[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81022.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2cnwD.bssp"
#ERROR : Can't open dsspfile "2cnwE.bssp"
#ERROR : Can't open dsspfile "2c5qB.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2cnwF.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2c5qE.bssp"
#ERROR : Can't open dsspfile "2df5A.bssp"
#ERROR : Can't open dsspfile "1augA.bssp"
#ERROR : Can't open dsspfile "2c5qA.bssp"
#ERROR : Can't open dsspfile "4ecaA.bssp"
#ERROR : Can't open dsspfile "2b98D.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2c5qF.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2afiF.bssp"
#ERROR : Can't open dsspfile "3cioA.bssp"
#ERROR : Can't open dsspfile "2afkG.bssp"
#ERROR : Can't open dsspfile "3cr8C.bssp"
#ERROR : Can't open dsspfile "2b98A.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2afiM.bssp"
#ERROR : Can't open dsspfile "3cwqB.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "3ea0B.bssp"
#ERROR : Can't open dsspfile "2b98C.bssp"
#ERROR : Can't open dsspfile "3cwqA.bssp"
#ERROR : Can't open dsspfile "2bejA.bssp"
#ERROR : Can't open dsspfile "3bfvA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2afiE.bssp"
#ERROR : Can't open dsspfile "1dulA.bssp"
#ERROR : Can't open dsspfile "2afkE.bssp"
#ERROR : Can't open dsspfile "2afiO.bssp"
#ERROR : Can't open dsspfile "1djpA.bssp"
#ERROR : Can't open dsspfile "2bekA.bssp"
#ERROR : Can't open dsspfile "2afkF.bssp"
#ERROR : Can't open dsspfile "1byiA.bssp"
#ERROR : Can't open dsspfile "2afiH.bssp"
#ERROR : Can't open dsspfile "2afkH.bssp"
#ERROR : Can't open dsspfile "2afiN.bssp"
#ERROR : Can't open dsspfile "3bfjA.bssp"
#ERROR : Can't open dsspfile "1de0A.bssp"
#ERROR : Can't open dsspfile "3cr8A.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3cf4G.bssp"
#ERROR : Can't open dsspfile "2cb4A.bssp"
#ERROR : Can't open dsspfile "1dtsA.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "2d7uA.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "2bekB.bssp"
#ERROR : Can't open dsspfile "2afiP.bssp"
#ERROR : Can't open dsspfile "2b98B.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "3ea0A.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2b99B.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"

## Summary of PDB Search
:434
    3e-47  34%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    7e-39  32%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-33  35%  2cnwD  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-32  33%  2cnwE  [x.x.x] CELL DIVISION PROTEIN FTSY
    8e-32   7%  2c5qB  [x.x.x] RRAA-LIKE PROTEIN YER010C
    7e-29  18%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    4e-28  37%  2cnwF  [x.x.x] CELL DIVISION PROTEIN FTSY
    6e-28  80%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-28   7%  2c5qE  [x.x.x] RRAA-LIKE PROTEIN YER010C
    2e-27   8%  2df5A  [x.x.x] PYRROLIDONE-CARBOXYLATE PEPTIDASE
    3e-26  11%  1augA  [c.56.4] PYROGLUTAMYL PEPTIDASE-1
    1e-25   7%  2c5qA  [x.x.x] RRAA-LIKE PROTEIN YER010C
    2e-25  13%  4ecaA  [c.88.1] L-ASPARAGINE AMIDOHYDROLASE
    2e-24   8%  2b98D  [x.x.x] RIBOFLAVIN SYNTHASE
    2e-23  33%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-23   5%  2c5qF  [x.x.x] RRAA-LIKE PROTEIN YER010C
    3e-23  12%  1cp2A  [c.37.1] NITROGENASE IRON PROTEIN
    7e-23  80%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-22  80%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-21  13%  2afiF  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-21  12%  3cioA  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    5e-21  13%  2afkG  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-21  20%  3cr8C  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    5e-20   8%  2b98A  [x.x.x] RIBOFLAVIN SYNTHASE
    7e-20  34%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-19  14%  2afiM  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-19  15%  3cwqB  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    1e-18  15%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    2e-18  14%  3ea0B  [x.x.x] ATPASE, PARA FAMILY
    3e-18   8%  2b98C  [x.x.x] RIBOFLAVIN SYNTHASE
    1e-17  15%  3cwqA  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    2e-17  16%  2bejA  [x.x.x] SEGREGATION PROTEIN
    3e-17  12%  3bfvA  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    4e-17  33%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-17  13%  2afiE  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-17  47%  1dulA  [a.36.1] SIGNAL RECOGNITION PARTICLE PROTEIN (FIFTY-FOUR
    6e-16  13%  2afkE  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-16  12%  2afiO  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-16  14%  1djpA  [c.88.1] GLUTAMINASE-ASPARAGINASE
