------FENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETG
2e54A           ------------------------------MNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLG
1czcA           ------------------------------FENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETG
2aatA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
1arhA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
2d66A           ------------------------------FENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETG
1aamA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
1b8gB           ------------------------RNATFNSSSY--FLGWQEYEKNPYHEVHNTNGIIQCFDLLESWLAK
1bqdA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
1c7gA           -----------------------MNYPAEPFRIKSVETVMISRDERVKKMQEAGYNTFL--LNSKDIYID
7aatA           -----------------------WWSHVEMGPP----DPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKP
1btcA           ------------------------------------------------------------------MLLN
3dc1D           -------------------------------------ITAASAARNPSPIRRGPKSMISLAGGLPNPNMF
1bybA           ------------------------------------------------------------------MLLN
2dgmB           ---------KQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGRQNLATFCQT
1aiaA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
1ajsA           -------------------------APPSVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYR--TD
1aheA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGLYYDETG
3ei9B           -----------------------RNSNMSKLQAGYL-FPEIARRRSAHLLKYPDAQVISLGIGDTT---E
1bqaA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
1c7nA           -------------------------------------TKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVA
1ariA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
1akaA           -----------------------WWSHVEMGPP----DPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKP
1ay5B           -------------------------------------GNLKPQAPDKILALMGEFGKID--LGVGVYKDA
3e2fA           ------------------------------------------AKRIEGLDSNVWVEFTKLAADPSVVNLG
1b4xA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
3bc8A           -------------RRAHEHLIRLLLEQGKCPEDGWDESTLELFLHELAVMDSNNFLGNCGVGEREGRVAS
1cliB           ----------------------------------------------------------------------
3cq6A           -------------------------------------PLREELRGEHAYGAPQLNVDIRLNTNENP---Y
1d2fB           -------------------------------------------------FDFSKVVLLP--FTISDMDF-
3d6kA           -----------------------------------------------YAELKAKNLSLDLTRGKPSAEQL
3bcaA           --------------EARRAHE----HLIRLLLEQGK-CPEDGWDESTLELFLHELAVMDSNNFLGNCGVG
2c44A           -----------------------------KRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGT---G
3dzzB           -------------------------------------THVPKRQGNSIKWGVLKEKELPWIAED-----F
3ei7A           -----------------------RNSNMSKLQAGYL-FPEIARRRSAHLLKYPDAQVISLGIGDTT---E
3dc1A           -------------------------------------ARFITAASAARNPSPGPKSMISLAGGLPNPNMF
1bkgA           -----------------------LSRRVQAMKP----SATVAVNAKALELRRQGVDLVALTAGEPDF---
2egyB           ------------------------------------AGRIQASTIRELLKLTQRPGILSFAGGLPAPELF
3dydA           ------------------------------------------VRPSDKVKPNPNKTMISLSIGDPTVFGN
1ax4A           ---------------AKRIVEPFRIKMVEK-------IRVPSREEREAALKEAGYNPFLLPSSAVYIDLL
3bv0B           -------------------------------------PVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHG
2bwnB           --------NLALDKAIQKLHDEGRY---RTFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDYL--GM
2cstA           ------------------------------FAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEG
1ay4B           ------------------------------------GNLKPQLALMGEFRADPRQGKIDLGVGVYKDATG
3ei6A           -----------------------------NMSKLQAGYLFIARRRSAHLLKYPDAQVISLGIGDTTE---
3bcbA           --------ARRAHEHLIRLLLEQGKCPEDGW------DESTLELFLHELAVMDSNNFLGNC-GVGEREGR
3d6kD           -------------------------------ARLAQVREEVTA---KYAELKAKNLSLDLTRGKPSAEQL
1bjwA           -----------------------LSRRVQAMK----PSATVAVNAKALELRRQGVDLVALTAGEPDF---
2c44B           ----------------------------VKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGT---G
3ei8A           -----------------------RNSNMSKLQAGYL-FPEIARRRSAHLLKYPDAQVISLGIGDTT---E
3ei7B           -----------------------------NMSKLQAGYLFIARRRSAHLLKYPDAQVISLGIGDTT---E
1asbA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
3dydB           ------------------------------------------SVRPSDVKPNPNKTMISLSIGDPTVFGN
2d61A           ------------------------------FENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETG
3e9kA           --------------------------KLRHFREFYIPKIQLPPVDLSLVNKDENAIYFLGNSLG------
2dgkC           ------------------------------------RFPLHEMRDDVAFQIINDELYLDGRQNLATFCQT
1djuA           --------------------------------------------LSDRLELVSAKDVISLGIGEPD---F
3ecdC           --------------------------------------------------------------PFFSQSLA
2bwpA           --------NLALDKAIQKLHDEGRY---RTFIDIEREKGAFPKAQWNR-PDGGKQDITVW--CGNDYLGM
3ecdA           --------------------------------------------------------------PFFSQSLA
1b5oA           -----------------------LSRRVQAMKP----SATVAVNAKALELRRQGVDLVALTAGEPDF---
2bwnD           --------NLALDKAIQKLHDEGRY---RTFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDYL--GM
2bwoD           --------NLALDKAIQKLHDEGRY---RTFIDIEREKGAFPKAQWNRPD-GGKQDITVWCGNDYL--GM
3e2yA           --------------------------------------------RIEGLDSNVWVEFTKLAADPSVVNLG
3eiaB           ----------------------------SNMSKLQAGYLFIARRRSAHLLKYPDAQVISLGIGDTT---E
2egyD           -------------------------------------GRIQASTIRELLKLTQRPGILSFAGGLPAPELF
2c44C           ----------------------------VKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGT---G
3dzzA           -------------------------------------THVPKRQGNSIKWGVLKEKELPWIAED-----F
3d6kC           -------------------------------ARLAQVREEVTA---KYAELKAKNLSLDLTRGKPSAEQL
1b5pA           -----------------------LSRRVQAMKP----SATVAVNAKALELRRQGVDLVALTAGEPDF---
3ei6B           -----------------------RNSNMSKLQAGYL-FPEIARRRSAHLLKYPDAQVISLGIGDTT---E
3b46B           -------------------------------------NKYFTSNTAKDVWSLTGRELIN--LGQGFFSYS
3b46A           ------------------------------TSNTAKDVWSLTNEAAAKAANNQGRELIN--LGQGFFSYS
3eiaA           ----------------------------SNMSKLQAGYLFIARRRSAHLLKYPDAQVISLGIGDTT---E
1dfoB           ------------------------------------KREMNIADYDAELWQAMEQEKVRQEHIELIASEN
1ay4A           ------------------------------LGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATG
5bj3A           --------------------------------------------RGLSRRVQAMKPLVALTAGEPDF---
2bwoB           --------NLALDKAIQKLHDEGRY---RTFIDIEREKGAFPKAQWNRPDG-GKQDITVWCGNDYL--GM
1bj4A           ------------------------WSSHDAMLA---QPLKDSDVEVYNIIKKESNRQRVGLELIAS--EN
1djuB           ---------------------------------------------------ELVSDVISLGIGEPD---F
3ei9A           -----------------------RNSNMSKLQAGYL-FPEIARRRSAHLLKYPDAQVISLGIGDTT---E
2dr1B           ------------------------------------------------VYEMVKPKYKLFTAGP-----V
3ca8B           -----FPTLSPATIDAINVIGQWLAQDFSGEVPYQADCVILAGNAVMPTIDADQQIPLLISGGIGHSTTF
1bjoA           -------------------------------------------------------IFNFS------SGPA
2bhgA           ----------------------------------------------------------------------
3cbfA           -------------------------------------GRIQASTIRELLKLTQRPGILSFAGGLPAPELF
1agxA           --------------------------------KVPVDALIKAVPQVNDLANITGIQALQVASES---ITD
1bjnA           -------------------------------------------------------IFNFS------SGPA
1d2fA           ---------------------------------------------------------------------F
5bj4A           ----------------------------------------------RVQAMKPGVDLVALTAGEPDF---
3cq4B           -------------------------------------------TLSDLPLREELRVDIRLNTNENP---Y
2dgkA           ------------------------------------SKRFPLHEMRDDVAIINDELYLDGRQNLATFCQT
1ejiA           -------------------------------------PLKDSDAEVYSIIKKESNRQRVGLELIAS--EN
3cq4A           -------------------------------------------TLSDLPLREELRVDIRLNTNENP---Y
2bwnA           -------LDKAIQKLHDEGRY-------RTFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDYL--GM
2bwnE           ----NLALDKAIQKLHDEGRY-------RTFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDYLG--M
3dc1B           -------------------------------------FITAASAARNPSPIRGPKSMISLAGGLPNPNMF
3d6kB           -----------------------------------------VREEVTAKYAKAKNLSLDLTRGKPSAEQL
3dwkA           -------------------------------------------PIPAKIYDKNG-ELVKTL--DNGQRHE
1ecxB           -------------------------------------------------------VYFDN------NATT
2dr1A           -----------------------------------------FEEAFKEVYEMVKPKYKLFTAGP-----V
2egyC           ------------------------------------AGRIQASTIRELLKLTQRPGILSFAGGLPAPELF
2bieA           -------------------------------------------------------VFNFN------AGPS
1bw0A           -----------------SNHAGLVFNPIRTVSDNSPSPKPIIKLSVGD---------------PTLDKNL
1eg5B           -------------------------------------------------------VYFDNNA------TT
2bhxB           --------------------------------------------------------------------PS
2bieB           -------------------------------------------------------VFNFN------AGPS
2aevA           ---------------------------------------------------------------------E
2c0rA           -----------------------------------------------------ERAYNFN------AGPA
2bwoA           --------NLALDKAIQKLHDEGRY---RTFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDYLG--M
3bcxB           ------------------------------------SQEELRQIAEVAQYAETAMAPKPFEAGKSVVPPS
1eg5A           -------------------------------------------------------VYFDNNA------TT
3ecdD           --------------------------------------------------------------------LA
1bw0B           -----------------SNHAGLVFNPIRTSDNAKPSPPIIKLSVG----------------DPTLDKNL
1dfoA           ------------------------------------------ADYDAELWQAMEQEKVRQEHIELIASEN
3bcxA           ------------------------------------SQEELQQIAEVAQYAETAMAPKPFEAGKSVVPPS
3cq5B           ------------------------------------LPLREELRGEHAYGAPQLNVDIRLNTNENPY---
3cq5A           -------------------------------------PLREELRGEHAYGAPQLNVDIRLNTNENPY---
2ch1A           -------------------------------------------PASLRNPLIIPEKIMMGPGP------S
1c0nA           -------------------------------------VDAVRADFPVLSREVNGLPLAYLDSAA----SA
1ecxA           -------------------------------------------------------VYFDN------NATT
1c4kA           -----------------------------------------------IQFDCPGHQGGQYYRKHPAGREF
2a7vA           --------------------------------------------------------------WTGQESLS
2cdmA           ----------------------------------------------------------------------
2dkjA           -----------------------------------------LFELIALEEKRQREGLELIAS------EN
3ecdB           --------------------------------------------------------PFFSQ------SLA
1bs0A           ----------------------------------------VAQGAGRWLV-ADDRQYLNFS-SNDYLGLS
1b9hA           ---------------------------------------------------------------------F
3c3jC           -----------------------------------------------FALLPAETHDRGFATSSITTASC
3e77A           ------------------------------------------------------NLYFQS---MLP---H
2ch2A           -----------------------------------------------------PASLRNPLIIPEKIMMG
1djeA           ----------------------------------------VAQGAGRWLV-ADDRQYLNFS-SNDYLGLS
3ca8A           -------------------------------------CVILAGNAVMPTIDADQQIPLLISGGIGHSTTF
3e77C           ------------------------------------------------------NLYFQS---MLP---H
1b9iA           ----------------------------------------------------------------------
3e77B           ------------------------------------------------------NLYFQSMLP------H
3bb8A           ------------------------------------SQEELRQIAEVAQYAETAMAPKPFEAGKSVVPPS
2e7jA           ---------------------------------------------------------------------L
2bwpB           ----------------------------RTFIDIEREKGAFPKAQWNRPDG-GKQDITVWC-GNDYLGMG
1cj0A           -----------------------------------------SDAEVYDIIKKESNRQRVGLELIASE--N
3blvH           ---------------------------------NIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVLN
3dr4B           --------------------------------------------------------------------IS
3b8xB           --------------------------------------------------------------------YP
3bn1D           ----------------------------------------------------------------------
3dr4D           --------------------------------------------------------------------IS
3bn1C           --------------------------------------------------------------------IS
1cj0B           -----------------------------------------SDAEVYDIIKKESNRQRVGLELIASE--N
2aeuA           ----------------------------------------------------------------------
3b8xA           --------------------------------------------------------------------YP
2c81A           ---------------------------------------------------------------------P
3dr4A           ----------------------------------------------------------------------
3dr7B           --------------------------------------------------------------------IS
3d1rA           ----------------------------------------------------------------------
3caiA           --------------------------------------------RVRGLHPSLGDGWVH--FDAP--AGM
2c7tA           ----------------------------------------------------------------------
3blxD           ---------------------------------NIGHKISIFEAVHGSAPDIAGQDKANPTALLSVMMLN
2douA           ----------------------------------------------------------------------
