[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS80932.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eglA.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "3eglB.bssp"
#ERROR : Can't open dsspfile "3eglC.bssp"

## Summary of PDB Search
:283
    1e-19  17%  3eglA  [x.x.x] DEGV FAMILY PROTEIN
    7e-18  28%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    4e-17  17%  3eglB  [x.x.x] DEGV FAMILY PROTEIN
    4e-14  17%  3eglC  [x.x.x] DEGV FAMILY PROTEIN
:283

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxSSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQV
3eglA           -------APVRVIVDSSACLPTHVAEDLDITVINLHVNN----------------------GEERSTSGL
2dt8A           ---------ITLVTDSTSDLPQDLRGRLGVRVVPLYVNLSGAIYRDWEEITPTEIFQKVREAAFPTTSQP
3eglB           --------PVRVIVDSSACLPTHVAEDLDITVINLHVNN----------------------GEERSTSGL
3eglC           -------APVRVIVDSSACLPTHVAEDLDITVINLHVNNER------------------------STSGL


                         .         .         *         .         .         .         .:140
query           APEDLRKLYEALLXXXXXXXXXXXXXXXXXXXDTAKKVAQAFGERVKXXXXXXXXXXXXXXXXXXXXXXX
3eglA           SSLELAASYARQLERGGDDGVLALHISELSSTWSAAVTAAAVDDSVRVVDTSSLGAVGAAAAAARADGAS
2dt8A           SPEDFARVYREALEEADHVLSLHISGKLSGTVQSAELAAQEFPGRVTVVDTQAASLGVGVLRAKELLEEG
3eglB           SSLELAASYARQLERGGDDGVLALHISELSSTWSAAVTAAAVDDSVRVVDTSSLGAVGAAAAAARADGAS
3eglC           SSLELAASYARQLERGGDDGVLALHISELSSTWSAAVTAAAVFDDDSVRVVDTSSLGAVGAAAAAARADG


                         +         .         .         .         .         *         .:210
query           XXXXWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
3eglA           LQECYDIAVDTL-----RSETWIYLHRIDEI-WSGRIS-TATAVSTALATRPIRFN-GGREIAATRTQSA
2dt8A           QSL--EAVLAELERLRRDHFVRFSVATLEFLKRGGRIGGAQAFLGTLLNLKPVLTLKEGRVEAAGRARGE
3eglB           LQECYDIAVDTL-----RSETWIYLHRIDEI-WSGRISTATAVSTAATR--PIRFN-GGREIAATRTQSA
3eglC           ASLQEC-YDIAVDTLRSET--WIYLHRIDEI-WSGRIS-TATAVSTALATRPIRFN-GGREIAATRTQSA


                         .         .         .         +         .         .         .:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPXXXXXXXXXXXXXXVEVLGALPAGAAVSVHTGPGTVAAFAG
3eglA           FALVELAQIRAD----GEPVFIAIGQNEAREAAQLEELLRNALPEGSFSVDIDPTLAVHSGPGAVSVS--
2dt8A           KKAREEILKAFRAWAEGRIRAYFLYSGDEDAVAALRQEVLASGLPVELVNELGAVIASHTGPGTYGFYAY
3eglB           FALVELAQIRA----DGEPVFIAIGQEAAQLEELLRNALPEGSSFSV---DIDPTLAVHSGPGAVSVS--
3eglC           F----ALVELAQIRADGEPVFIAIGQEAAQLEELLRNALPEGSSFSV---DIDPTLAVHSGPGAVSVS--


                         .         *         .         .         .         .         +:350
query           Pxx
3eglA           ---
2dt8A           S--
3eglB           ---
3eglC           ---