    8e-16  17%  2bekA  [x.x.x] SEGREGATION PROTEIN
    1e-15  12%  2afkF  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-15  14%  1byiA  [c.37.1 (1bs1A)] DETHIOBIOTIN SYNTHASE
    5e-15  13%  2afiH  [x.x.x] NITROGENASE IRON PROTEIN 1
    8e-15  12%  2afkH  [x.x.x] NITROGENASE IRON PROTEIN 1
    4e-12  13%  2afiN  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-12  14%  3bfjA  [x.x.x] 1,3-PROPANEDIOL OXIDOREDUCTASE
    5e-12  12%  1de0A  [c.37.1] NITROGENASE IRON PROTEIN
    4e-11  15%  3cr8A  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    8e-11  13%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-10   9%  3cf4G  [x.x.x] ACETYL-COA DECARBONYLASE/SYNTHASE EPSILON
    1e-10   3%  2cb4A  [x.x.x] MOSQUITOCIDAL TOXIN
    3e-10  14%  1dtsA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    7e-10  13%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    1e-09  10%  2d7uA  [x.x.x] ADENYLOSUCCINATE SYNTHETASE
    2e-09  16%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    5e-09  18%  2bekB  [x.x.x] SEGREGATION PROTEIN
    5e-09  12%  2afiP  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-09   6%  2b98B  [x.x.x] RIBOFLAVIN SYNTHASE
    6e-05  45%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-05  16%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-04  11%  3ea0A  [x.x.x] ATPASE, PARA FAMILY
    3e-04  30%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    6e-04   5%  2b99B  [x.x.x] RIBOFLAVIN SYNTHASE
    0.001  20%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLXXXXXXXXXXXXXXLGRKVLESLTP
3dm5A           VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
3dm5B           VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
2cnwD           -------------------------NLEEVLEELEMALLAADVGLSATEEILQEVRAS--GRKDLKEAVK
2cnwE           -------------------------NLEEVLEELEMALLAADVGLSATEEILQEVRGRKDLKEAVKEKLV
2c5qB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2cnwF           -------------------------NLEEVLEELEMALLAADVGLSAT-------------EEILQEVRA
2c03B           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2c5qE           ----------------------------------------------------------------------
2df5A           -----------------------------------------------------------AKDLDGIKIGD
1augA           -----------------------------------------------------------------AAEGP
2c5qA           ----------------------------------------------------------------------
4ecaA           ----------------------------------------------------------------------
2b98D           ----------------------------------------------------------------------
3dm9B           ---------------------IKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
2c5qF           ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
2c03A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2c04A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2afiF           ----------------------------------------------------------------------
3cioA           -----------------------------APEQLEEHGISVYATIPMSEWLDKRQQRHRKNIPFLAVDNP
2afkG           ----------------------------------------------------------------------
3cr8C           ----------------------------------------------------------------------
2b98A           ----------------------------------------------------------------------
3dmdC           -------------DRILT-VEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
2afiM           ----------------------------------------------------------------------
3cwqB           ----------------------------------------------------------------------
1b25A           ---------------MYGWGRILRVNL--TTGEVKVQEYPEEVAKKFIGGRG-------LAAWILWNEAR
3ea0B           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
2bejA           ----------------------------------------------------------------------
3bfvA           -----------------------------RIKDEEDVEKELGLPVLGSIQKFNMTNTRRSTSSLIVHEQP
3dmdB           MFGKLREKLKSFVKRRILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
2afiE           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
2afkE           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
1djpA           ----------------------------------------------------------------------
2bekA           ----------------------------------------------------------------------
2afkF           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------
2afiH           ----------------------------------------------------------------------
2afkH           ----------------------------------------------------------------------
2afiN           ----------------------------------------------------------------------
3bfjA           ----------------------------------------------------------------------