3blvD           ---------------------------------NIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVLN
3dr4C           --------------------------------------------------------------------IS
1dkrA           ------------------------------------------------------------------IFSL
2dqxA           ----------------------------------------------------------------------
2bkwA           ------------------------------------------------------SVDTL--LIPGPI---
2douB           ----------------------------------------------------------------------
3bwnB           ----------------------------------------------------------------------
2a8iB           ----------------------------------------------------------------------
3bn1A           --------------------------------------------------------------------IS


                         .         .         *         .         .         .         .:140
query           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTNRPYI
2e7uA           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYI
3du4A           HRKKELDDAIKKQLGKSTLLGMTNVPATQLAETIDISPKKLTRVFYSDSGAEAMEIALKMAFQYPEKQKF
3dodB           HRKKELDDAIKKQLGKSTLLGMTNVPATQLAETLIDISPKLTRVFYSDSGAEAMEIALKMAFQYWKKPEK
3dodA           HRKKELDDAIKKQLGKSTLLGMTNVPATQLAETLIDISPKLTRVFYSDSGAEAMEIALKMAFQYWKKPEK
3drdB           HRKKELDDAIKKQLGKSTLLGMTNVPATQLAETLIDISPKLTRVFYSDSGAEAMEIALKMAFQYWKKPEK
3bs8A           HTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKI
2cinA           MNPPALVDDREFHAELPSNSDVYSVAMARFVETFARVLGALPHLFFVEGGALAVENALKAAFDWKSRTQV
2bylA           HCHPKIVNALKSQVDKLTSRAFYNNVLGEYEEYI-TKLFNYHKVLPMNTGVEAGETACKLARKWKYKAKI
3clzB           NKRTAEQSCDQK-------------LTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGPAEG
3clzD           NKRTAEQSCDQK-------------LTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGAEG
3bv0A           HGHPALDQALTTQLRVVMFGGLTHEPAARLAKLLVDITPALDTVFFSDSGSVSVEVAAKMALQYPGKRRL
2byjA           HCHPKIVNALKSQVDKLTLRAFYNNVLGEYEEYI-TKLFNYHKVLPMNTGVEAGETACKLARIQKYKAKI
1dtyA           YNHPQLNAAMKSAMSHVMFGEITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARDRF
3clzA           NKRTAEQSCDQKLTNT-------------NRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGAEG
2cfbA           HAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKV
1d7uA           HCHPEIVSVIGEYAGKLDHLFSLSRPVVDLATRLANITPPLDRALLLSTGAESNEAAIRMAKLVTGKYEI
3drdA           HRKKELDDAIKKQLGKIAHSTMTNVPATQLAETLIDISPKLTRVFYSDSGAEAMEIALKMAFQY--WKNI
1dgdA           HCHPEIVSVIGEYAGKLDHLFSLSRPVVDLATRLANITPPLDRALLLSTGAESNEAAIRMAKLVTGKYEI
3dxvB           YGHPAIVAAVSAAAANATILSASNAPAVTLAERASFPGEGTHKIWFGHSGSDANEAAYRAIVKATGRSGV
1asfA           KTLTSVKKAEQYLLENETIPEFGRCTQELLFGKGSALINKRARTAQTPGGTGALRVAADFLAKNTSVKRV
2dgmC           WDDENVHKLMDLSINKNWIDKEEAAIDLRCVNMVADLWNGQAVGTNTIGSSEACMLGGMAMKWRWRK---
2d5yA           PVLTSVKKAEQYLLENETTKNYLPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1ajrA           DCQPWVLPVVRKVEQRIANNSLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFL
1b8gA           NPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMFDPNHLVLTAGATSANETFIFCLADPGEAVLI
2eh6A           HAYPKLTEALKEQVEKLLHVSYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYKNKWKF
2dgmA           WDDENVHKLMDLSINKNWIDKEEAAIDLRCVNMVADLWNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME
3aatA           KTLTSVKKAEQYLLENETTKNYLGEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
2cy8A           HGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMI
3dxvA           YGHPAIVAAVSAAAANATILSASNAPAVTLAERLLASFPGEGTIWFGHSGSDANEAAYRAIVKATGRSGV
1arsA           KTLTSVKKAEQYLLENETTKEFGRCTQELLFGKGSALINDKARTAQTPGGTGALRVAADFLAKNTSVKRV
2dgmE           WDDENVHKLMDLSINKNWIDKEEAAIDLRCVNMVADLWNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME
2d64A           KTLTSVKKAEQYLLENETTIDGIPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
2e54A           HSHPRLVEAIKDQAEKLIHCSNLFWNRQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKKSI
1czcA           KTLTSVKKAEQYLLENETTKNFGRCTQELLFGKGSALINDRARTAQTPGGTGALRVAADFLAKNTSVRRV
2aatA           KTLTSVKKAEQYLLENETTKNGIPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1arhA           KTLTSVKKAEQYLLENETTKNYLGEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
2d66A           KTPTSVKKAEQYLLENETIPEFGRCTQELLFGKGSALINKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1aamA           KTLTSVKKAEQYLLENETTKNYLPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1b8gB           NPEAAAFKKNGESIFAELALFQDPAFKKAMVDFMAEIRFDPNHLVLTAGATSANETFIFCLADPGE--AV
1bqdA           KTLTSVKKAEQYLLENETTKNGIPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1c7gA           LLTDSGTNAMSDKQWAGDEAYAGSENFYHLEKTVKELFG-FKHIVPTHQGRGAENLLSQLAIKPGQYVAG
7aatA           YVLNCVRKAEAMIAAKKMDKEYLADFTRASAELALGENSGRYVTVQGISGTGSLRVGANFLQRFFKFSRD
1btcA           YVPVYVMLPLG-----VVNVDNVFEDPDGLKEQLLQLRAAVDGVMV--DVWWGIIELKGPKQYDWRAYRS
3dc1D           PFKTAVITVENGKTIQRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCK
1bybA           YVPVYVMLPLG-----VVNVDNVFEDPDGLKEQL-LQLRAAGVDGVMVDVWWGIIELKGPKQYDWRAYRS
2dgmB           WDDENVHKLMDLSINKNWIDKEEAAIDLRCVNMVADLWNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME
1aiaA           KTLTSVKKAEQYLLENETTKEFGRCTQELLFGKGSALINDKARTAQTPGGTGALRVAADFLAKNTSVKRV
1ajsA           DCQPWVLPVVRKVEQRIANNSLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFL
1aheA           KILTSVKKAEQYLLENETTKEFGRCTQELLFGKGSALINDKARTAQTPGGSGALRVAADFLAKNTSVKRV
3ei9B           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQ--VMFGSNVTI
1bqaA           KTLTSVKKAEQYLLENETTKNYLGEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1c7nA           DMEFKNPPELIEGLKKYLDETVLGEYKKTVKKWMKDRHQQTDWIINTAGVVPAVFNAVREFTKPGDG--V
1ariA           KVLTSVKKAEQYLLENETTKDGIPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
1akaA           YVLNCVRKAEAMIAAKKMDKEYLADFTRASAELALGENSGRYVTVQGISGTGSLRVGANFLQRFFKFSRD
1ay5B           TGHTPIMRAVHAAEQRMLETEAGLSGEPEFQKAMGELILGDGLKSETTAGTGALRQALELARMANPDLRV
3e2fA           QGFPYVKEELSKAAFITRGFGHPALLSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVII
1b4xA           KTLTSVKKAEQYLLENETTKEFGRCTQELLFGKGSALINDKARTAQTPGGTGALRVAADFLAKNTSVKRV
3bc8A           ALVARRHYRFIHGIGRQPKAAGSNKITNSLVLNVIKLAHSVASCFVVPMATGMSLTLCFLTLRHKRPKAI
1cliB           ----------------------------------------------------------------------
3cq6A           PPSEALVADLVATVDKIATELNRYPLRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRT
1d2fB           ATAPCIIEALNQRLMHGVFGYSRWEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEG
3d6kA           DLSNDLLSLPGGDFRTCRNYGGLLGIADIRELWAEALGLPADLVVAQDGSSLNIFDLISWSYTWGNNDSS
3bcaA           EREGRVASALVARRHYRFIHGIGQKITNSLVLNVIKLAGSVASCFVVPMATGMSLTLCFLTLRHKRPKAK
2c44A           AVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKM
3dzzB           KIAPEIASEEKLKVAAFGYESVPAEYYKAVADWEEIRARPKEDWCVFASGVVPAISAVRQFTSPGDQILV
3ei7A           PIPEVITSAMAKKAHELSTIEGYKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISR--LQVMFGSNVTI
3dc1A           PFKTAVITVENGKTIQSPSAGIPELLS-WLKQLQIKLHQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLL
1bkgA           DTPEHVKEAARRALAQGKTKYAPPELREALAEKFRRENVTPEETIVTVGGKQALFNLFQAILDPGD--EV
2egyB           PKEEAAEAAARILREKVALQYSPTEGYAPLRAFVAEWIGRPEEVLITTGSQQALDLVGKVFLDE--GSPV
3dydA           LPDPEVTQAMKDALDSGKYNGYALSSREEIASYYHCPEAPLEAVILTSGCSQAIDLCLAVL--ANPGQNI
1ax4A           TDSNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFN-YDYIIPAHQGRGAENILFPVLLKYGKAKNP
3bv0B           HGHPALDQALTTVMNHVMFGGLTHEPAARLAKLLVDITPAGDTVFFSDSGSVSVEVAAKMALQYPGKRRL
2bwnB           GQHPVVLAAMHEALEAGSGGTRNISGTTAYHRRLEAEIAQKEAALVFSSAYNANDATLSTLRVLFPGLII
2cstA           QPLPVVRKVEQLIAGDGSLNHLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFL
1ay4B           HTMRAVHAAEQRMLETETTKTYAPEFQKAMGELILGDGLKSETTATLATGTGALRQALELARMANPDLRV
3ei6A           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRL--QVMFGSNVTI
3bcbA           VASALVARRHYRFIHGIGRSSLLNKITNSLVLNVIKLAHSVASCFVVPMATGMSLTLCFLTLRHKRPKAK
3d6kD           DLSNDLLSLPGGDFRTDCRNYGGLLGIADIRELWAEALGLPADLVVAQDGSSLNIFDLISWSYTWGNNDS
1bjwA           DTPEHVKEAARRALAQGKTKYAPPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDE
2c44B           AVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTI-----PTHQGRGAEQIYIPVLIKKREQEKG
3ei8A           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISR--LQVMFGSNVTI
3ei7B           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISR--LQVMFGSNVTI
1asbA           KTLTSVKKAEQYLLENETTKNGIPEFGRCTQELLFGKGDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
3dydB           LTDPEVTQAMKDALDSGKYNGYALSSREEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNI
2d61A           KVLTSVKKAEQYLLENETTKEFGRCTQELLFGKGSALINDRARTAQTPGGTGALRVAADFLAKNTSVKRV
3e9kA           LQPKMVKTYLEEELDKWAKIAAYGTGDESIVGLMKDIVGAEKEIALMNALTVNLHLLMLSFFKPTPKRYK
2dgkC           WDDENVHKLMDLSINKNWIDKEEAAIDLRCVNMVADLWNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME
1djuA           DTPQHIKEYAKEALDKGLTHYGPNELREAIAEKLKKQNGIETEIMVLLGANQAFLMGLSAFLKDGEEVLI
3ecdC           ERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYDEVEALAIERVKRLFNGHAN
2bwpA           GQHPVVLAAMHEALEAGSGGTRNISGTTAYHRRLEAEIAQKEAALVFSSAYNANDATLSTLRVLFPG---
3ecdA           ERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGADEVEALAIERVKRLFNAGHA
1b5oA           DTPEHVKEAARRALAQGKTKYAPPELREALAEKFRRENVTPEETIVTVGGSQALFNLFQAILDPGDE--V
2bwnD           GQHPVVLAAMHEALEAGSGGTRNISGTTAYHRRLEAEIAQKEAALVFSSAYNANDATLSTLRVLFPGLII
2bwoD           GQHPVVLAAMHEALEAVGAGSGGTAYHRRLEAEIAGLHQ-KEAALVFSSAYNANDATLSTLRVLFPGLII
3e2yA           QGPSYVKEELSKAAFITRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDE
3eiaB           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDG--AKCDISRLQVMFGSNVTI
2egyD           PKEEAAARILREKGEVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLL
2c44C           AVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTI-----PTHQGRGAEQIYIPVLIKKREQEKG
3dzzA           KIAPEIASEEKLKVAAFGYESVPAEYYKAVADWEEIRARPKEDWCVFASGVVPAISAVRQFTSPGDQILV
3d6kC           DLSNDLLSLPGGDFRTDCRNYGGLLGIADIRELWAEALGLPADLVVAQDGSSLNIFDLISWSYTWGNNDS
1b5pA           DTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFVTPEETIVTVGGSQALFNLFQAILDPGDEVIV
3ei6B           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISR--LQVMFGSNVTI
3b46B           P-PQFAIKEAQKALDIPMVNQYSPSLINSLIKLYSPIYLKAENVTVTTGANEGILSCLMGLLNA--GDEV
3b46A           P-PQFAIKEAQKALDIPMVNQYSPSLINSLIKLYSPIYLKAENVTVTTGANEGILSCLMGLLNAGDE--V
3eiaA           PIPEVITSAMAKKAHELSTIEGYKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISR--LQVMFGSNVTI
1dfoB           YTSPRVMQAQGSQLTNKYAEGYPGIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLG
1ay4A           HIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATV-------GGTGALRQ
5bj3A           DTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFVTPEETIVTVGGSQALFNLFQAILDPGDEVIV
2bwoB           GQHPVVLAAMHEALEAVGAGSGGTAYHRRLEAEIAGLHQ-KEAALVFSSAYNANDATLSTLRVLFPGLII
1bj4A           FASRAVLEALGSCLNNKYSEGYPGELETLCQKRALQDPQCWGVNVQPYSGSPANFAVYTALVEPHGR--I
1djuB           DTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLDPKTEIMVLLGANQAFLMGLSAFLKDGEEVLI
3ei9A           PIPEVITSAMAKKAHELSTIEGYSPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISR--LQVMFGSNVTI
2dr1B           ACFPEVLEIMKVQMFSHRSKEYRKDTVERLREFLEVEKGEVLL--VPSSGTGIMEASIRNGVSK--GGKV
3ca8B           LYSAIAQHPHYNTIRTTGRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTA
1bjoA           MLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAA
2bhgA           ------------------------------------------------------------------VGNT
3cbfA           PAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDE--GSPV
1agxA           KELLSLARQVNDLVKKPSVNGHGTDTMEETAFFLNLVHTDKPITALSADGPLNLYSAVALASEAKNKGVM
1bjnA           MLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAA
1d2fA           ATAPCIIEALNQRLMHGVFGYSRWEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEG
5bj4A           DTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFVTPEETIVTVGGSQALFNLFQAILDPGDE--V
3cq4B           PPSEALVADLVATVDKIATELDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRT
2dgkA           WDDENVHKLMDLSINKNWIYPQSAAIDLRCVNMVADPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME
1ejiA           FASRAVLEALGSSLNNKYSEGYPELCQKRALQAYHLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIGL
3cq4A           PPSEALVADLVATVDKIATELRDAELRDELAAYITKQTVTRDNLWAANGSNEILQQLLQAFGGP--GRTA
2bwnA           GQHPVVLAAMHEALEAGSGGTRNISGTTAYHRRLEAEIAGKEAALVFSSAYNANDATLSTLRVLFPG---
2bwnE           GQHPVVLAAMHEALEAVGAGSGGISGTTAYHRRLEAEIAGKEAALVFSSAYNANDATLSTLRVLFPGLII
3dc1B           PFKTAVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKGQMDLCVTSGSQQGLCKVFEMIINPGDNVLL
3d6kB           DLSNDLLSLPGGDFRTCRNYGGLLGIADIRELWAEALGLPADLVVAQDGSSLNIFDLISWSYTWGNNDSS
3dwkA           HVNLKDVPKSMKDAVLATEDRFYEHGALDYKRLFGSTLTQVVKDAFLSIGRKAQEAYLSYRLEQEDDIFQ
1ecxB           RVDDRVLEEMIVFYREKYGNPNSALHMEKAREKVAKVLGVPSEIFFTSCATESINWILKVAETFEKRKRT
2dr1A           ACFPEVLEIMKVQMF-SHRSKEYRKVHMDTVERLREEVEKGEVLLVPSSGTGIMEASIRNGVSK--GGKV
2egyC           PKEEAAEAAARILREKALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLL
2bieA           ALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTM
1bw0A           LTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGG--SHGI
1eg5B           RVDDRVLEEIVFYREKYGNPNIEANLHEKAREKVAKVLGVSSEIFFTSCATESINWILKTVAFEKRKRTI
2bhxB           ALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVH------------EQAQNLLRELLQIPNDYQIL
2bieB           ALPKPALERAQKELLNFNDTQMSVEVHEQAQNLLREIPNDYQILFLQGGASLQFTMLPMNLLTKGTI--G
2aevA           KARKIILEILNEKGRDALYDLSGLSGGFLI---DEKDKALLNTYIGSSYFAEKVNEYGLKHLGGDENDKC
2c0rA           ALPLEVLERAQAEFVDYQHTGMSIAVHNEAQARLLLGNPTGYKVLFIQGGASTQFAMIPMNFLKEGQTAN