1de0A           ----------------------------------------------------------------------
3cr8A           ---------------------IADPSVAERAEKIGVRLIAYPRMVYVEDRAEHLPEAEASGEEFQRRMRA
3cioD           -------------------------EAPEQLEEHGISVYATIPMSEWLDKRTRLQRHRTKNIPFLAVDNP
3cf4G           ----------------------------------------------------------------------
2cb4A           ----------------------------------------------------------------------
1dtsA           ----------------------------------------------------------------------
1eg7B           -----------------------------------------EIAQAAKMKPVMELARGLGIQE--DEVEL
2d7uA           ----------------------------------------------------------------------
1eg7A           --------------------------------------------------------------ELARGLGI
2bekB           ----------------------------------------------------------------------
2afiP           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------FESAEV
3ea0A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------
3do6A           -------------------------------------------------------------KEIADQLEL


                         .         .         *         .         .         .         .:140
query           AEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
3dm5A           KEHIIKIVYEELT----KFLGTEAKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
3dm5B           KIKIVYEELTKFLGTE--AKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
2cnwD           EKLVGMLEPDERRATLRKLGFQKPKPVEPVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2cnwE           GMLEPDERRATLRKLGFNPQKPKPVEPKGVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2c5qB           -------------------------------------------DLQKLQRFSTCDISDGLLNVYNIPTGG
3cr8B           ---------------------PPRERQGFTVFFTGLSGAGKSTLARALAARLMEMGGRCTLLDGDIVRRH
2cnwF           RKDLKEAVKEKLVGMLEPPVEPKG----RVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2c03B           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2c5qE           ---------------------------------------------QKLQRFSTCDISDGLLNVYNIPTGG
2df5A           AQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNA------------IDARIP
1augA           ASIVSEQVPTVFYKSLAVLREAIKKHQPDIIICVGQAGGRMQITPERVAINL------------NEARIP
2c5qA           ------------------------------------------SDLQKLQRFSTCDISDGLLNVYNIPTGG
4ecaA           ----------------------------------------------------------------------
2b98D           --------------------------------------------------------KKVGIVDTVDMASI
3dm9B           GKIIEEAVKEAVSEILETSRRIDLKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
2c5qF           ----------------------------------------------------------------------
1cp2A           -----------------------------QVAIYGKGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADS
2c03A           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2c04A           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2afiF           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
3cioA           ADSA-VEAVRALRTSLHFAMMET--ENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGY
2afkG           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
3cr8C           ------------------RQTPPRERQGFTVFFTGLSGAGKSTLARALAARLMEMGGRCTLLDGDIVRRH
2b98A           --------------------------------------------------------KKVGIVDTVDMASI
3dmdC           GKIIEEAVKEAVSEILET-SRRIDLIEEIVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
2afiM           --------------------------------IYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
3cwqB           -----------------------------ITVASFKGGVGKTTTAVHLSAYLA-LQGETLLIDGDPNRSA
1b25A           GVEPLSPENKLIFAAGPFNGLPTPSGGKLVVAAKSPLGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPV
3ea0B           ----------------------------RVFGFVSAKGDGGSCIAANFAFASQEPDIHVLAVDISLPFGD
2b98C           --------------------------------------------------------KKVGIVDTVDMASI
3cwqA           -----------------------------ITVASFKGGVGKTTTAVHLS-AYLALQGETLLIDGDPNRSA
2bejA           -------------------------KVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNA
3bfvA           KSPISEKFRGIRSNIMFANPDS---AVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPT
3dmdB           GKIIEEAVKEAVSEILETSRRIDKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
2afiE           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
1dulA           ----------------------------------------------------------------------
2afkE           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
2afiO           -----------------------------QCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
1djpA           ----------------------------------------------------------------------