2bwoA           GQHPVVLAAMHEALEAGSGGTRNISGTTAYHRRLEAEIAGKEAALVFSSAYNANDATLSTLRVLFPGLII
3bcxB           GKVTKELQLMVEASLDGWLTTGRDAFEKKLGEYLGVPYVLT-----TTSGSSAALTSPKLGVRALKPGDE
1eg5A           RVDDRVLEEIVFYREKYGNPNIEANLHEKAREKVAKVLGVPSEIFFTSCATESINWILKTVAETFEKRTI
3ecdD           ERDASVRGAILKELERQQSQVELIASENIVSRAVLDA---QGSVLTNKYADEVEALAIERVKRLFNAGHA
1bw0B           LTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGGSHG--I
1dfoA           YTSPRVMQAQGSQLTNKYAEGYPGIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLG
3bcxA           GKVTKELQLMVEASLDGWLTTGRDAFEKKLGEYLGVPYVLT-----TTSGSSAALTSPKLGVRALKPGDE
3cq5B           PPSEALVADLVATVDKIATELNRYPLRDELAAYITKQTAVTRDNLWAANGSNEILQQLLQAFGGPGRTAL
3cq5A           PPSEALVADLVATVDKIATELNRYPLRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRT
2ch1A           NCSKRVLTAMTNTVLSNFHAELF-RTMDEVKDGLRYQTENRATMCVSGSAHAGMEAMLSNLLEEGDRVLI
1c0nA           QKPSQVIDAEAEFYRHGYAAVHAGEKMENVRKRASLNARSAEELVFVRGTTEGINLVANSWGNSNVRANI
1ecxA           RVDDRVLEEMIVFYREGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKVAETFEKRKRT
1c4kA           YDFFGERADLCNADVALGDLLIHEGPAVAAEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVLF
2a7vA           DSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGVDEIELLCQRRALEAFDLDPA
2cdmA           --------IGRAASFYASEWQGKGAEELGLSGEVDSK--RFRELLAGNIGEGHRIRSATRQDSKERIGLD
2dkjA           FVSKQVREAVGSVLTNKYAEGYPGRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMG
3ecdB           ERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYADEALAIERVKRLFNAGHAN
1bs0A           H-HPQIIRAWQQGAEQGIGSGGSGHLEEELAEWLG-----YSRALLFISGFAANQAVIMMAKE----DRI
1b9hA           PAWPQYDDAERNGLVRALEWWRMGGDEVNSFEREFAAHHGAAHALAVTNGTHALELALQVMGVGPGT-EV
3c3jC           LAVFAPETINSQTFRDVADRCQAILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAARESLKVLELTAGKL
3e77A           SVLLEIQKELLDYKGVGISVLEMSHIINNTENLVRELLAVYKVIFLQGGGCGQFSAVPLNLIGLKAGRCA
2ch2A           PGPSNCSKRVLTAMTNTVLSNELFRTMDEVKDGLRYQTENRATMCVSGSAHAGMEAMLSNLLEEGDRVLI
1djeA           H-HPQIIRAWQQGAEQGIGSGGSGHLEEELAEWLGYSRALL-----FISGFAANQAVIAAMMAKEDRIAA
3ca8A           LYSAIAQHPHYNTIRTTGRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTA
3e77C           SVLLEIQKELLDYKGVGISVLEMSHIINNTENLVRELLAVYKVIFLQGGGCGQFSAVPLNLIGLKAGRCA
1b9iA           PAWPQYDDAERNGLVRALEWWRMGGDEVNSFEREFAAHHGAAHALAVTNGTHALELALQVMGVG-PGTEV
3e77B           SVLLEIQKELLDYKGVGISVLEMSHIINNTENLVRELLAVYKVIFLQGGGCGQFSAVPLNLIGLKAGRCA
3bb8A           GKVTKELQLMVEASLDGWLTTGRDAFEKKLGEYLGVPYVLT-----TTSGSSAALTSPKLGVRALKPGDE
2e7jA           QTGGKLTEEARQALLEW------PPIHDFIHNQLPKFLG-CDVARVTNGAREAKFAVMHSLAKKDAWVVM
2bwpB           Q-HPVVLAAMHEALEAVGAISGTTAYHRRLEAEIAGLHQ-KEAALVFSSAYNANDATLSTLRVLFPGLII
1cj0A           FASRAVLEALGSCLNNKYSEGYPGLCQKRALQAYGLDPQCWGVNVQPYSGSPANFAVYTALVEPHGR--I
3blvH           HGLTNHADQIQNAVLSTIASGPE-----------------------------------------------
3dr4B           VAAPRLDGNERDYVLECMDTTSVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVI
3b8xB           LASSTWDDLEYKAIQSVLDSKMMGEYVKQYETQFAKTFG-SKYAVMVSSGSTANLLMIAALFFTKKPRLK
3bn1D           -AAPRLDGNERDYVLECMDTTSVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVI
3dr4D           VAAPRLDGNERDYVLECMDTTSVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVI
3bn1C           VAAPRLDGNERDYVLECMDTTSVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALV-AMGIGPGDEV
1cj0B           FASRAVLEALGSCLNNKYSEGYPGELETLCQKRALQAPQCWGVNVQPYSGSPANFAVYTALVEPHGR--I
2aeuA           ----KARKIILEILNEKGRDALYDLSGLSGGFLIDEKKALLNTYIGSSYFAEKVNEYGLKHLGGDENDKC
3b8xA           LASSTWDDLEYKAIQSVLDSKTMGEYVKQYETQFAKTFG-SKYAVMVSSGSTANLLMIAALF--------
2c81A           QHSDRTRRKIEEVFQSNRWAISGESMERKFAKAFADFNG-VPYCVPTTSGSTALMLALEALGIGEGDEVI
3dr4A           -AAPRLDGNERDYVLECMDTTSVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVI
3dr7B           VAAPRLDGNERDYVLECMDTTSVGRFIVEFEKAFADYCG-VKHAIACNNGTTALHLALVAMGIGPGDEVI
3d1rA           ----------------------------------------------------------------------
3caiA           LIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLDAEAVADLVNVLGADRAVLLSLLAEASSSRAGLEV
2c7tA           QHSDRTRRKIEEVFQSNRWAISGESMERKFAKAFADFNG-VPYCVPTTSGSTALMLALEALGIGEGDEVI
3blxD           HHADQIQNAVLSTIASGPEN--------------------------------------------------
2douA           ----------------------------------------------------------------------
3blvD           HGLTQIQNAVLSTIASG-----------------------------------------------------
3dr4C           VAAPRLDGNERDYVLECMDTTWISSVGRFIVEFEKADYCGVKHAIACNNGTTALHLALVAMGIGPGD-EV
1dkrA           NSNPELAKEIADIVGVQLSVTRFSDGEVQINIEES--IRGCDCYIIQSTSDPVNEHIMELLIMVDVIPYY
2dqxA           -----------------------------------------QLLQLRAAGVDGVMVDVRWGIIELKGPKQ
2bkwA           ILSGAVQKALDVPSLGEFVSIFQRVLKNTRAVFKSAAASKSQPFVLAGSGTLGWDIFASFILSKAPNKNV
2douB           ----------------------------------------------------------------------
3bwnB           ----------------------------------------------------------------------
2a8iB           ----------------------------------------------------------------------
3bn1A           VAAPRLDGNERDYVLECMDTTWISSVGRFIVEFEKADYCGVKHAIACNNGTTALHLALVAMGIGPGDEVI


                         +         .         .         .         .         *         .:210
query           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPXXXXXXXXXXXXXIAAIIFEP
2e7uA           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEP
3du4A           IAMKNGYHGDTIGAVSVGSIELFHHVGPLMFESYKAPIPYVYRSESGDPDECRDQLRELAQLLALSIESM
3dodB           QKF----------IAMKSYKAPIPYVYRSESGDPDECRDQCL------RELAQLLEEHHEEIAALSIESM
3dodA           QKF----------IAMKSYKAPIPYVYRSESGDPDECRDQCL------RELAQLLEEHHEEIAALSIESM
3drdB           QKF----------IAMKSYKAPIPYVYRSESGDPDECRDQCL------RELAQLLEEHHEEIAALSIESM
3bs8A           LKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEP
2cinA           LHLRGAFHGRSGYTLSLTNTKPARFPKFDWPRIDAPYMRPGLALEAEALRQARAAFETRPHDIACFVAEP
2bylA           VFAAGNFWGRTLS-------AISSSTDPTSYDGFGPFMPGFDIIPYNDL--PALERALQDPNVAAFMVEP
3clzB           NRYDGIYKVVKYWPEGKSGFLYLLRRDDDEPGPWTKEGK----------------------DRIKKLGLT
3clzD           NRYDGIYKVVKYWPEGKSGFLYLLRRDDDEPGPWTKEGK----------------------DRIKKLGLT
3bv0A           MTWRGGYHGDTFLAMSICDPHGGHSLWTDVLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGELAAVVVEP
2byjA           VFAAGNFWGRTLS-------AISSSTDPTSYDGFGPFMPGFDIIPYNDL--PALERALQDPNVAAFMVEP
1dtyA           LTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDVGFARLMAAHRHEIAAVIIEPI
3clzA           NRYDGIYKVVKYWPEKGKSGFLLLRRDDDEPGPWTKEGKDRI----------------------------
2cfbA           IKFEGCYHGHAATLTAP----------------------------YNDLEAVSRLFEQYPNDIAGVILEP
1d7uA           VGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPLAELDYAFDLIDRQSSGNLAAFIAEP
3drdA           GKPEKQKFIAMKSYKAPIPYVYRSESGDPDECRDQCLRELAQLLEEHHEEIA-----------ALSIESM
1dgdA           VGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFATYRPRFERNLAELDYAFDLIDRQSSGNLAAFIAEP
3dxvB           IAFAGAYHGCTVGSMAFSGHSAAKADGLILLPYPDPYYRNDPTGDAILTLLTEKLAAVPAGSIGAAFIEP
1asfA           WVSNPSWPNHKSVFN-------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC
2dgmC           -RMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVT
2d5yA           WVSNPSWPNHKSVFN--------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHG
1ajrA           ARWYNGTNNKDTPVYVSSPTENHNGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHA
1b8gA           --PTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQ---------EAEKRNLRVKGVLVTN
2eh6A           ISFENSFHGRTYGSLSATGQPKFHKGFE----------PLVPGFSYAKLNDIDSVYKLLDEETAGIIIEV
2dgmA           AAG----KPTDKPNLVCGPVQICWHKFARYWDVELREIPMR---PGQLFMDPKRMIEACDENTIGVVPTF
3aatA           WVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
2cy8A           LRFEGTTANT-------------------------------LLIRPDDIEGMREVFANHGSDIAAFIAEP
3dxvA           IAFAGAYHGCTVGSMAFSG----LILLP----YPDPYYRNDPTGDAILTLLTEKLAAVPAGSIGAAFIEP
1arsA           WVSNPSWPNHKSVFN--------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHG
2dgmE           AAGKPTDKPNL----VCGPVQICWHKFARYWDVELREIPMRPGQLFMDP---KRMIEACDENTIGVVPTF
2d64A           WVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
2e54A           LSAHNSFHGRTLGSLT----------ATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEP
1czcA           WVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
2aatA           WVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAG-------------DVVLFHGC
1arhA           WVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAG-------------DVVLFHGC
2d66A           WVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
1aamA           WVSNPSWPNHKSVFN--------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHG
1b8gB           LIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQ---------ITETALEEAYQEAEKRNLRVKGVLVTN
1bqdA           WVSNASWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
1c7gA           NMYFTTTRFHQEKNGATFVDIVRD-------EAHDASLNLPFKGDIDLNKLATLIKEKGAENIAYICLAV
7aatA           VYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPE-------------KSIILLHA
1btcA           LFQLVQECGLTLQAI--MSFHQCGGNVGDIVNIPIPQWVLDIGESNHDIFYTNRSGTRNKEYLVGVDNEP
3dc1D           VFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIIESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVP
1bybA           LFQLVQECGLTLQAIMSFHQC--GGNVGDIVNIPIPQWVLDIGESNHDFYTNRSGTRNKEYLTVGVDNEP
2dgmB           AAGKPTDKPN----LVCGPVQICWHKFARYWDVELREIPMR---PGQLFMDPKRMIEACDENTIGVVPTF
1aiaA           WVSNPSWPNHKSVFN-------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC
1ajsA           ARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWDTEKLDLQGFLSDLENAPEFSIFVLHAC
1aheA           WVSNPSWPNHKSVFN--------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHG
3ei9B           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIE---------YMRCTPENGFFPDLSTVGRTDIIFFCS
1bqaA           WVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
1c7nA           IIITPVYYPFFMAIKNQERKIIECELLEKDGYYTIDFQKLEKLSKDK---------------NNKALLFC
1ariA           WVSNPSHPNHKSVF--------------NSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHG
1akaA           VYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPE-------------KSIILLHA
1ay5B           FVSDPTWPNHVSIMN--------------FMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHG
3e2fA           MVPFYDCYEPMVRM---AGAVPVFIPLRSKPTDGMKWTS------SDWTFDPRELESKFSSKTKAIILNT
1b4xA           WVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQA--------------GDVVLFHG
3bc8A           IWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQEL---------------GPEHILCL
1cliB           -----------PVLVSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVND--------------LVVQGAEP
3cq6A           ALGFQPSYSMHPILAKGTHT--------------------EFIAVSRGADFRIDMDVALEEIRAKQPDIV
1d2fB           VVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCMGKLEAVLAKPEC---------------KIMLLC
3d6kA           RPW---SAEEKVKWLCPVPGYDRHFTITEHFGFEINV--------PTDEGPDGVVRELVKDPQVKGWTVP
3bcaA           YIIWPRIDQKSCFKSMVT---------AGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHSTT
2c44A           VAFSNYFFDTTQGHSQINGCT----VRNVYIKEAFDTGVRYDFKGNFDLGLERGIEEVGPNNVPYIVATI
3dzzB           Q---EPVYNFYSVIEGNGRRVISSDLIYENSKYSVNWADLEEKLATPS-----------------VRVFC
3ei7A           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF---------PDLSTVGRTDIIFFCS
3dc1A           DEPAYSGTLQSLHP---LGCNIINVASDESGIVPDSLRDILSRWKPED------AKNPQKNTPKFLYTVP
1bkgA           IVLSPYWVSYPE--------------MVRFAGGVVVEVETL--PEEGFVPDPERVRRAITPRTKALVVNS
2egyB           LLEAPSYMGAIQAFRLQGPR------------------FLTVPAGEEGPDLDALEEVLKRERPRFLYLIP
3dydA           LVPRPGFSLYKTLAESMGI----------------EVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNN
1ax4A           VFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETYDDW----KGDFDIKLKENIAQHGADNIVAIVSTV
3bv0B           MTWRGGYHGDTFLAMICDPHGGMHSLWTDVLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGELAAVVVEP
2bwnB           YS---DSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA----------------APKLIAFES
2cstA           RRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDARGLDLQGLLDDMEKAPEFSIFILHAC
1ay4B           FVSDPTWPNHVSIMNF-MGLPVQTYRYFDAETRGVDFEGMKADLAAAKKG-------------DMVLLHG
3ei6A           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIE--------YMRCTPENGFFPDLSTVGRTDIIFF--C
3bcbA           YIIWPRIDQKSCFKSMVTFEPVVIENVLEGDELRTDLKAVEAKIQEL---------------GPEHILCL
3d6kD           SRPWS--AEEKVKWLCPVPGYDRHFTITEHFGFE-------INVPTDEGPDGVVRELVKDPQVKGWTVPV
1bjwA           VIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPR---------------TKALVVNS
2c44B           LDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIAFDTGVRYDFKGNFDLGLERGIEEVGPNNVPYIVATI
3ei8A           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF----------PDLSTVGRTDIIFFC
3ei7B           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF----------PDLSTVGRTDIIFFC
1asbA           WVSNPSWPNHKSVFN--------------SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHG
3dydB           LVPRPGFSLYKTLAESMGIEV-----------------KLYNLLPEKSWEIDLKQLEYLIDEKTACLIVN
2d61A           WVSNPSWPNH-------------KSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC
3e9kA           ILLEAKAFSDHYAIESQLQLHGLNIEESMRMIKPREGEE------TLRIEDILEVIEKEGDSIAVILFSG
2dgkC           AAGKPTDKPN----LVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDEN---TIGVVPTF
1djuA           PT---PAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVT----------------DKTRALIIN
3ecdC           VQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLIDYDQ-------VEALAQQHKPSLIIA
2bwpA           LIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA----------------APKLIAFES