2bekA           -------------------------KVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNA
2afkF           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
1byiA           ----------------------------KRYFVTGTDEVGKTVASCALLQAAKAAGYRTAGYKPVASGSE
2afiH           -----------------------------QCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
2afkH           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
2afiN           --------------------------------IYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
3bfjA           ---------------------------RMFDYLVPFFGPNAISVVGERCQLLGGK--KALLVTKGLRKDG
1de0A           ---------------------------MRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
3cr8A           GLKIPEWYSFPEVLAELHRQTPPRERQGFTVFFTGLSGAGKSTLARALARLMEMGGRCVTLLDGDIVRRH
3cioD           ADSAVEAVRALRTSLHFAMMETEN---NILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGY
3cf4G           ---------------------------------SYGVNTSKAVSPEMAAKIISKAKRPLLMVGTLALDPE
2cb4A           --------------------------------NTWIQAALTWLDSSLLYQLISTRIPSFASPNGLHREQT
1dtsA           -------------------------------------EVGKTVASCALLQAAKAAGYRTAGYKPVASGSE
1eg7B           YGKYKAKISLDVYRRL--KDKPDGKLILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGP
2d7uA           ---------------------ADRVMRKAKQAKDVKELEPYLTDVAQEINDALDEGSLVLVEGTQGFGLS
1eg7A           QEDEVELYGKYKAKISLDVYRRLKDKPLVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGP
2bekB           -------------------------KVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNA
2afiP           -------------------------------------GIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
2b98B           --------------------------------------------------------KKVGIVDTTFARVD
3e70C           ----------------------------------------------------------------------
3czpB           GHSIDKDTYEKAVIELREALLEAQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEELE
3ea0A           -------------------------------------GDGGSCIAANFAFALQEPDIHVLAVDISLPFGD
2ax4B           -------------------------------WLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHG
2b99B           --------------------------------------------------------KKVGIVDTTFARVD
3do6A           KDDILYYIAKIDHRFLKSLENHEDGKLILVTAVTTPAGEGKTTTSIGLSSLNR-IGKKSIVTLRE---PS


                         +         .         .         .         .         *         .:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIXXXXXXXXXXXXXXXXXXXTAGRLQIDERLMEELVRLKAALR
3dm5A           AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIH
3dm5B           AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIE-MKQISNVIH
2cnwD           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIA
2cnwE           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKDPEE
2c5qB           YFPNLTAISPPQNSSIVGTAYTVLFAPIRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQATRAQY
3cr8B           LSSELGFSKAHRDVNVRRIGFASEITKNRGIAICAPIAPYRQTRR--DVRAMIEAVGGFVEIHVATDPYV
2cnwF           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIA
2c03B           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2c5qE           YFPNLTAISPPQNSSIVGTAYTVLFAPIDDPRPAVNYIDSVPPNSILLEPHLQSQFHPFIKITQATRAQY
2df5A           DNEGKKIEDEPIVPGAPTAYF---STLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGY
1augA           DNEGNQPVGEDISQGGPAAYW---TGLPIKRIVEEIKKEGIPAAVSYTAGTFVCNHLFYGLMDEISRHHP
2c5qA           YFPNLTAISPPQNSSIVGTAYTVLFAPPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQATRAQY
4ecaA           -----------------------------------------------TVGKVGVEN-LVNAVPQLKDIAN
2b98D           AIKKLKELSPNIKIIRKTVPGIK--DLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQ
3dm9B           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLDEKKIARV--TK
2c5qF           -----------------------------------------------LEPHLQSQFHPFIKITQYGGLMS
1cp2A           TRLLLGGLAQKSVLDTLREEGEDVELDSILKEGYGGIRCVESGGPEPGVGCAGRGIITSINMLEQLGAYT
2c03A           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2c04A           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2afiF           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVIINFLEEEGAYE
3cioA           SHNLFTVSNEHGLSEYLA------GKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWAN
2afkG           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPGVGCAGRGVITAINFLEEEGAYE
3cr8C           LSSELGFSKAHRDVNVRRIGFPIAPYRQTRRDVRAMIEAVGGFVEIHVATPIEYEVPETPELAIDTTGLA
2b98A           AIKKLKELSPNIKIIRKTVPGIK--DLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLAQLMTN
3dmdC           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTK
2afiM           TRLILHSKAQNTIMEMAAEAGTVEDLEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYE
3cwqB           TGWGKRGSLPFKVVDERQAAKYAPKYQDTQARDLEALADGCDLLVIPSTPDALALDALLTIETLQKLGNN
1b25A           YIYIEDDNVSILSAEGLWGKTTFETERE------------------------------------------
3ea0B           LDYLSGNTHSQDLADISNASDRLDKSLL----DTVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHIAA
2b98C           AIKKLKELSPNIKIIRKTVPG--IKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQ
3cwqA           TGWGKRGSLPFKVVDERQAAKVIDTQARPEDEDLEALADGCDLLVIPSTPDALALDALLTIETLQKLGNN
2bejA           TSGLGVRAERGVYHLLLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPVQ
3bfvA           QHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRADTLLMNYNFVTPPVN
3dmdB           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTK
2afiE           TRLILHSKAQNTIMEMAAEAGTVEDLELVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYE
1dulA           ----------------------------------------------------------------------
2afkE           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVAINFLEEEGAYE
2afiO           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEVGCAGRGVITAINFLEEEGAYE
1djpA           ------------------------------------------------AAKVGVDK-LIAGVPELADLAN
2bekA           TSGLGVRAERGVYHLLQGEPLEGLVGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPVQ
2afkF           TRLILHSKAQNTIMEMAAEAGTVEDLELVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYE
1byiA           KTPEGLRFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQ
2afiH           TRLILHSKAQNTIMEMAAEAGTVEDLELVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYE
2afkH           TRLILHSKAQNTIMEMAAEAGTVEDLELVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYE
2afiN           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVIINFLEEEGAYE
3bfjA           AVDKTLHYLREAGIEVAIFDGVEPNPKDTNVRDGLAVFRREQCDIIVCGKGIGIAATHEGDLYQYAGIET
1de0A           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVAINFLEEEGAYE
3cr8A           LSSELGSKAHRDVNVRRIGFVASEITK--------NRGIAICAPIAPYRQTRRDVRAMIEAVIHVATDPY
3cioD           SHNLFTVSNEHGLSEYLAGKDELNKVIQ------HFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWAN
3cf4G           LLDRVVKISKAANIPIAATGSSLAVLAD-----KDVDAKYINAHMLGFYLTDPKWPGLDGNGVLSAAKNF
2cb4A           IDSNTGQIQIDNEHRLLRWDRRPPNDIF-----LNGFIPRVTNQNLSPVEDTHLLNYLRTNSPSIFVSTT
1dtsA           KTPEGLTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQ
1eg7B           SF---GIKGGAAGGGYAQVVPMEDINLH------------------------------------------
2d7uA           LYYGTYPY-----VTSKDVTASSVAADVGIGPTRVDEVIVVFKSFPTRVGAGPFPTEMPMEEADRLGLVE
1eg7A           SF---GIKGGAAGGGYAQVVPMEDINLH------------------------------------------
2bekB           TSGLGVRAERGVYHLLQGEPLVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPVQ
2afiP           TRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVAGRGVITAINFLEEEGAYE
2b98B           MASIAIKKLKELSPNIKIKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLAQLMTN
3e70C           ----------------------------------------------------------------------
3czpB           RPPQWRFWR-------------------------------------------------------------
3ea0A           LDYLSGNTHSQDLADISNASDRLDKSLLDTVQHISPSLDLIPS-----PATFEKIVNIEPERVSDLIHIA
2ax4B           LNRNL-----------------------------------------------------------------
2b99B           MASIAIKKLKELSPNI-KIIRKTVPGIKDLPVACKKLLEEEGCDIVMLGMPGKAEKDKVLGLMLAQLMTN
3do6A           LGPTLGLKGGATG---------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
3dm5A           PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE
3dm5B           PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE
2cnwD           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2cnwE           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2c5qB           LKSNGTVVFGRIRDVD--EHRTLNHPVFAYGVGSCAPKAVVKAVGTNV---QLKILTSDGVTQTIPGDYI
3cr8B           PETPELAIDT-TGLAIDEAVQQILLKLEHEGYL-------------------------------------
2cnwF           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2c03B           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2c5qE           LKSNGTVVFGRIRDVD--EHRTLNHPVFAYGVGSCAPKAVVKAVGTNV---QLKILTSDGVTQTIPGDYI
2df5A           PKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELE-------AVKVAIEVAL-----------------
1augA           HIRGGFIHQTLQKSAPSLSLDHITKALKIAAVTAAVHEDDIETG--------------------------
2c5qA           LKSNGTVVFGRIRDVD--EHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQL---KILTSDGVTQTIPGDYI
4ecaA           VKEQVVNIGSMNDNVWLTLAKKINTDCKTDGFVITHVDTMEETAYFLDLTVKCDKPVVMVGAMRPSTSMS
2b98D           KHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGK--------------------
3dm9B           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
2c5qF           TRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDYI
1cp2A           DDLDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALYAANNISKGIQKYAKSGGVRYELLDAFA