3ecdA           NVQPHSGAQNGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLIDYDQ-------VEALAQQHKPSLIIA
1b5oA           IVLSPYWVSYPEMV--------------RFAGGVVVEVETL--PEEGFVPDPERVRRAITPRTKALVVNS
2bwnD           YS---DSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA----------------APKLIAFES
2bwoD           YSD---SLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA----------------APKLIAFES
3e2yA           VIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRE------LESKFSSKTKAIILNT
3eiaB           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF----------PDLSTVGRTDIIFFC
2egyD           EAPSYMGAIQAFRLQ-----GPRFLTVPAGEEGPDLDA-LEEVLKRERP--------------RFLYLIP
2c44C           LDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYKGNFDLEGLERGIEEVGPNNVPIVATI
3dzzA           QE---PVYNFYSVIEGNGRRVISSDLIYENSKYSVNWADLEEKLATP---------------SVRVFCNP
3d6kC           SRPWSAEEK--VKWLCPVPGYDRHFTITEHFGFE--------INVPTDEGPDGVVRELVKDPQVKGWTVP
1b5pA           LSP--YWVSYPE--------MVRFAGGVVVEVETLPEEGFVPDPERVRR---------AITPRTKALVVN
3ei6B           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF----------PDLSTVGRTDIIFFC
3b46B           IVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQ------FEKAITSKTKAVIINT
3b46A           IVFEPFFDQYIPNIELCGGK-------VVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVIIN
3eiaA           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF---------PDLSTVGRTDIIFFCS
1dfoB           MNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADL----------------EKQAKEHKPKMIIG
1ay4A           ALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHG
5bj3A           --LSPYWVSYPEMVRFAGGVV-----------------VEVETLPEEGFVPDPERVRRAITPRTKALVVN
2bwoB           YSDSLNHASMIEGI---KRNAGPKRIFRHNDVAHLRELIAADDPA----------------APKLIAFES
1bj4A           MGLDLPDGGHLTHGFMTDKKKISATSIFFESMP-------YKVNPDTGYINYDQLEENARLFHPKLIIAG
1djuB           --PTPAFVSYAPAVILAGGKP-----------------VEVPTYEEDEFRLNVDELKKYVTDKTRALIIN
3ei9A           AVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFF----------PDLSTVGRTDIIFFC
2dr1B           LVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAV-KPEDLDDALRKNPD-------------VEAVTITY
3ca8B           IVVQDPTMQRRTMTFRRMTGDNPDAPRWLSYPGGNNADSVIFINQLQGLWPVERYLSLLTGELPRLRDDS
1bjoA           VPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRA--VKPMREWQLSDNAAYMHYCP
2bhgA           KPVELNLDGKTVAICCATGVFGTAYLVPR-HLFAEKYDKIL----DGRATDSDYRVFEFEIKVKGQDLSD
3cbfA           LLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKR------------------ERPRFLYLIP
1agxA           VLMNDSIFAARDVTKGINIHTHAFVSQWNSEFNIEKIQGDALPGVQIVYGSDNMMPDAYQAFAKAGVKAI
1bjnA           VPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRA----------VKPMREWQLSDN
1d2fA           VVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPE--------------CKIMLLC
5bj4A           IVLSPYWVSYPEMVRFAGGVV-----------------VEVETLPEEGFVPDPERVRRAITPRTKALVVN
3cq4B           ALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIR----------------AKQPDIVFVTT
2dgkA           AAGKPTDKPN----LVCGPVQICWHKFARYWDVELREIPMR---PGQLFMDPKRMIEACDENTIGVVPTF
1ejiA           DLPDGGHLTHGFTDKKKISATSIFFESPYKVYPETGYINYDQLEENASL-------------FHPKLIIA
3cq4A           LGFQPSYSMHPILA---------------------KGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIV
2bwnA           LIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA----------------APKLIAFES
2bwnE           YS---DSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAA----------------PKLIAFES
3dc1B           DEPAYSGTLQSLH---PLGCNIINVASDESGIVPDSLRDILSRWKPED------AKNPQKNTPKFLYTVP
3d6kB           RPW---SAEEKVKWLCPVPGYDRHFTITEHFGFE--------INVPTDEGPDGVVRELVKDPQVKGWTVP
3dwkA           VYLNKIYYSDGVTGIKAAAKY-------------------------------------------------
1ecxB           IITTPIEHKAVLETMKYLSMKGFKVK--------------YVPVDSRGVVKLEELEKLVDEDTFLVSIMA
2dr1A           LVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLDDALRKNPDV--------------EAVTITY
2egyC           --EAPSYMGAIQAFRLQGP------------------RFLTVPAGEEGPDLDALEEVLKRERPRFLYLIP
2bieA           LPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIP------------DFSEFQLNE
1bw0A           LMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR---PENDWEADLDEIRRLKDDKTKLLIVT
1eg5B           ITTPIEHKAVLETKYLSKGFKVKYVPVD-----SRGVVKLEELEKLVDED-------------TFLVSIA
2bhxB           FLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNE
2bieB           NYVLTGSWSEKALKEAKLLGETHIAAST--------KANSYQSIP----------------DFSEFQLNE
2aevA           VGFNRTSSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAKYFESDKVGEILNKIDKDTLVII---
2c0rA           YVMTGSWASKALKEAKLIGDTHVAASSEASNYMTLP-------------------------KLQEIQLQD
2bwoA           YSD---SLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPK----------------LIAFES
3bcxB           VITVAAGFPT-------------TVNPTIQNGLIPVFVDVD---IPTYNVNASLIEAAVSDKTKAIMIAH
1eg5A           ITTPIEHKAVLETKYLSKGFKVKYVPVD-----SRGVVKLEELEKLVDED-------------TFLVSIA
3ecdD           NVQPHSGAQNGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLIDYDQ-------VEALAQQHKPSLIIA
1bw0B           LMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR---PENDWEADLDEIRRLKDDKTKLLIVT
1dfoA           MNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEH----------------KPKMIIG
3bcxA           VITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLI-----------------------EAAVSDKT
3cq5B           G-FQPSYSMHPILA---------------------KGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIV
3cq5A           ALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEE--------------------IRAKQPDIV
2ch1A           --AVNGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQ---------------PKCLFLTH
1c0nA           IISQMEHHANIVPWQMLCARV--------------GAELRVIPLNPDGTLQLETLPTLFDAATRLLAITH
1ecxA           IITTPIEHKAVLETMKYLSMKGFKVKYVPVD--SRGVVKLEELEKLVDED------------TFLVSIMA
1c4kA           DRNNHKSVYNSALAMAGGRPVYLQTNRNPYGFIGGIYDSDFDEKKIRELAAKVDPERAKWKRPFRLAVIQ
2a7vA           QWGVNVQPYSGSPANLAVYTALLQPHDR----------IMGYKLNPKTGLIDYNQLALTARLFRPRLIIA
2cdmA           LTFSAPKSVSLQALVAGAHDRAVARTLEQATRIETTGNLVIGKFRHETSRERDPQLHTHAVILNTKRSDG
2dkjA           --MDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRR-----------------LALEHRPK
3ecdB           VQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLIDYDQ-------VEALAQQHKPSLIIA
1bs0A           AADRLSHAS-----LLEAASLS-----PSQ----------LRRFAHNDVTHLARLLASPCPGQQMVVTEG
1b9hA           IVPAFTFISSSQAAQR---LGAVTVPVDVDAATY-----------NLDP----------EAVAAAVTPRT
3c3jC           AAFYDSPTGFRHG----------PKSLVDDETLVVVFVSSHPYTRQYDLDLLAELRRDNQARVIAIAAES
3e77A           DYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNP----------------DASYVYYCA
2ch2A           --AVNGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQ---------------PKCLFLTH
1djeA           DRL-----SHAS--LLEAASLS-----PSQ----------LRRFAHNDVTHLARLLASPCPGQQMVVTEG
3ca8A           IVVQDPTMQRRTMATFRR----------------------------------------------------
3e77C           DYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNP----------------DASYVYYCA
1b9iA           IVPAFTFISSSQAAQR---LGAVTVPVDVDAATY-----------NLDPEAV----------AAAVTPRT
3e77B           DYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNP----------------DASYVYYCA
3bb8A           V-------------ITVAAGFPTTVNPTIQNGLIPVFVDVD---IPTYNVNASLIEAAVSDKTKAIMIAH
2e7jA           --DENCHYSSYVAAERAGLNIALVPKTDYPDYAIT-PENFAQTIEETKKRG--------------EVVLA
2bwpB           YSDSLNHASMIEGIKR---NAGPKRIFR-----------------HNDVAHLRELIAADDPAAPKLIAFE
1cj0A           MGLDLPDGGHLTH-------GFMTDKKKISATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAG
3blvH           ----------------------------------------------------------------------
3dr4B           V-PSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLE-----------------ALITPRTKAIMPVH
3b8xB           KGDEIIVPAVSWSTTYYP---------LQQYGLRVKFVDIDINTLNIDIESL----------KEAVTDST
3bn1D           V-PSLTYIASANSVTYCGATP-----------------VLVDNDPRTFNLDAAKLEALITPRTKAIMPVH
3dr4D           V-PSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKL------------------------EALITPRT
3bn1C           IVPSLTYIASANSVTYCGA-----------------TPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVH
1cj0B           MGLDLPDGGHLTHGFMTDKKKISATSIF-------FESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAG
2aeuA           VGFNRTSSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAKYFESDKVGEILNKIDKDTLVIITGS
3b8xA           -FTKKPRLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDI----------ESLKEAVTDST
2c81A           V-PSLTWIATATAVLNVNALP------------------------VFVDVEADTYCIDPQLIKSAITDKT
3dr4A           -VPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKL------------------------EALITPRT
3dr7B           V-PSLTYIASANSVTYCGA-----------------TPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVH
3d1rA           ---------------------------------------------------------------PDSEVDV
3caiA           IVSRLDDEANIAPWLRAAHRYGA---KVKWAEVDIETGELPT----------WQWESLISKSTRLVAVNS
2c7tA           -VPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLI------------------------KSAITDKT
3blxD           ----------------------------------------------------------------------
2douA           ----------------------------------------------------------------VLLLNY
3blvD           ----------------------------------------------------------------------
3dr4C           IVPSLTYIASANSVTY--------------CGATPVLVDNDPRTFNLDAAKLEALITPR---TKAIMPVH
1dkrA           GYARQDRKSREPILLETAGATRVIALDLHAPQIQGFFD-----IPIDHGVPILGEYFEGKNLEDIVIVSP
2dqxA           YDWRA-YRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIYTNRSGTRNKEYLTVGVDNEP
2bkwA           LVVSTGTFSDRFADCLRSYGAQVDVVRPLKIGESVPLELITEKLSQNSY--------------GAVTVTH
2douB           ----------------------------------------------------------------VLLLNY
3bwnB           ----------------------------------------------------------------------
2a8iB           --------------------------------------------------------------SSPFLASE
3bn1A           V-PSLTYIASANS--------------VTYCGATPVLVDNDPRTFNLDAAKLEALITPR---TKAIMPVH


                         .         .         .         +         .         .         .:280
query           VVGNAGVLVPTEDFLKALHEAREFGVLLIADEVMTGFRLAFGGATELLGLKPDXXXXXXXXXXXXXXXXX
2e7uA           VVGNAGVLVPTEDFLKALHEAKAYGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKILGGGLPAAAY
3du4A           VQGASGMIVMPEGYLAGVRECTTYDVLMIVDEVATGFRTGKMFACEHENVQPDLMAAGKGITGGYLPIAV
3dodB           VQGASGMIVMPEGYLAGVRECTTYDVLMIVDEVATGFRTGKMFACEHENVQPDLMAAGKGITGGYLPIAV
3dodA           VQGASGMIVMPEGYLAGVRECTTYDVLMIVDEVATGFRTGKMFACEHENVQPDLMAAGKGITGGYLPIAV
3drdB           VQGASGMIVMPEGYLAGVRECTTYDVLMIVDEVATGFRTGKMFACEHENVQPDLMAAGKGITGGYLPIAV
3bs8A           VAGNMGVVPPQEGFLQGLRDTEQYGSLLIFDEVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAY
2cinA           IQGEGGDRHFRPEFFAAMRECDEFDALLIFDEVQTGCLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGR
2bylA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDVLLGKALSGGLYPVSAV
3clzB           MQYPEGYLEALA----------------------------------------------------------
3clzD           MQYPEGYLEALA----------------------------------------------------------
3bv0A           VVQGAGMRFHDPRYLHDLRDCRRYEVLLIFDEIATGFGRTGALAADHAGVSPDIMCVGKALTGGYLSLAA
2byjA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDVLLGKALSGGLYPVSAV
1dtyA           VQGAGGMRMYHPEWLKRIRKCDREGILLIADEIATGFRTGKLFACEHAEIAPDLCLGKALTGGTMTLSAT
3clzA           ----------------------------------------------------------------------
2cfbA           VVGNAGFIPPDAGFLEGLRETKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAY
1d7uA           ILSSGGIIELPDGYMAALKRCEARGMLLILDEAQTGVGRTGTMACQRDGVTPDILTLSKTLGAGLPLAAI
3drdA           VQGASGMIVMPEGYLAGVRECTTYDVLMIVDEVATGFRTGKMFACEHENVQPDMAAGKGITGGYLPIAVT
1dgdA           ILSSGGIIELPDGYMAALKRCEARGMLLILDEAQTGVGRTGTMACQRDGVTPDILTLSKTLGAGLPLAAI
3dxvB           IQSDGGLIVPPDGFLRKFADCRAHGILVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAV
1asfA           CHNPTGI-DPTLEQWQTLAQSVEKGWLPLFDFAFQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
2dgmC           YTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVADFRLPRVKSISASGHKFGLAPLGCGWV
2d5yA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
1ajrA           CAHNPTGTDPTPEQWKQIASMKRRFLFPFFDSAYQGFAWAIRYFVSEGFELFCAQSFSNFGLYNERVGNL
1b8gA           PSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVY
2eh6A           IQGEGGVNEASEDFLSKLQECKEKDVLLIIDEVQTGIGRTGEFYAQHFNLKPDVIALAKGLGGGVPIGAI
2dgmA           GVTYTGNYEFPHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWRVKSISASGHKFGLAPLGCGWV
3aatA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
2cy8A           VGSHFGVTPVSDSFLREGAEARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGIL
3dxvA           IQSDGGLIVPPDGFLRKFADCRAHGILVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAV
1arsA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
2dgmE           GVTYTGNYEFPQDALDKFQADTGIDIDMHIDAASGGFLAPFVADFRLPRVKSISASGHKFGLAPLGCGWV
2d64A           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
2e54A           IQGESGIVPATKEFLEEARKCDEYDALLVFDEVQCGMGRTGKLAYQKYGVVPDVLTTAKGLGGGVPIGAV
1czcA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGTC
2aatA           CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSANFGLYNERVGAC
1arhA           CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQGDAEGLRAFAAMHKELIVSSYSKNFGLYNERVGAC
2d66A           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
1aamA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGDAEGLRAFAAMHKELIVSSYSKNFGLYNERVGAC
1b8gB           PSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVY
1bqdA           CCHNATGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGDAEGLRAFAAMHKELIVASSYSNFGLYNERVGAC
1c7gA           TVNLAGGQPVSMANMRAVHEASTYGIKIFYDATRCVENAYFIKEQEAGYENADGCTMSGKKDCLVNIGGF