2c03A           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2c04A           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2afiF           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANNTDREDELIIALA
3cioA           DHYDLVIVDTPPMLAVSDAAVVGRSVGTS--LLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKR
2afkG           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLGTDREDELIIALA
3cr8C           IDAVQQILLKLEHEGYLRL---------------------------------------------------
2b98A           KHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPE----------------------------
3dmdC           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
2afiM           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLGGLICNSRNTDRE
3cwqB           RFRILLTIIPPYPSKDGDEARQLLTTAGLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEIL---------
1b25A           ----------------------------------------------------------------------
3ea0B           SFYDYIIVDFGASIDHVGVWVLEHLDELC---IVTTPSLQSLRRALLKLCKEFEKPISRIEIILNRADTS
2b98C           KHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKG-------------------
3cwqA           RFRILLTIIPPYPSKDGDEARQLLTTAGLPGVVVSEVSDSKAGIAWSDYKATGKEIVEEILTLEH-----
2bejA           AEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGEKVFW------TVI
3bfvA           TVTDAQLFSKFTGKDEVKKGKELIEATGLLGVVLNRMP--------------------------------
3dmdB           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
2afiE           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLGGLICNSRNIALA
1dulA           ----------------------------------------------------------------------
2afkE           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANSTDREDELIIALA
2afiO           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGI------------------
1djpA           VREQVMQIASITNDDLLKLGKRVAELADSNDVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMS
2bekA           AEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEA-------QLRAHFGEKVFWTV
2afkF           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGI------------------
1byiA           LPVILVVGVKLGCINHAMLTAQVIQHAGLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEI-------
2afiH           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLNTDREDELIIALA
2afkH           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGI------------------
2afiN           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLNTDREDELIIALA
3bfjA           LPIVAVNTTAGTASEVTRHCVLTNTETKVKF---------------------------------------
1de0A           DDLDFVFYDVLGDVVCGGWAMPIRENKAQEIYIVCSGEMMAMYAANNISK--------------------
3cr8A           PETPELAIDT-TGLAIDEAVQQILLKLEHEGYL-------------------------------------
3cioD           DHYDLVIVDTPPML-AVSDAAVVGRSVG-TSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKR
3cf4G           SNLKTIAIEIQNATMSFGNLSKADHYAALDELI-------------------------------------
2cb4A           RGLEITPWTPHSANNNIIYRYEIFAPGGIDINASFSRNHNPFPN--------------------------
1dtsA           LPVILVVGVKLGCINHAMLTAQVIQHAGLAGWVANDVTPPGKRHAEYMTTRMIPAPLL---------GEI
1eg7B           ----------------------------------------------------------------------
2d7uA           YGTVTGRRRRVGWFDFE-MARYSARINGATMLAVTMLDKYDKEAFGVTIEERVGVPVGLIKTGPELEHII
1eg7A           ----------------------------------------------------------------------
2bekB           AEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEARAHFGEKVFWTVIPRNVR---
2afiP           DDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGINSGSVRLGGLDELIIALA
2b98B           KHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYL---------------------------------
3e70C           --------DALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
3czpB           ----------------------------------------------------------------------
3ea0A           ASFYDYIIVDFGASIDHVGVWVLEHLDELCIVTTPSLQSLRRAGQLLKLCKEFEKPISRIEI--------
2ax4B           ----------------------------------------------------------------------
2b99B           KHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYL---------------------------------
3do6A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PFYPDRLAGRILGMGDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGR
3dm5A           PFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKELRGKFTLKDMYAQLEAMRKMGPIS-----------
3dm5B           PFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKEERGKFTLKDMYAQLEAMRKMG--------------
2cnwD           PFDPEAFVEALL----------------------------------------------------------
2cnwE           PFDPEAFVEALL----------------------------------------------------------
2c5qB           AGDNNGIVRIPVQETDISKLVTYISIEVDLLVSEDIKNGIPAKQAQNDRRSVLK----------------