7aatA           CAHNPTGVDPRQEQWKELASVKKRNLLAYFDMAYQGFASGDINDAWALRHFIEQGIDVVLSQSYAKNMGL
1btcA           IFHGRTAIEIYSDYMKSFREMSDFLESGLIIDIEVGLPAGELRYPS------------------------
3dc1D           NGNNPTGNSLTSERKKEIYEARKYDFLIIEDDPYYFLQFNKFRPTFLSMDVDGRVIRADSFSIISSGLRI
1bybA           IFHGRTAIEIYSDYMKSFREMSDFLESGLIIDIEVGL---------------------------------
2dgmB           GVTYTGNYEFPQDALDKFQADTGIDIDMHIDAASGGFLAPFVADFRLPRVKSISASGHKFGLAPLGCGWV
1aiaA           CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSHNFGLYNERVGAC
1ajsA           AHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEDAWAIRYFVSQSFSKNFGLYNERVGNL
1aheA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
3ei9B           PNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEASFSNYAGFTGVRLGWT
1bqaA           CCHNATGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLY
1c7nA           SPHNPVGRVWKKDELQKIKDVLKSDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNI
1ariA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGDAEGLRAFAAMHKELIVSSYSKNFGLYNERVGAC
1akaA           CAHNPTGVDPRQEQWKELASVKKRNLLAYFDMAYQGFASGDINDAWALRHFIEQGIDVVLSQSYAHNMGL
1ay5B           CCHNPTGANLTLDQWAEIASLEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASASCSKNFGIYRERTGCL
3e2fA           PHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVGMWERTITIGSAGTFSVTGWKLGWS
1b4xA           SCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
3bc8A           HSTTACFAPRVPDRLEELAVCANYDIPHVVNNAYGLQSSKCMHLIQQGARVGRIDAFVQSLDNFMVPVGG
1cliB           LFFLDYYATGASAVISGIAECLQSGCSLVGGETAEMPGMYHGE-----DYDVAGFCVGVVEKSEIIDGSK
3cq6A           FVTTPNNPTGDVTSLDDVERINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSAFDFAGGRL
1d2fB           SPQNPTGKVWTCDELEIMADCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPAL
3d6kA           VFGNPTGVTFSEQTCRELAETAAPDFRIVWDNAYALHTVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFF
3bcaA           ACFAPRVPDRLEELAVI---CANYDIPHVVNNAYGLQSSKCMHLIQQGARVGRVQSLDNFMVPVGGAIIA
2c44A           TSNSAGGQPVSLANLKAMYSAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTLAMSAKKDAMVPMGGLL
3dzzB           NPHNPIGYAWSEEEVKRIAECAKHQVLLISDEIHGDLVLTDEDITPAFNWVVSLISPSTFNLAALHAACA
3ei7A           PNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEASFSKYAGFTGVRLGWT
3dc1A           NGNNPTGNSLTSERKKEIYEARKYDFLIIEDDPYYFLFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRI
1bkgA           PNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHSPGRVAPEHTLTVNGAAKAFAMTGWRI
2egyB           SFQNPTGGLTPLPARKRLLQVMERGLVVVEDDAYRELYFFELAREAGYPGVIYLGSFSKVLSPGLRVAFA
3dydA           PSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDGGLAKRWLVPGWRLGWI
1ax4A           TCNSAGGQPVSMSNLKEVYEAKQHGIFVVMDSARFCERDPKYKNATIKEVIFDMSAKDPLLNIGGLVAIR
3bv0B           VVGAGGMRFHDPRYLHDLRDCRRYEVLLIFDEIATGFGRT-GALFAADHAGVSPDIMCVGKALTGGYLSL
2bwnB           VYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGVAERDGLMHRIDIFNGTLAAYGVFGGY
2cstA           AHNPTGT-DPTPDEWKQIAAMKRRCLFPFFDSAYQGFASAVRYFVSEGFELFCAQSFSKNFGLYNERVGN
1ay4B           CCHNPTGANLTLDQWAEIASLEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASASCSKNFGIYRERTGCL
3ei6A           SPNNPTGAAATREQLTQLVEAKKNGSIIVYDSAYAMYMSDDNPRIFEIPGAEEVAMETASFSKYAGFTGV
3bcbA           HSTTACFAPRVPDRLEELAVCANYDIPHVVNNAYGLQSSKCMHLIQQGARVGRIDAFVQSLDNFMVPVGG
3d6kD           FGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFF
1bjwA           PNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEFSPGRVAPEHTLTVNGAAAFAMTGWRIGYA
2c44B           TSNSAGGQPVSLANLKAMYSAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTAMSAKKDAMVPMGGLLC
3ei8A           SPNNPTGAAATREQLTQLVEAKKNGSIIVYDSAYAMYMSDDNPSIFEIPGAEEASFSNYAGFTGVRLGWT
3ei7B           SPNNPTGAAATREQLTQLVEAKKNGSIIVYDSAYAMYMSDDNPSIFEIPGAEEASFSKYAGFTGVRLGWT
1asbA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFAFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
3dydB           NPSNPCGSVFSKRHLQKILAAARQCVPILADEIYGDMVFSDCKYEPLATLSTDGGLAKRWLVPGWRLGWI
2d61A           CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAASSYSKNFGLYNERVGAC
3e9kA           VHFYTGQHFNIPAITKA---GQAKGCYVGFDLAHAVGNVACWCSYKYLNAHEKHAHTIKPALVGWFGHEL
2dgkC           GVTYTGNYEFPQHDALDKFQDTGIDIDMHIDAASGGFLAPFVADFRLPRVKSISASGHKFGLAPLGCGWV
1djuA           SPCNPTGAVLTKKDLEEIADVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMT
3ecdC           GFSAYPRKLDFARFRAIAD---SVGAKLMVDMAHIAGIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVL
2bwpA           VYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGVAERDGLMHRIDIFNGTLAKAYGVFGG
3ecdA           GFSAYPRKLDFARFRAI---ADSVGAKLMVDMAHIAGVIAAGRANPVEHAHVVTSTTHKTLRGPRGGFVL
1b5oA           PNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHSPGRVAPEHTLTVNGAAKAFAMTGWRI
2bwnD           VYSMDGDFGPIKE-ICDIA--EEFGALTYIDEVHAVGMYGGAGVAERDGLMHRIDIFNGTLAAYGVFGGY
2bwoD           VYSMDGDFGPIKEI---CDIAEEFGALTYIDEVHAVGMYGPRGVAERDGLMHRIDIFNGTLAKAYGVFGG
3e2yA           PHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVT
3eiaB           SPNNPTGAAATREQLTQLVEAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSQYAGFTG
2egyD           SFQNPTGGLTPLPARKRLLQVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVLS
2c44C           TSNSAGGQPVSLANLKAMYSAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTLAMSAKKDAMVPMGGLL
3dzzA           HNPIGYAW--SEEEVKRIAECAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSTFNLA
3d6kC           VFGNPTGVTFSEQTCRELAETAAPDFRIVWDNAYALHTLSDEFQAAGNPNRFWFSSTSKITHAGSGVSFF
1b5pA           SPNNPTGAVYPKEVLEALARAVEHDFYLVSDEIYEHLLYGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRI
3ei6B           SPNNPTGAAATREQLTQLVEAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEASFSKYAGFTGVRLGWT
3b46B           PHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLTLTVGSAGSFAATGWRIGWVL
3b46A           TPHNPIGKVFTREELTTLGNCVKHNVVIISDEVYEHLYFTDSFRIATLSPEIGGSAGSFAATGWRIGWVL
3eiaA           PNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPSIFEIPGAEEASFSQYAGFTGVRLGWT
1dfoB           GFSAYSGVVD----WAKMREADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLI
1ay4A           CCHNPTGANLTLDQWAEIASLEKTGALPLIDLAYQGFGDGLEEAAGTRLIASRIPEVLIAASCSKNFGIY
5bj3A           SPNNPTGAVYPKEVLEALRLAVEHDFYLVSDEIYEHLLYEGEHSPGRVAPEHTLTVNGAAKAFAMTGWRI
2bwoB           VYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGVAERDGLMHRIDIFNGTLAKAYGVFGG
1bj4A           TSCYSRN-----LEYARLRKADENGAYLMADMAHISGLVAAGVVPTLRGCRAGMIFYRKGVKSVDPATGK
1djuB           SPCNPTGAVLTKKDLEEIADVVEHDLIVISDEVYEHFIYDDARHYSIAERTITVNGFSKTFAMTGWRLGF
3ei9A           SPNNPTGAAATREQLTQLVEAKKNGSIIVYDSAYAMYMSDDNPSIFEIPGAEEASFSNYAGFTGVRLGWT
2dr1B           NETSTGVLNP----LPELAKAKEHDKLVFVDAVSAMG--GADIKFDKWGLDVVFSSSQKAFGVPPGLAIG
3ca8B           YGPRGRDFIVHVDFPAEVIHAWQAVLIEAMES--------------------------------------
1bjoA           NETIDGIAIDE-------TPDFGADVVVAADFSSTILRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDL
2bhgA           AALVLHRGNKVRDITKHFRDARKKGTPVVGVVNNADVRLIFSGTYKDIVVTPGLFAYKAATRAGYAGGAV
3cbfA           SFQNPTGGLTPLPARKRLLQVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVLS
1agxA           IHAGTGNGSMANYLVPEVRKHDEQGLQIRSSRVAQGF---------------------------------
1bjnA           AAYMHYCPNETIDGIAIDETDFGADVVVAADFSSTILSRPIDVRYGVIYAGAQNIGPAGLTIVIVREDLL
1d2fA           SPQNPTGKVWTCDELEIMADCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPAL
5bj4A           SPNNPTGAVYPKEVLEALARAVEHDFYLVSDEIYEHLLYGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRI
3cq4B           PNNP----TGDVTSLDDVERINVAPGIVIVDEAYAEFPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRL
2dgkA           GVTYTGNYEFPQHDALDKFQDTGIDIDMHIDAASGGFLAPFVADFRLPRVKSISASGHKFGLAPLGCGWV
1ejiA           GTSCYSRNLD----YARLRKADDNGAYLADAHISGLVAGVVPSPFEHCHVLRGCRAGIFYRKGVRSVDPK
3cq4A           FVTTPNNPTGDVTSLDDVERINVAPGIVIVDEAYAEFSPSTTLLEKYPTKLVVSRTMSKAFDFAGGRLGY
2bwnA           VYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAAYGVFG
2bwnE           VYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAAYGVFG
3dc1B           NGNNPTGNSLTSERKKEIYEARKYDFLIIEDDPYYFLQFNKFRPTFLSMDVDGRVIRADSFSIISSGLRI
3d6kB           VFGNPTGVTFSEQTCRELAETAAPDFRIVWDNAYALHTLSDEFQAAGNPNRFWFSSTSKITHAGSGVSFF
3dwkA           ----------------------------------------------------------------------
1ecxB           ANNEVGTIQPVEDV---TRIVKKKNKETLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITY
2dr1A           NETSTGVLNPLPELAKV---AKEHDKLVFVDAVSAMG--GADIKFDKWGLDVVFSSSQKAFGVPPGLAIG
2egyC           SFQNPTGGLTPLPARKRLQMVMERGLVVVEDDAYRELYLFELAREAGYPGVIYLGSFSKVLSPGLRVAFA
2bieA           NDAYLHITSNNTIYGTQYQNPEINHAPLIADMSSDILSRPLVNQFGMIYAGAQKNLGPSGVTVVIVKKDL
1bw0A           NPSNPCGSNFSRKHVEDIVRAEELRLPLFSDEIYAGMVFKGKDDFETTVPRVILGGTANLVVPGWRLGWL
1eg5B           ANNEVGTIQPVEDVTRIVKK---KNKETLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITY
2bhxB           NDAYLHITSNNTIYGTQYQNPEINHAPLIADMSSDILSRPLKVNQGMIYAGAQKNLGPSGVTVVIVKKDL
2bieB           NDAYLHITSNNTIYGTQYQNPEINHAPLIADMSSDLSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDL
2aevA           TGSTMDLKVIELENFKKVINAKNKEAIVFVDDASGARVRLLFNQPPALKLGADLVVTSTDLMEGPRGGLL
2c0rA           NAAYLHLTSNETIEGAQFKAPDTGSVPLIGDMSSDILSRPFLNQFGLVYAGAQKNLGPSGVTVVIVREDL
2bwoA           VYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGAGVADGLMHRIDIFNGTLAAYGVFGGY
3bcxB           TLGNLF-------DLAEVRRADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAV
1eg5A           ANNEVGTIQPVEDVTRI---VKKKNKETLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITY
3ecdD           GFSAYPRKLDFARFRAI---ADSVGAKLMVDMAHIAGVIAAGRANPVEHAHVVTSTTHKTLRGPRGGFVL
1bw0B           NPSNPCGSNFSRKHVEDIVRAEELRLPLFSDEIYAGMVFKGKADFETTVPRVILGGTANLVVPGWRLGWL
1dfoA           GFSAYSGVVDWAKMREI---ADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLI
3bcxA           KAIMIAHTLGNLFDLAEVRRADKYNLWLIEDCCDALGSTYDGKAGTFGDIGTVSFYPAHHITMGEGGAVF
3cq5B           FVTTPNNPTGDVTSLDDVERINVAPGIVIVDEAYAEFSPSPSATLLEKYPTKLVVSRTMSKAFDFAGGRL
3cq5A           FVTTPNNPTGDVTSLDDVERINVAPGIVIVDEAYAEFSPSPSATLLEKYPTKLVVSRTMSKAFDFAGGRL
2ch1A           GDSSSGLLQPLEGVGQICH---QHDCLLIVDAVASLCGVPLGAPPGITPISPKALDVIRNRRTKSKVFYW
1c0nA           VSNVLGTENPLAEM---ITLAHQHGAKVLVDGAQAVMHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKE
1ecxA           ANNEVGTIQPVEDVTRI---VKKKNKETLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITY
1c4kA           LGTYDGTIYNAHEVVKR---IGHLCDYIEFDSAWVGYEQFIP----------------------------
2a7vA           GTSAYARLIDYARMREV---CDEVKAHLLADMAHISGLVAAKVIP---SPFKHADIVTTTTHKTLRGARS
2cdmA           QWRALKNDEIVKATRYL---GAVYNAELAHELQKLGYQLRYGKDFDLAHIDRQ-----------QIEGFS
2dkjA           VIVAGASAYPRFWDFKAFREADEVGAYLVVDMAHFAGLVAAGLPNPLPYAHVVTSTTHKTLRGPRGGLIL
3ecdB           GFSAYPRKLDFARFRAI---ADSVGAKLMVDMAHIAGVIAAGRANPVEHAHVVTSTTHKTLRGPRGGFVL
1bs0A           VFSMDGDSAP----LAEIQQTQQHNGWLMVDDAHGTGVIGGRGSCWLQKVKPELLVVTFGKGFGVSGAAV
1b9hA           KVIMPVHMAGLMADMDALAKSADTGVPLLQDAAHAHGARWQGKRVGELSIATFSFQNGKLMTAGEGGAVV
3c3jC           SDIVAAILPPSRHFIDVEQACFLYAQTFALQSLHGNT---------------------------------
3e77A           NETV---------HGVEFDFPDVKGAVLVCDMSSNFLSKPDVSKFGVIFAGAQKNVGSAGVTVVIVRDDL
2ch2A           GDSSSGLLQPLEGVGQI---CHQHDCLLIVDAVASLCGVPFYMD---KWEIDAVYTGAQVLGAPPGITPI
1djeA           VFSMDGDSAP----LAEIQQTQQHNGWLMVDDAHGTGVIGGRGSCWLQKVKPELLVVTFGKGFGVSGAAV
3ca8A           ----------------------------------------------------------------------
3e77C           NET------VHGVEFDFI--PDVKGAVLVCDMSSNFLSKVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDL
1b9iA           KVIMPVHMAGLMADMDALAKSADTGVPLLQDAAHAHGARWQGKVGELDSIATFSFQNGKLMTAGEGGAVV
3e77B           NETV--------HGVEFDFIPDVKGAVLVCDMSSNFLSKPVD-----VSKFGVIFAGAQKNVGSAGVTVV
3bb8A           TLGN----LFDLAEVRRV--ADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAKHITMGEGGAV
2e7jA           LITYPDGNYGNLPDVKKIAKCSEYDVPLLVNGAYAIG--RMPVSLKEIGADFIVGSGHKSMAASGPIGVM
2bwpB           SVYSMDGDFGPIKEICDI--AEEFGALTYIDEVAVGMYGPRGGVAERDGLMHDIFNGTLAKAYGVFGGYI
1cj0A           T-SCYSRNLDYGRLRKI---ADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMI
3blvH           ----------------------------------------------------------------------
3dr4B           LYG------QICDMDPILEVARRHNLLVIEDAAEAVGATYRGKSGSLGDCATFSFFGNAIITTGEGGMIT
3b8xB           KAILTVNLLGNPNNFDEINKIGGRDIILLEDNCESMGATFNN----------------------------
3bn1D           LYGQICDMDPILEV------ARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNIITTGEGGMIT
3dr4D           KAIMPVHLYGQICDMDPILEARRHNLLVIEDAAEAVGATYRGKSGSLGDCATFSFFGNAIITTGEGGMIT
3bn1C           LYGQICDMDPILEV------ARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNIITTGEGGMIT
1cj0B           TSCY-----SRNLDYGRLRKADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMI
2aeuA           TMDLK---VIELENFKKVINAKNKEAIVFVDDASGARVRLLFNQPPALKLGADLVVTSTDKLMEGPRGGL
3b8xA           KAILTVNLLGNPNNFDEINKIGGRDIILLEDNCESMG---------------------------------
2c81A           KAIIPVHLFGSMANMDEINEAQEHNLFVIEDCAQSHGSVWNNQAGTIGDIGAFSCQQGKVLTAGEGGIIV
3dr4A           KAIMPVHLYGQICDMDPILEARRHNLLVIEDAAEAVGATYRGKSGSLGDCATFSFFGNAIITTGEGGMIT
3dr7B           LYGQICDMDPILEV------ARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNIITTGEGGMIT
3d1rA           LYGIGGAPEGVVSAAVIRALGDMNGRLLARHDVKGDNENRRIGRCKAMGIEAGKVLRLGDMARSDNVIFS
3caiA           ASGTLGGVTDLRAMTKLVHDVG---ALVVVDHSAAAP--YRLLDIRETDADVVTVNAHAWGGPPIGAMVF
2c7tA           KAIIPVHLFGSMANMDEINEAQEHNLFVIEDCAQSHGSVWNNQAGTIGDIGAFSCQQGKVLTAGEGGIIV
3blxD           ----------------------------------------------------------------------
2douA           PNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYAPSPLALPGAKERVVELFSLSKSYNLAGFRL
3blvD           ----------------------------------------------------------------------
3dr4C           LYGQIC-------DMDPILEARRHNLLVIEDAAAVGATYRGKKSGSLGDCATFSFFGNAIITTGEGGMIT
1dkrA           DHGG---VTRARKLADRL----------------------------------------------------
2dqxA           IFHGRTAIEIYSDYMKSFREMSDFLESGLIIDIEVGL---------------------------------
2bkwA           VDTSTAVLSDLKAISQAIKQ-TSPETFFVVDAVCSIGCEEFPAGLSISLCSSRFDYALNDSKNGHVHGYF
2douB           PNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQ--VYEGEAPSPLALPGAKERVVELFSLSKSYNL
3bwnB           ----------------------------------------------------------------------
2a8iB           DGVLGGVIVLRSCRCSAEPDLLVEFLWSHTTESCVGYAQDGKAKTHISRLPPG-----------------
3bn1A           LYGQIC-------DMDPILEARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNIITTGEGGMIT


                         .         *         .         .         .         .         +:350
query           XXRREIMEKVAPLGPVYQAGTLSGNPXXXXXXXXXXXXXXXNPGYYRYLEDLGARLERGLKEVLAQKGIP
2e7uA           AGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEVLKEKGLP
3du4A           TFATEFYDDYENLKTFFHGHSYTGNQ-LGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVG
3dodB           TFATEFYDDYENLKTFFHGHSYTGNQ-LGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVG
3dodA           TFATEFYDDYENLKTFFHGHSYTGNQ-LGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVG
3drdB           TFATEFYDDYENLKTFFHGHSYTGNQ-LGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVG
3bs8A           GGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQLTPD--SYKNFIKKGDRLEEGISKAAEAHGIP
2cinA           RVDEVAD--NVFAVPSRLNSTWGGNL-TDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAV
2bylA           LCDDDIMLTIK---PGEHFSTYGGNP-LGCRVAIAALEVLEEENLAENADKLGIILRNELMK--LPSDVV
3clzB           ----------------------------------------------------------------------
3clzD           ----------------------------------------------------------------------
3bv0A           TLCTADVAH-----TISAGPTFMANP-LACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVT
2byjA           LCDDDIMLT---IKPGEHGSTYGGNP-LGCRVAIAALEVLEEENLAENADKLGIILRNELMK--LPSDVV
1dtyA           LTTREVAETISDGEAFMHGPTFMGNP-LACAAANASLAILESGDWQQQVADIEVQLREQLAP-ARDAEMV
3clzA           ----------------------------------------------------------------------
2cfbA           GGRAEIMKMVAPAGPTLSGNPLAM------TAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHE
1d7uA           VTSAAIEERAHELGYLFY-TTHVSDP-LPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCI
3drdA           FATEDIYKAFYDDKTFFHGHSYTGNQLGCAVALENLALFES-ENIVEQVAEKSKKLHFLLQDLHALPHVG
1dgdA           VTSAAIEERAHELGYLFY-TTHVSDP-LPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCI
3dxvB           IAPAEILDCASA-----FAMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLI
1asfA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
2dgmC           IWRDEEALPQEQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFIC
2d5yA           TLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR--MRQLFV
1ajrA           TVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSE--LR
1b8gA           SLSKDLGLPGFRVGATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGIS
2eh6A           LAREEVAQS---FTPGSHGSTFGGNPLACRAGTVVVDEV---EKLLPHVREVGNYFKEKLKELGKGK---
2dgmA           IWRDEEALPQELIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFIC
3aatA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
2cy8A           GGREDVMGV-------LSRGSFTGNPITAAAAIAAIDTILED-DVCAKINDLGQFAREAMNHLFARKGLN
3dxvA           IAPAEILDCASAFAMQTLHG-----NPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLI
1arsA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR--MRQLFV
2dgmE           IWRDEEALPGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFIC
2d64A           TLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
2e54A           IVNERANVL----EPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKK-LQEMKEEYDVV
1czcA           TLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQL--FV
2aatA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
1arhA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNT
2d66A           TLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR--MRQLFV
1aamA           TLVAADSETVDRAFSQMKAAIDANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNT
1b8gB           SLSKDLGLPGFRVGTKMSSFGLVSSQ-TQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGIS
1bqdA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNT
1c7gA           LCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEHRVKQVRYLGDKLREAGVPIVEP
7aatA           YGICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQ--LV
1btcA           ----------------------------------------------------------------------
3dc1D           GFLTGPKPLIERVILHIQVSTLHPST-FNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAADKWL
1bybA           ----------------------------------------------------------------------
2dgmB           IWRDEEALPQQIGTFAINFSRPAGQVIAQYYEFLRLGREGY-TKVQNASYQVAAYLADEIAKLGPYEFIC
1aiaA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR--MRQLFV
1ajsA           TVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRAR
1aheA           TLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR--MRQLFV
3ei9B           VIPKKLLYSDGFPNRIICTCFNGASNISQAGALACLTPEGLE--AMHKVIGFYKENTNIIIDTFTSLGYD
1bqaA           NERAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNT
1c7nA           AGMGMSNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEI
1ariA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
1akaA           YGICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQ--LV
1ay5B           LALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQ--LA
3e2fA           IGPAHLIKHLQTVNSFYTCATPLQAA-LAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLL-NSVGL
1b4xA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
3bc8A           AIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNER
1cliB           VSDGDVLIALGSSGPHSNGYSLVRKILEVSGCDPQTTELDGKP-LADHLLAPTRIYVKSVLELIEKVDVH
3cq6A           GYNPAFIDAVMLVRL-----PYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEEL----GYA
1d2fB           TGAYGIIENSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPE
3d6kA           ASSKENIEWY---ASHANVRGIGPNKLNQLAHAQFFGDVAGLKAHLKHAASLAPKFERVLESRLSEYGVA
3bcaA           GFNEPFIQDISK----MYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNER
2c44A           CMKDDSFFDVYTEVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQA
3dzzB           IIPNPDLRARA---EESFFLAGIGEP-NLLAIPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPE
3ei7A           VIPKKLLYSDGFPNRIICTCFNGASNISQAGALACLTPEGL-EAMHKVIGFYKENTNI-IIDTFTSLGYD
3dc1A           GFLTGPKPLIERVILHIQVSTLHPST-FNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAADKWL
1bkgA           GYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
2egyB           VAHPEALQK---LVQAKQGADLHTPMLNQMLVHELLKEGFSER-LERVRRVYREKAQAMLHALDREVPKE
3dydA           LIHDRRDIFGNEIGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGA-LAAIPGL
1ax4A           DNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYP
3bv0B           AATLCTADVAHTISAGPTFMANPLAC----AVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVT
2bwnB           IAASARMVDAVRSYAPGFIFSTSLPP-AIAAGAQASIAFLKTAEGQKLRDAQQMHAKV-LKMRL-KALGM
2cstA           LSVVKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSR
1ay4B           LALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQ--LA
3ei6A           RLPKKLLYSDGDFNRIICTCFNGASNISQAGALACLTPEGLE-AMHKVIGFYKENTNIIIDT-FTSLGYD
3bcbA           AINEPFIQDISKM----YPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNER
3d6kD           ASSKENIEWYA---SHANVRGIGPNKLNQLAHAQFFGDVAGLKAHLKHAASLAPKFERILDSRLSEYGVA
1bjwA           CGPKEVIKA---MASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
2c44B           MKDDSFFDVYTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQA
3ei8A           VIPKKLLYSDGFPNRIICTCFNGASNISQAGALACLTPEGL-EAMHKVIGFYKENTNIIIDT-FTSLGYD
3ei7B           VIPKKLLYSDGFPNRIICTCFNGASNISQAGALACLTPEGL-EAMHKVIGFYKENTNIIIDT-FTSLGYD
1asbA           TLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
3dydB           LIHDRRDIFGNEIGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCY-GALAAIPGL
2d61A           TLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQL--FV
3e9kA           STRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQAKALRKKSVLLTGYLEYLIKHNYGVVNII
2dgkC           IWRDEEALPGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFIC
1djuA           GWRVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLP
3ecdC           TNDEEIAKK-----INSAVGPLMHVI-AGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKA---GGVDL
2bwpA           YIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRL--KALGM
3ecdA           TNDEEIA----KKINSAVFGPLMHVIAGKAVAFGEALTDDF-KTYIDRVLANAQALGDVLKAGGVDLVTG
1b5oA           GYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
2bwnD           IAASARMVDAVRSYAPGF-IFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKM--RLKALGM
2bwoD           YIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKV-LKMRLKALGMP
3e2yA           GWKLGWSHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMLNSVGL
3eiaB           VRPKKLLYSDGFPNRIICTCFNGASNISQAGALACLTPEGLE--AMHKVIGFYKENTNIIIDTFTSLGYD
2egyD           PGLRAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSER-LERVRRVYREKAQAMLHALDREVPKE
2c44C           CMKDDSFFDVYTECRQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQA
3dzzA           ALHAACAPDLRARAEESFFLAGIGEPNLLAIPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEV
3d6kC           ASSKENIEWYA---SHANVRGIGPNKLNQLAHAQFFGDVAGLKAHLKHAASLAPKFERVLDSRLSEYGVA
1b5pA           GYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
3ei6B           VIPKKLLYSDGFPNRIICTCFNGASNISQAGALACLTPEGL-EAMHKVIGFYKENTNI-IIDTFTSLGYD
3b46B           SLNAELLSY---AAKAHTRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFT-SIFDELGLP
3b46A           SLNAELLSYAAK----AHTRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDELGLP
3eiaA           VIPKKLLYSDGFPVAKDICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDT-FTSLGYD
1dfoB           LAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKA-MVEVFLERGYK
1ay4A           RERCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQ--LA
5bj3A           GYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
2bwoB           YIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRL--KALGM
1bj4A           EILYNLESLIN---SAVFPGLQGGPH-NHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYK
1djuB           VAAPSWIIERM--VKFQMYNATCPVT-FIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLP
3ei9A           VIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFNTNIIIDTFTSLGYD
2dr1B           AFSERFLEIAEKMPERGWSTPSTPPMPQVFGINVALRIIEK-MGGKEKWLEMYEKRAKMVREGVREIGLD
3ca8B           ----------------------------------------------------------------------
1bjoA           LGKANIACPSIYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFY
2bhgA           LAKDGADTFI----VGTHSAGGNGVG--------------------------------------------
3cbfA           PGLRVAFEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSER-LERVRRVYREKAQAMLHALDREVPKE
1agxA           ----------------------------------------------------------------------
1bjnA           GKANIACPSILDYSILNDNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDV
1d2fA           TGAYGINSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPE
5bj4A           GYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
3cq4B           GYFVANPAFIDA--VMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEEL----GYA
2dgkA           IWRDEEALPQEQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFIC
1ejiA           TGKETYYELESLINSAVFPGLQGGPH-NHAIAGVAVALKQATTEFKIYQLQVLANC-RALSDALTELGYK
3cq4A           FVANPAFIDAVM----LVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPS
2bwnA           GYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALG-M
2bwnE           GYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMP
3dc1B           GFLTGPKPLIERVILHIQVSTLHPST-FNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKW
3d6kB           ASSKENIEWYA---SHANVRGIGPNKLNQLAHAQFFGDVAGLKAHLKHAASLAPKFERVLESRLSEYGVA
3dwkA           ----------------------------------------------------------------------
1ecxB           IRKGVPIRPLIHGGRGLRSGTQNVPGIVGAARAMEIAVEEL-SEAAKHMEKLRSKLVSGLMNLGAHIITP
2dr1A           AFSERFLEIAEKMPKEKESTPSTPPM-PQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLD
2egyC           VAHPEALQKL---VQAKQGADLHTPMLNQMLVHELLKEGFSER-LERVRRVYREKAQAMLHALDREVPKE
2bieA           LNTKVEQVPTMLATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF
1bw0A           LYVDPHGNGPSFLGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMY-LYNHIGECIGL
1eg5B           IRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPL
2bhxB           LVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAK-QNEEKAKIIYDTIDESNGF
2bieB           LVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAK-QNEEKAKIIYDTIDESNGF
2aevA           AGKKELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLERIRKAFERAKNFDLSKIEK-LNKELKAIDDN
2c0rA           VAESPKHMLRYDTYVKNNSLYNTPPSFGIYMVNEVLKWIEERGGLEGVQQ-ANRKKASLIYDAIDQSGGF
2bwoA           IAASARMVDA--VRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMP
3bcxB           FTQSAELKSIIESFRDWGRDCLGSLPFGYDHKYTYSHLGYNLEEFVEKRKANFKYLKDALQSCADFIELP
1eg5A           IRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPL
3ecdD           TNDEEIAKKINSAVGPLMHVIAG------KAVAFGEALTDDFKTYIDRVLANAQALGDVLKA---GGVDL
1bw0B           LYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGL
1dfoA           LAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKV
3bcxA           TQSAELKSIIESFRDWGRDCYCLGSLPFGYDHKYTYSHLGYNEEFVEKRKANFKYLKDALQSCADFIELP
3cq5B           GYFVANPAFIDAVMLVRL--PYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPS
3cq5A           GYFVANPAFIDAVMLV--RLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPS
2ch1A           DLLLLGNYWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVK
1c0nA           ALLQELSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSAL--GLNNIAEYEQNLMHYALSQLESVPDL
1ecxA           IRKGVPIRPLIHGGGQERGLRSGTQNGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMN-LGAHIIT
1c4kA           ----------------------------------------------------------------------
2a7vA           GLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNPMFREYSLQVLKNARAMADALLERGYSL
2cdmA           KRTEQIAEWYAARGLDPNSVS-LEQK-------QAAKVLSRAKKTSVDREALRAEWQATAKE--------
2dkjA           SNDPELGKRIDKL---IFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRI
3ecdB           TNDEEIAKKINSA---VFPGPLMHVIAGKAVAFGEALTDDF-KTYIDRVLANAQALGDVLKA---GGVDL
1bs0A           LCSSTVADYLLQFARHLIYST-SMPPAQAQALRASLAVIRSDEGDARRLAALITRFRAGVQDLPFTLADS
1b9hA           FPDGETEKYERDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQG
3c3jC           ----------------------------------------------------------------------
3e77A           LGFALRECPSVYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGF
2ch2A           SISPKALDVIRNREPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVK
1djeA           LCSSTVADYLLQFARHLIYST-SMPPAQAQALRASLAVIRSDEGDARRLAALITRFRAGVQDL-------
3ca8A           ----------------------------------------------------------------------
3e77C           LGFALRESVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGF
1b9iA           FPDGETEKYETAFRHSCGRPRDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIRDERWTLLSRLLGA
3e77B           IVRDDLLGFALRECPSVLEYLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGF
3bb8A           FTQSAELKSII---ESFRDWGRDCQLITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELP
2e7jA           GMKEEWAEIVLRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIK
2bwpB           AASARMVDAVRSYAPGFIFST-SLPPAIAAGAQASIAFLKTAEG--QKLRDAQQMHAKVLKMRLKALGMP
1cj0A           FYRRGVRSVDILINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQV-VANCRALSAALVELGYK
3blvH           ----------------------------------------------------------------------
3dr4B           TNDDDLAAKMRLLRGYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKP
3b8xB           ----------------------------------------------------------------------
3bn1D           TNDDDLAGMDPNRRYWFPIVGFNYRM-TNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKP
3dr4D           TNDDDLAAKMRLLRGYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKP
3bn1C           TNDDDLAAKMRLLRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKP
1cj0B           FYRRGVRSVDKEILYNLEPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQV-VANCRALSAALVELGYK
2aeuA           LAKKELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLERIRKAAKNFDLSKIEKLNKELKAIDDNINIV
3b8xA           ----------------------------------------------------------------------
2c81A           TKNPRLFELIQQLRADSRVYCDDSSELMHGDMQLVKKGDIQGSNYCLSEFQILLDQLQELDDKNAIDGIK
3dr4A           TNDDDLAAKMRLLRGYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKP
3dr7B           TNDDDLAQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKP
3d1rA           ATGITKGDL---LEGISRKGNIATTE--------------------------------------------
3caiA           R----DPSVMNSFGSVSTNPYATGPAQFGLLAGVVASIEYLAALDESARGSRRERLAVSMQSADLNRVFD
2c7tA           TKNPRLFELI----QQLRADSRVYCD--------------------------------------------
3blxD           ----------------------------------------------------------------------
2douA           GFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKT------PKEVVRGYARVYRERALGMAEAKGVL
3blvD           ----------------------------------------------------------------------
3dr4C           TNDDDLAAKMRLLNRRYWFPIVGFNYRMTNIQAAIGLAQLERDEHLAARERVVGWYEQKLARLGNRVTKP
1dkrA           ----------------------------------------------------------------------
2dqxA           ----------------------------------------------------------------------
2bkwA           SSLRRWTPIENYEAGKAYFATPPVQLINSLDVALKEILEEGLHKRWDLHRESDWFKDSLVNGLQLTSVSR
2douB           AGFRGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVRGYARVYRERALGMAEALKG------VL
3bwnB           --------------------------------------------FFKYGREMMKNRWEKLREVVKESDAF
2a8iB           ----------------------------------------------------------------------
3bn1A           TNDDDLAAKMRLLNRRYWFPIVGFNYRMTNIQAAIGLAQLERDEHLAARERVVGWYEQKLARRVTKPHVA


                         .         .         .         .         *         .         .:420
query           HAVNRVGSMVTVFFTEGPVVTFQDAKRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHTEEDVEKTL
2e7uA           HTVNRVGSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHREEDVEKTL
3du4A           D-IRQLGFMCGAELVRSK--ETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFLPLASTAEELSEMV
3dodB           D-IRQLGFMCGAELVRSK--ETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFLPLASTAEELSEMV
3dodA           D-IRQLGFMCGAELVRSK--ETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFLPLASTAEELSEMV
3drdB           D-IRQLGFMCGAELVRSK--ETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFLPLASTAEELSEMV
3bs8A           HTFNRAGSMIGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTI
2cinA           VLDPRGRGLMCAFSL------------PTTADRDELIRQLWQRAVIVLPAGADTVRFRPTVSTAEIDAAI
2bylA           TAVRGKGLLNAIVIKETKDWDAWKVCL------RLRDNGLLAKPTHGDIIRFAPPL---VIKEDELRESI
3clzB           ----------------------------------------------------------------------
3clzD           ----------------------------------------------------------------------
3bv0A           D-VRVCGAIGVIEC-------------DRPVDLAVATPAALDRGVWLRPFRNLVYAMPYICTPAEITQIT
2byjA           TAVRGKGLLNAIVIKE-----------TKDWDAWKVCLRLRDNGLLAKPTHGDIIRFPLVIKEDELRESI
1dtyA           ADVRVLGAIGVVETTHP-------------VNMAALQKFFVEQGVWIRPFGKLIYLPPYIILPQQLQRLT
3clzA           ----------------------------------------------------------------------
2cfbA           VCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTI
1d7uA           GDVRGRGLLLGVEIVKD-RRTKEPADGLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPTVSEDEIDLGL
3drdA           DIRQLGFMCGAELVRSK---ETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFPPLASTAEELSEMV
1dgdA           GDVRGRGLLLGVEIVKDRRTKEPADGLGA-KITRECMNLGLSMNIVQLPGMGGVFRIAPTVSEDEIDLGL
3dxvB           GDIRGRGLACGMELVC-----DRQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVPPLTITETDIHKAL
1asfA           NTLQEKGANRDFSFIIKQNGMFSFSGLTK----EQVLRLREEFGVYAVAS---GRVNVAGMTPDNMAPLC
2dgmC           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATIVVMRIMCRRGFEMDFAELLL
2d5yA           NTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRL----REEFGVYAVASGR---LNVAGMTPDNLAPLC
1ajrA           ARLEALKTPGTWNH----ITDQIGMFSFTGLNPKQVEYLINQKHIYLLPSGR---INMCGLTTKNLDYVA
1b8gA           CLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFALPERTLDLAM
2eh6A           --VKGRGLMLGL-----------ELERECKDYVLK----ALEKGLLINCTAGKVLRFLPIIQKEHIDRAI
2dgmA           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLR--GWQVPAFTLGGEATDIVVMCRRGFEMDFAELLL
3aatA           NTLQEKGANRDFSFIIKQNGMFSFSGLTK----EQVLRLREEFGVYAVASGF---VNVAGMTPDNMAPLC
2cy8A           WLAYGRFSGFHLMPGLPPNTTDTGSITRAEVARPDMRMALILEGVDIGGRGS--VFLSAQHEREHVEHLV
3dxvA           GDIRGRGLACGMELVC-----DRQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLPLTITETDIHKAL
1arsA           NTLQEKGANRDFSFIIKQNGMFSFSGLTK----EQVLRLREEFGVYAVAS---GRVNVAGMTPDNMAPLC
2dgmE           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATIVVMRIMCRRGFEMDFAELLL
2d64A           NTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRL----REEFGVYAVASGR---LNVAGMTPDNLAPLC
2e54A           ADVRGMGLMIGIQFREE-------------VSNREVATKCFENKLLVVPAGNNTIRFLPTVEYGEIDLAV
1czcA           NTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRL----REEFGVYAVASGR---LNVAGMTPDNLAPLC
2aatA           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVASGR---VNVAGMTPDNMAPLC
1arhA           LQEKGANRDFSFIIKQNGMFSFSGLTK------EQVLRLREEFGVYAVASG---AVNVAGMTPDNMAPLC
2d66A           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVASGR---VNVAGMTPDNMAPLC
1aamA           LQEKGANRDFSFIIKQNGMFSFSGLTK------EQVLRLREEFGVYAVASG---RVNVAGMTPDNMAPLC
1b8gB           CLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFALPERTLDLAM
1bqdA           LQEKGANRDFSFIIKQNGMFSFSGLTK------EQVLRLREEFGVYAVAS---GRVNVAGMTPDNMAPLC
1c7gA           TGGHAVFLDARRFCPHLTQDQFPAQSLAASIYVSAGRSKETGENHRPKLETVRLTIPRRVYTYAHMDVVA
7aatA           SNLKKEGSSHNWQHITDQIGMFCFTGLK----PEQVERLTKEFSIYMTKDGR---ISVAGVASSNVGYLA
1btcA           ----------------------------------------------------------------------
3dc1D           TGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASASPEQMDVAF
1bybA           ----------------------------------------------------------------------
2dgmB           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATIVVMRIMCRRGFEMDFAELLL
1aiaA           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVASG---RVNVAGMTPDNMAPLC
1ajsA           LEALKTPGTWNHITDQIGMFSFTGLNP------KQVEYLINQKHIYGRINMCGLTTKNLDYVATSIHEAV
1aheA           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVASGR---VNVAGMTPDNMAPLC
3ei9B           VYGGKNAPYVWVHFPNQS-------------SWDVFAEILEKTHVVTTPSGFGPGRVSAFGHRENILEAC
1bqaA           LQEKGANRDFSFIIKQNGMFSFSGLTK------EQVLRLREEFGVYAVASGR---VNVAGMTPDNMAPLC
1c7nA           KAPLIEGTYLQWID----FRALKMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESL
1ariA           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVAS---GRVNVAGMTPDNMAPLC
1akaA           SNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERL----TKEFSIYMTKDGR---ISVAGVASSNVGYLA
1ay5B           GELRDLSGSDRFGF-----VAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDS--RINIAGLNDNTIPILA
3e2fA           KPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSFCFIKKDSTLDAAE
1b4xA           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVAS---GRVNVAGMTPDNMAPLC
3bc8A           LQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFAAIGMKMQDVDLFI
1cliB           AIAHLTGGGFWENIPRNTQAVIDESSWQWPEVFNWLQTAGNVEHHEMYRTFNCGVGMIIALPAPEVDKAL
3cq6A           VVPSESNFVFFGDFSDQ----------------HAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFL
1d2fB           LNWQIPQSTYLAWL---DLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGV
3d6kA           KWTSPTGGYFISVDVVPGT----ASRVVELAKEAGIALTGAGSSFPLHNDPNNENILAPSLPPVAELEVA
3bcaA           LLQTPHNPISLAMTLKTIDGHHDKAVTGNVQTVSGHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFI
2c44A           GGHAAFVDAGKLLPHIPADPAQALACEVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHMDFII
3dzzB           VKVLDSNASYLAWV----DISALGNAEDFCKYLREKTGLIISAGNGYRGNGHEFVRINLACPKELVIDGQ
3ei7A           VYGGKNAPYVWVHFPNQ-------------SSWDVFAEILEKTHVVTPGSGFGPGRVSAFGHRENILEAC
3dc1A           TGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASASPEQMDVAF
1bkgA           AVRPSGAFYVLMDTSP------------IAPDEVRAAERLLEAGVAVVPGTDFAARLSYATSEENLRKAL
2egyB           VRYTRPKGGMFVWMELPKGLSAE-----------GLFRRALEENVAVPGGPFFANGLSYALDREGIAEGV
3dydA           RPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNF--IRVVITVPEVMMLEAC
1ax4A           TGGHAVFVDCKKLVPQIPGDQFPAQAVINALYFLLGRDPATGEQKHADMEFMRLTIARRVYTNDHMDYIA
3bv0B           D-VRVCGAIGVIEC-------------DRPVDLAVATPAALDRGVWRPFRNLVYAMPPYICTPAEITQIT
2bwnB           PIIDHGSHIVPVVIGDPVH----TKAVSDMLL--SDYGVYVQPINFPTVPRGTERLPSPVHDLKQIDGLV
2cstA           LESLGTPGTWNHITDQIGMFSFTGLNP------KQVEYMIKEKHIYLMASGR---INMCGLTTKNLDYVA
1ay4B           GELRDLSGSDRFGF-----VAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDS--RINIAGLNDNTIPILA
3ei6A           VYGGKNAPYVWVHFPNQS----------SWDVFAEI---LEKTHVVTTPSGFEGFVVSAFGHRENILEAC
3bcbA           LLQTPHNPISLAMTLKTIDGHHDKAVTGNVQTVSGHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFI
3d6kD           KWTSPTGGYFISVDVVP----GTASRVVELAKEAGIALTGAGSSFPLHNDPNNENILAPSLPPVAELEVA
1bjwA           AVRPSGAFYVLMDTSPIAPDE------------VRAAERLLEAGVAVVPGTDFAARLSYATSEENLRKAL
2c44B           GGHAAFVDAGKLLPHIPADQFPAQALAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHMDFII
3ei8A           VYGGKNAPYVWVHFPNQS-------------SWDVFAEILEKTHVVTTPGSGEGFVVSAFGHRENILEAC
3ei7B           VYGGKNAPYVWVHFPNQS-------------SWDVFAEILEKTHVVTTPSGFEGFVVSAFGHRENILEAC
1asbA           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVASG---RVNVAGMTPDNMAPLC
3dydB           RPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNF--IRVVITVPEVMMLEAC
2d61A           NTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRL----REEFGVYAVASG---RVNVAGMTPDNMAPLC
3e9kA           TPSHVEERGCQLTITFS-------------VPNKDVFQELEKRGVVCDKNGIRVAPVPLYNSFHDVYKFT
2dgkC           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDVVMRIMCRRGFEMDFAELLL
1djuA           TVKPKGAFYIFPRIRDTGLTSKKFSEL-----MLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAM
3ecdC           VTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEF
2bwpA           PIIDHGSHIVPVVIGDPVH---------TKAVSDML---LSDYGVYVQPINFPTVTPSPVHDLKQIDGLV
3ecdA           GTDNHLLLVDLRPKGLKGAQVEQALERAGITCKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVG
1b5oA           AVRPSGAFYVLMDTSP------------IAPDEVRAAERLLEAGVAVVPGTDFAARLSYATSEENLRKAL
2bwnD           PIIDHGSHIVPVVIGDPVH------------TKAVSDMLLSDYGVYVQPINFPTFTPSPVHDLKQIDGLV
2bwoD           I-IDHGSHIVPVVIGDPVHTK------------AVSDMLLSDYGVYVQPINFPTVTPSPVHDLKQIDGLV
3e2yA           KPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSFCFIKKDSTLDAAE
3eiaB           VYGGKNAPYVWVHFPNQSSW-------------DVFAEILEKTHVVTPGSGFEGFVVSAFGHRENILEAC
2egyD           VRYTRPKGGMFVWMELPKGLS-----------AEGLFRRALEENVAVPGGPFFANLSYATLDREGIAEGV
2c44C           GGHAAFVDAGKLLPHIPADPAQALACEVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHMDFII
3dzzA           KVLDSNASYLAWVDISALGNAEDFCKY-----LREKTGLIISAGNGYRGNGHEFVRINLACPKELVIDGQ
3d6kC           KWTSPTGGYFISVDVVP----GTASRVVELAKEAGIALTGAGSSFPLHNDPNNENILAPSLPPVAELEVA