3cr8B           ----------------------------------------------------------------------
2cnwF           PFDPEAFVEALL----------------------------------------------------------
2c03B           PFYPERLAGRILGMGDV-----------------------------------------------------
2c5qE           AGDNNGIVRIPVQETDISKLVTYISIEVDLLVSEDIKNGIPAKQAQNDRRSVLKKY--------------
2df5A           ----------------------------------------------------------------------
1augA           ----------------------------------------------------------------------
2c5qA           AGDNNGIVRIPVQETDISKLVTYIE--KSIEVDLLVSEDIPAKQAQNDRRSVL-----------------
4ecaA           ADGPFNLYNAVVTAADKASANRGNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKH
2b98D           ----------------------------------------------------------------------
3dm9B           PFEKEWFLERIFG---------------------------------------------------------
2c5qF           AGDNNGIVRIPVQETDISKLVTYISIEVDLLVSEDIKNGIPAKQAQNDRRSVLK----------------
1cp2A           KELGSQLIHFVPRSPMVTKAEI--NKQTVIEYDPTCEQAEEYRELARKVDAIPKPMTQERLEEILMQYG-
2c03A           PFYPERLAGRILGMG-------------------------------------------------------
2c04A           PFYPERLAGRILGMGDV-----------------------------------------------------
2afiF           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYKVVDNKLLVIPNP--ITMDELEELLMEFG-
3cioA           ASTAYSYGYN------------------------------------------------------------
2afkG           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYKVVDNKLLVI--PNPITMDELEELLMEFG-
3cr8C           ----------------------------------------------------------------------
2b98A           ----------------------------------------------------------------------
3dmdC           PFEKEWFLERIFG---------------------------------------------------------
2afiM           DELIIALAHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRVDNKLLVIPNPITMDELEELLM-------
3cwqB           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3ea0B           RITSDEIEKVIGRPISRIPQDEDAQESLLSGQAPKSQLSKTIVDWALH----------------------
2b98C           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
2bejA           PRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARV------------------------------
3bfvA           ----------------------------------------------------------------------
3dmdB           PFEKEWFLERIFG---------------------------------------------------------
2afiE           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYKVVDNKLLVIPNP--ITMDELEELL-----
1dulA           ----------------------------------------------------------------------
2afkE           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYKVVDNKLLVIPNPI--TMDELEELL-----
2afiO           ----------------------------------------------------------------------
1djpA           ADGMLNLYNAVAVASNKDSRGKG-----------------------------------------------
2bekA           IPRNVRLAAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARV------------------------------
2afkF           ----------------------------------------------------------------------
1byiA           PWLAENPENAATGKYINLAL--------------------------------------------------
2afiH           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYKVVDNKLLVI--PNPITMDELEELL-----
2afkH           ----------------------------------------------------------------------
2afiN           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEY-RALARKVVDNKLLVITMDELEELL-----
3bfjA           ----------------------------------------------------------------------
1de0A           ----------------------------------------------------------------------
3cr8A           ----------------------------------------------------------------------
3cioD           ASTAYSYG--------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
2cb4A           ----------------------------------------------------------------------
1dtsA           PWLAEAATGKYINLAL------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2d7uA           DR--------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2bekB           ----------------------------------------------------------------------
2afiP           NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEY------------------------------
2b98B           ----------------------------------------------------------------------
3e70C           PFEKEWFLERIFG---------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3ea0A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
3dm5A           -------IGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSM
3dm5B           -----PSIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSM
2cnwD           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2c5qB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2cnwF           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c5qE           ----------------------------------------------------------------------