1b5pA           AVRPSGAFYVLMDTSP------------IAPDEVRAAERLLEAGVAVVPGTDFAARLSYATSEENLRKAL
3ei6B           VYGGKNAPYVWVHFPNQS-------------SWDVFAEILEKTHVVTTPGSGEGFVVSAFGHRENILEAC
3b46B           YTAPEGTYFVLVDFSKVKIPEYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKFAVCKDDAYLENAV
3b46A           YTAPEGTYFVLVDFSKVKIYPYPEEILNKGKDFRISHWLINELGVVIPPTEFYIKEFAVCKDDAYLENAV
3eiaA           VYGGKNAPYVWVHFPNQSSW-------------DVFAEILEKTHVVTPGSGFGPGRVSAFGHRENILEAC
1dfoB           VVSGGTDNHLFLVDLVDKNLTGKEADAGRANITVNKNSVPNDPKSPFVTSGIRVGT-PAITRRGFKEAEA
1ay4A           GELRDLSGSDRFGF-----VAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINI--AGLNDNTIPILA
5bj3A           AVRPSGAFYVLMDTSPIAPDE------------VRAAERLLEAGVAVPGTDFAAFRLSYATSEENLRKAL
2bwoB           PIIDHGSHIVPVVIGD------------PVHTKAVSDMLLSDYGVYVQPINFPTFTPSPVHDLKQIDGLV
1bj4A           IVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDF
1djuB           TVKPKGAFYIFPRIRDTGLTSKKFSEL-----MLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAM
3ei9A           VYGGKNAPYVWVHFPNQS-------------SWDVFAEILEKTHVVTTPGSGEGFVVSAFGHRENILEAC
2dr1B           ILAEPGHESPTITAVLTP----------PGIKGDEVYEAMRKRGFELAKGYGSVKGHMGYMKFEDIQEML
3ca8B           ----------------------------------------------------------------------
1bjoA           RNDVAKRNRSRMNVP---------FQLADSALDKLFLEESFAAGLHALKGHRVVGGMYNAMPLEGVKALT
2bhgA           ----------------------------------------------------------------------
3cbfA           VRYTRPKGGMFVWMELPKGLS-----------AEGLFRRALEENVAVPGGPFFANGLSYALDREGIAEGV
1agxA           ----------------------------------------------------------------------
1bjnA           AKRNRSRMNVPFQLADS-------------ALDKLFLEESFAAGLHALKGHRVVGGMYNAMPLEGVKALT
1d2fA           LNWQIPQSTYLAWL---DLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGV
5bj4A           AVRPSGAFYVLMDTSPIAPDE------------VRAAERLLEAGVAVPGTDFAAFRLSYATSEENLRKAL
3cq4B           VVPSESNFVFFGD-------------------QHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFL
2dgkA           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATIVVMRIMCRRGFEMDFAELLL
1ejiA           IVTGGSDNHLILDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRLGT-PALTSRGLLEEDF
3cq4A           ESNF----VFFGDFSDQ----------------HAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFL
2bwnA           PIIDHGSHIVPVVIGDPVHTK------------AVSDMLLSDYGVYVQPINFPTFTPSPVHDLKQIDGLV
2bwnE           IIDHG-SHIVPVVIGDPVHTK------------AVSDMLLSDYGVYVQPINFPTVTPSPVHDLKQIDGLV
3dc1B           LTGLAEWHVPAAGMFLWIKVKGINDVKELEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASASPEQMDVAF
3d6kB           KWTSPTGGYFISVDVVPG-----TASRVVELAKEAGIALTGAGSSFPLHNDPNNENLAPSLPPVAELEVA
3dwkA           ----------------------------------------------------------------------
1ecxB           LEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTRHVLDAMGVDRRIAQGAIRISL-CKYNTEEEVDYFL
2dr1A           ILAEPGHESPTITAVLTP----------PGIKGDEVYEAMRKRGFELAKGYGSVKGHMGYMKFEDIQEML
2egyC           VRYTRPKGGMFVWMELPKGLS-----------AEGLFRRALEENVAVPGGPFFANGLSYALDREGIAEGV
2bieA           YVGHAEKGSRSLMNVTFNLRNEELN--------QQFLAKAKEQGFVGLNGHRSVGGCYNAVPIDACIALR
1bw0A           APTMPRGAMYLMSRIDLEKYRDIKTDV------EFFEKLLEEENVQVLPGTIFHARLTTTRPVEVYREAV
1eg5B           EISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTRHVLDAGVDRRIA--QGAIRISL-CKYNTEEEVDYFL
2bhxB           YVGHAEKGSRSLMNVTFNLRNEELN--------QQFLAKAKEQGFVGLNGHRSVGGCYNAVPIDACIALR
2bieB           YVGHAEKGSRSLMNVTFNLR--------NEELNQQFLAKAKEQGFVGLNGHRSVGGCYNAVPIDACIALR
2aevA           INIVYERTPTGFVIKRVYKDDTINIKKLFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYII
2c0rA           YRGCVDVDS--------RSDMNITFRLASEELEKEFVKASEQEGFVGLKGHRSVGGLYNAVPYESCEALV
2bwoA           IIDHG-SHIVPVVIGDPVHTK------------AVSDMLLSDYGVYVQPINFPTVTPSPVHDLKQIDGLV
3bcxB           EATENSDPSWFGFPI--TLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTD
1eg5A           EISLPNTLSVSFPNIRG---STLQNLLSGYGIYVSTHVLDAGVDRRIAQGAIRISL-CKYNTEEEVDYFL
3ecdD           VTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEF
1bw0B           APTMPRGAMYLMSRIDLEKYRDIKTDV------EFFEKLLEEENVQLPGTIFHAPRLTTTRPVEVYREAV
1dfoA           VSGGTDNHLFLVDLVDKNLTGKEADAALGRAITVNKNSVPNDPKSPFVTSGIRPAITRRGFKEAEAKELA
3bcxA           EATENSDPSWFGFPI--TLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTD
3cq5B           ESNF----VFFGDFSDQ----------------HAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFL
3cq5A           ESNF----VFFGDFSDQ----------------HAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFL
2ch1A           DPRHRLPTVTGIMIPKGV-----DWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYL
1c0nA           TLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLANTHEEVDRLV
1ecxA           PLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTHVLDAMGVDRRIAQGAIRISL-CKYNTEEEVDYFL
1c4kA           ----------------------------------------------------------------------
2a7vA           VSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGA-PALTSRQFREDDF
2cdmA           ----------------------------------------------------------------------
2dkjA           VTGGTDNHLFLVDLRPKGLTGKEAEERLDAVITVNKNAIPFDPKPPRVTSGIRIGT-PAITTRGFTPEEM
3ecdB           VTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEF
1bs0A           C-----SAIQPLIVG-------------DNSRALQLAEKLRQQGCWVTAIRPPTVTLTAAHEMQDIDRLL
1b9hA           GDVRADRNSHYMAMF--------RIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRTDADESVDAIARRC
3c3jC           ----------------------------------------------------------------------
3e77A           YVCPVEPQNRSKMN----IPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIYNAVTIEDVQKLA
2ch2A           DPRHRLPTVTGIMIPKG-----VDWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYL
1djeA           --------PFTLADSCSAIQPLIVG---DNSRALQLAEKLRQQGCWVTGIRPPTLTLTAAHEMQDIDRLL
3ca8A           ----------------------------------------------------------------------
3e77C           YVCPVEPQNRSKMNIPFRI----GNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIYNAVTIEDVQKLA
1b9iA           IDGVVPQGGDVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRTDPDESVDAIARRC
3e77B           YVCPVEPQNRSKMNIPFRI----GNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRAAVTIEDVQKLA
3bb8A           EATENSDPSWFGFPI--TLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTD
2e7jA           QLGDNPHNHDLMFFHAEVLYEISKK---AKGGRFFLYRELKSRKIHGIKPGLTRYFKLSGLSDEEVDYVL
2bwpB           IIDH-----------GSHIVPVVIG---DPVHTKAVSDMLLDYGVYVQPINFPTVTPSPVHDLKQIDGLV
1cj0A           IVTGGSDNHLILVDLRSKGTDGGRAEK----VLEACSIACNKNTCPGDKSALRPALTSRGLLEKDFQKVA
3blvH           ----------------------------------------------------------------------
3dr4B           HVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLYAHLATDDLKIAEACGVDGLN-LPTHAGLTEADIDRVI
3b8xB           ----------------------------------------------------------------------
3bn1D           HVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDARPVFHPMHIMPPYAHLATDDLPTHAGLTEADIDRVI
3dr4D           HVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIPPYAHLATDDLKIAEACGPTHAGLTEADIDRVI
3bn1C           HVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLESRPVFHPMHIMPPYAHLATDDLPTHAGLTEADIDRVI
1cj0B           IVTGGSDNHLILVDLRSKGTDGGRAKVLEACSIACNKNTCPGDKSALRPSGLRPALTSRGLLEKDFQKVA
2aeuA           YERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYII
3b8xA           ----------------------------------------------------------------------
2c81A           VMKRPPQVSRQTYYGYVFRFDPVKFGGLNAD---QFCEILREKFYLHPPYLPVHKNPLFCPWTKNRYLKS
3dr4A           HVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIPPYAHLATDDLKIAEACGPTHAGLTEADIDRVI
3dr7B           HVALTGRHVFWMYTVRLGEGLSTTR--------DQVIKDLDALGIESRPVFHPMLPTHAGLTEADIDRVI
3d1rA           ----------------------------------------------------------------------
3caiA           YLMVSLRSLPLVMLIGRPEAQIPVVSAVHKVPADRVVQRLADNGILAIANTGSRVLLAHYSTMAEVDQLV
2c7tA           ----------------------------------------------------------------------
3blxD           ----------------------------------------------------------------------
2douA           SLLPPRATMYLWGRLPEGVDD------------LEFGLRLVERGVAFGPGGKGFVRIALVRPLEELLEAA
3blvD           ----------------------------------------------------------------------
3dr4C           HVALTGRHVFWMY----TVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYTHAGLTEADIDRVI
1dkrA           ----------------------------------------------------------------------
2dqxA           ----------------------------------------------------------------------
2bkwA           YPSNSAHGLTAV--------YVADPPDVIAFLKSHGVVIAGGIHKDIGPKYIRIGHVTACNKNLPYKNCF
2douB           SLLPPRATMYLWGRLPEGVDD------------LEFGLRLVERGVAFGPGGKGFVRIALVRPLEELLEAA
3bwnB           TLPKYPEAFCNYFGKSLESYPAFAWLGTKEETD--LVSELRRHKVMSRAERCGSDKVSMLSREDVFNVFL
2a8iB           ----------------------------------------------------------------------
3bn1A           LTGRHVFWMYTVRLGEGLSTTRDQVIKDLDAESRPVFHPMHIMPPYAHLADGLNLPTHAGLTEADIDRVI


                         .         .         +         .         .         .         .:490
query           EALGEAL
2e7uA           EALRKAL
3du4A           AIMKQAI
3dodB           AIMKQAI
3dodA           AIMKQAI
3drdB           AIMKQAI
3bs8A           QAAEKVF
2cinA           AAVRSAL
2bylA           EIINKTI
3clzB           -------
3clzD           -------
3bv0A           SAMVEVA
2byjA           EIINKTI
1dtyA           AAVNRAV
3clzA           -------
2cfbA           AAARTVL
1d7uA           SLLGQAI
3drdA           AIMKQAI
1dgdA           SLLGQAI
3dxvB           DLLDRAF
1asfA           EAIVAVL
2dgmC           EDYKASL
2d5yA           EAIVAVL
1ajrA           TSIHEAV
1b8gA           QRLKAFV
2eh6A           SVLREIL
2dgmA           EDYKASL
3aatA           EAIVAVL
2cy8A           TTFDRVL
3dxvA           DLLDRAF
1arsA           EAIVAVL
2dgmE           EDYKASL
2d64A           EAIVAVL
2e54A           ETLKKVL
1czcA           EAIVAVL
2aatA           EAIVAVL
1arhA           EAIVAVL
2d66A           EAIVAVL
1aamA           EAIVAVL
1b8gB           QRLKAFV
1bqdA           EAIVAVL
1c7gA           DGIIKLY
7aatA           HAIHQVT
1btcA           -------
3dc1D           QVLAQLI
1bybA           -------
2dgmB           EDYKASL
1aiaA           EAIVAVL
1ajsA           TKI----
1aheA           EAIVAVL
3ei9B           RRFKQLY
1bqaA           EAIVAVL
1c7nA           ERLNKAL
1ariA           EAIVAVL
1akaA           HAIHQVT
1ay5B           RAIIE--
3e2fA           EIFRA--
1b4xA           EAIVAVL
3bc8A           KRLDKCL
1cliB           -------
3cq6A           DAAAEII
1d2fB           AGLINAI
3d6kA           DGFATCV
3bcaA           KRLDKCL
2c44A           EAFKHVK
3dzzB           RLKQGVL
3ei7A           RRFKQLY
3dc1A           QVLAQLI
1bkgA           ERFARVL
2egyB           RRLGRAL
3dydA           SRIQEFC
1ax4A           DALIGLK
3bv0B           SAMVEVA
2bwnB           HAM----
2cstA           KSIHEAV
1ay4B           RAIIE--
3ei6A           RRFKQLY
3bcbA           KRLDKCL
3d6kD           DGFATCV
1bjwA           ERFARVL
2c44B           EAFKHVK
3ei8A           RRFKQLY
3ei7B           RRFKQLY
1asbA           EAIVAVL
3dydB           SRIQEFC
2d61A           EAIVAVL
3e9kA           NLLTSIL
2dgkC           EDYKASL
1djuA           ERMERVL
3ecdC           REVGRLI
2bwpA           HAMDLLW
3ecdA           RLILEVF
1b5oA           ERFARVL
2bwnD           HAMDL--
2bwoD           HAMDL--
3e2yA           EIFRA--
3eiaB           RRFKQLY
2egyD           RRLGRAL
2c44C           EAFKHVK
3dzzA           RLK----
3d6kC           DGFATCV
1b5pA           ERFARVL
3ei6B           RRFKQLY
3b46B           ERLKLLK
3b46A           ERLKLLK
3eiaA           RRFKQLY
1dfoB           KELAGWM
1ay4A           RAIIE--
5bj3A           ERFARVL
2bwoB           HAMDLLW
1bj4A           QKVAHFI
1djuB           ERMERVL
3ei9A           RRFKQLY
2dr1B           DNLREVI
3ca8B           -------
1bjoA           DFMVEFE
2bhgA           -------
3cbfA           RRLGRAL
1agxA           -------
1bjnA           DFMVEFE
1d2fA           AGLINAI
5bj4A           ERFARVL
3cq4B           DAAAEII
2dgkA           EDYKASL
1ejiA           QKVAHFI
3cq4A           DAAAEII
2bwnA           HAMDL--
2bwnE           HAMDLLW
3dc1B           QVLAQLI
3d6kB           DGFATCV
3dwkA           -------
1ecxB           KKIEEIL
2dr1A           DNLREVI
2egyC           RRLGRAL
2bieA           ELMIQFK
1bw0A           ERIKAFC
1eg5B           KKIEEIL
2bhxB           ELMIQFK
2bieB           ELMIQFK
2aevA           KAIVESI
2c0rA           QFMEHFK
2bwoA           HAMDLLW
3bcxB           RIMNQTF
1eg5A           KKIEEIL
3ecdD           REVGRLI
1bw0B           ERIKAFC
1dfoA           GWMCDVL
3bcxA           RIMNQTF
3cq5B           DAAAEII
3cq5A           DAAAEII
2ch1A           YGFKESL
1c0nA           TGLQRIH
1ecxA           KKIEEIL
1c4kA           -------
2a7vA           RRVVDFI
2cdmA           -------
2dkjA           PLVAELI
3ecdB           REVGRLI
1bs0A           EVLHGN-
1b9hA           PNTDAIS
3c3jC           -------
3e77A           AFMKKFL
2ch2A           YGFKESL
1djeA           EVLHGN-
3ca8A           -------
3e77C           AFMKKFL
1b9iA           PNTDAIS
3e77B           AFMKKFL
3bb8A           RIMNQTF
2e7jA           NAFKEII
2bwpB           HAMDL--
1cj0A           HFIHRGI
3blvH           -------
3dr4B           AALDQVL
3b8xB           -------
3bn1D           AALDQVL
3dr4D           AALDQVL
3bn1C           AALDQVL
1cj0B           HFIHRGI
2aeuA           KAIVESI
3b8xA           -------
2c81A           VRKTEAY
3dr4A           AALDQVL
3dr7B           AALDQVL
3d1rA           -------
3caiA           RALAS--
2c7tA           -------
3blxD           -------
2douA           KRIREAL
3blvD           -------
3dr4C           AALDQVL
1dkrA           -------
2dqxA           -------
2bkwA           DLIKLAL
2douB           KRIREAL
3bwnB           ERLAN--
2a8iB           -------
3bn1A           AALDQVL