2df5A           ----------------------------------------------------------------------
1augA           ----------------------------------------------------------------------
2c5qA           ----------------------------------------------------------------------
4ecaA           TSDTPFDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLAT--------
2b98D           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2c5qF           ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2afiF           ----------------------------------------------------------------------
3cioA           ----------------------------------------------------------------------
2afkG           ----------------------------------------------------------------------
3cr8C           ----------------------------------------------------------------------
2b98A           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
3cwqB           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
3ea0B           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
2bejA           ----------------------------------------------------------------------
3bfvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2afiE           ----------------------------------------------------------------------
1dulA           ------DFLEQKVLVREAIINSTK--ERAKPEIIKGSRKRRIAAGSG-QVQDVNRLLKQFDDQR------
2afkE           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
1djpA           ----------------------------------------------------------------------
2bekA           ----------------------------------------------------------------------
2afkF           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------
2afiH           ----------------------------------------------------------------------
2afkH           ----------------------------------------------------------------------
2afiN           ----------------------------------------------------------------------
3bfjA           ----------------------------------------------------------------------
1de0A           ----------------------------------------------------------------------
3cr8A           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
2cb4A           ----------------------------------------------------------------------
1dtsA           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2d7uA           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
2bekB           ----------------------------------------------------------------------
2afiP           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3ea0A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ERRKxxxxxxxxxx
3dm5A           NKRQ----------
3dm5B           NKRQ----------
2cnwD           --------------
2cnwE           --------------
2c5qB           --------------
3cr8B           --------------
2cnwF           --------------
2c03B           --------------
2c5qE           --------------
2df5A           --------------
1augA           --------------
2c5qA           --------------
4ecaA           --------------
2b98D           --------------
3dm9B           --------------
2c5qF           --------------
1cp2A           --------------
2c03A           --------------
2c04A           --------------
2afiF           --------------
3cioA           --------------
2afkG           --------------
3cr8C           --------------
2b98A           --------------
3dmdC           --------------
2afiM           --------------
3cwqB           --------------
1b25A           --------------
3ea0B           --------------
2b98C           --------------
3cwqA           --------------
2bejA           --------------
3bfvA           --------------
3dmdB           --------------
2afiE           --------------
1dulA           --------------
2afkE           --------------
2afiO           --------------
1djpA           --------------
2bekA           --------------
2afkF           --------------
1byiA           --------------
2afiH           --------------
2afkH           --------------
2afiN           --------------
3bfjA           --------------
1de0A           --------------
3cr8A           --------------
3cioD           --------------
3cf4G           --------------
2cb4A           --------------
1dtsA           --------------
1eg7B           --------------
2d7uA           --------------
1eg7A           --------------
2bekB           --------------
2afiP           --------------
2b98B           --------------
3e70C           --------------
3czpB           --------------
3ea0A           --------------
2ax4B           --------------
2b99B           --------------
3do6A           --------------