[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81035.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c8tA.bssp"
#ERROR : Can't open dsspfile "2cbyB.bssp"
#ERROR : Can't open dsspfile "3bezD.bssp"
#ERROR : Can't open dsspfile "3bf0A.bssp"
#ERROR : Can't open dsspfile "2cbyD.bssp"
#ERROR : Can't open dsspfile "3bezA.bssp"
#ERROR : Can't open dsspfile "3bezC.bssp"
#ERROR : Can't open dsspfile "3bppA.bssp"
#ERROR : Can't open dsspfile "2cbyG.bssp"
#ERROR : Can't open dsspfile "2cbyA.bssp"
#ERROR : Can't open dsspfile "3bf0C.bssp"
#ERROR : Can't open dsspfile "3bf0D.bssp"
#ERROR : Can't open dsspfile "3bf0B.bssp"
#ERROR : Can't open dsspfile "2deoB.bssp"
#ERROR : Can't open dsspfile "1alqA.bssp"
#ERROR : Can't open dsspfile "2deoA.bssp"

## Summary of PDB Search
:433
    7e-18  23%  2c8tA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    3e-14  23%  2cbyB  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    2e-10  17%  3bezD  [x.x.x] PROTEASE 4
    2e-09  14%  3bf0A  [x.x.x] PROTEASE 4
    3e-09  23%  2cbyD  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    1e-08  20%  3bezA  [x.x.x] PROTEASE 4
    1e-08  19%  3bezC  [x.x.x] PROTEASE 4
    2e-08  25%  3bppA  [x.x.x] 1510-N MEMBRANE PROTEASE
    1e-07  22%  2cbyG  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    3e-07  21%  2cbyA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    4e-07  14%  3bf0C  [x.x.x] PROTEASE 4
    1e-06  13%  3bf0D  [x.x.x] PROTEASE 4
    5e-05  21%  3bf0B  [x.x.x] PROTEASE 4
    6e-05  21%  2deoB  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
    8e-04  16%  1alqA  [x.x.x] CP254 BETA-LACTAMASE
    9e-04  18%  2deoA  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
:433

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKTYLVPIEGEIDPALAVFVEQALARAEREGASGVAFLIDT
2c8tA           ------------------------------SERIIFLGSEVNDEIARLCAQILLLAAEDASKDISLYINS
2cbyB           ------------------------------SERIIFLGSEVNDEIARLCAQILLLAAEDASKDISLYINS
3bezD           ------------------------------ANGAIDGEETQGNVGGDTTAAQIRDARLDKVKAIVLRVNS
3bf0A           ----------------------------------------QGNVGGDTTAAQIRDARLDPKVKAIVLRNS
2cbyD           ------------------------------SERIIFLGSEVNDEIANRLCAQILLLAAEDASDISLYINS
3bezA           -----------------------------------------------TAAQIRDARLDPKVKAIVLRVNS
3bezC           ----------------------------------IDGEETQGNVGGDTTAAQIRDARLDPVKAIVLRVNS
3bppA           -----------------------------NIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDT
2cbyG           ------------------------------SERIIFLGSEVNDEIANRLCAQILLLAAEDASDISLYINS
2cbyA           ------------------------------SERIIFLGSEVNDEIANRLCAQILLLAAEDASDISLYINS
3bf0C           ----------------------------------MDGEETQGNVGGDTTAAQIRDARLDPKVKAIVLVNS
3bf0D           -----------------------------------DGEETQGNVGGDTTAAQIRDARLDPKVKAIVLVNS
3bf0B           ----------------------------------------QGNVGGDTTAAQIRDARLDPKVKAIVLVNS
2deoB           ----------------------------------AQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDT
1alqA           ---------------------------------LISETAKSVMKEFAAAAKELNDLEKKNAHIGVYALDT
2deoA           -----------------------------NIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDT


                         .         .         *         .         .         .         .:140
query           PGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSEIGAALPVVALPLQEPQAADQ
2c8tA           PGGSISAGMAIYDTMVLAPCDIATYAMMAASMGEFLLAAGTKGKALPHARILMHQPLIAIQAEQFAVIKK
2cbyB           PGGSISAGMAIYDTMVLAPCDIATYAMMAASMGEFLLAAGTKGKR-------YALPHARILMHQPIAIQA
3bezD           PGGSVTAVIRAELAAARAAGKPVVVSGGAASGGYWISTPANYIVANPSTLTGSIGIFGVRALPPEAQLQL
3bf0A           PGGSVTASEVIRAELAAAGKPVVVSMGGAASGGYWISTPANYIVANPSTLTGVITTVENSLDSIGVHTDG
2cbyD           PGGSISAGMAIYDTMVLAPCDIATYAMMAASMGEFLLAAGTKGKRY-------ALPHARILMHQPIAIQA
3bezA           PGGSVTAVIRAELAAARAAGKPVVVSGGAASGGYWISTPANYIVANPSTLTGSIGIFGVITTVENSLDSQ
3bezC           PGGSVTAVIRAELAAARAAGKPVVVSGGAASGGYWISTPANYIVANPSTLTGSIGIFGVITSITRALPPQ
3bppA           PGGRADAMMNIVQQSKIPVIIYVYPPGSAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAP
2cbyG           PGGSISAGMAIYDTMVLAPCDIATYAMMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIK
2cbyA           PGGSISAGMAIYDTMVLAPCDIATYAMGAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQ-----
3bf0C           PGGSVTASEVIRAELAAAGKPVVVSMGGAASGGYWISTPANYIVANPSTLTGSIGIFGVITTVELDSIGV
3bf0D           PGGSVTASEVIRAELAAAGKPVVVSMGMAASGGYWISTPANYIVANPSTLTGSIGIFGVITENSLDSIGV
3bf0B           PGGSVTASEVIRAELAAAGKPVVVSMGGAASGGYWISTPANYIVANPSTLTG------------------
2deoB           PGGRADANIVQRIQQSKIPVIIYVYPPGSAASAGTYIALGSHLIAAPGTSIGACRTNYFIA---------
1alqA           KSGKEVK---------------------------------------------------------------
2deoA           PGGADANIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAAPGTSIGAC----------------


                         +         .         .         .         .         *         .:210
query           KVISALKGKFRAVAEARGRPVELAEAMVDPNLEVPGLSAKGEPLTLSADKAVELKVADLKAASLYEALQA
2c8tA           EMF-------RLNAEFTGQPIERIEADSD------------RDRWFTAAEALEYGFVD------------
2cbyB           EQFAVIKKEMRLNAEFTGQPIERIEADSD------------RDRWFTAAEALEYGFVD------------
3bezD           SIENGYKRFITLVADARHSTPEQIDKIAQ-------------GHVWTGQDAKANGLVD------------
3bf0A           ----VSTSPLADVSITQLSIENGYKRFITLVADARHSTPEQQGHVWTGQDAKANGLVD-SLGDFDDAVAK
2cbyD           EQFAVIKKEMRLNAEFTGQPIERIEADSD------------RDRWFTAAEALEYGFVD------------
3bezA           LSIENGYKRFTLVADARHSTPEQIDKIA-------------QGHVWTGQDAKANGLVD------------
3bezC           LSIENGYKRFTLVADARHSTPEQIDKIA-------------QGHVWTGQDAKANGLVD------------
3bppA           AITNYFIAYIKSLAQESGRNATIAEEFITK------------DLSLTPEEALKYGVIEVVARDINELLKK
2cbyG           KE------MFRLNAEFTGQPIERIEADSD------------RDRWFTAAEALEYGFVD------------
2cbyA           -FAVIKKEMFRLNAEFTGQPIERIEADSD------------RDRWFTAAEALEYGFVD------------
3bf0C           HTDGVSTSPLADVSITRLSIENGYKRFITLVADARHSTPEQQGHVWTGQDAKANGLVDSLGDF-------
3bf0D           HTDGVSTSPLADVSITRLSIENGYKRFITLVADARHSTPEQQGHVWTGQDAKANGLVDSLGDF-------
3bf0B           ----------------------------------------------------------------------
2deoB           --------YIKSLAQESGRNATIAEEFITKD------------LSLTPEEALKYGVIEVVARDINELLKK
1alqA           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGFSPEVERLAPGPRVQVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c8tA           ----------------------------------------------------------------------
2cbyB           ----------------------------------------------------------------------
3bezD           ----------------------------------------------------------------------
3bf0A           AAELAKVKQ-------------------------------------------------------------
2cbyD           ----------------------------------------------------------------------
3bezA           ----------------------------------------------------------------------
3bezC           ----------------------------------------------------------------------
3bppA           S---------------------------------------------------------------------
2cbyG           ----------------------------------------------------------------------
2cbyA           ----------------------------------------------------------------------
3bf0C           ----------------------------------------------------------------------
3bf0D           ----------------------------------------------------------------------
3bf0B           ----------------------------------------------------------------------
2deoB           S--NGKTKIPVNGRYVTLN---------------------------------------------------
1alqA           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c8tA           ----------------------------------------------------------------------
2cbyB           ----------------------------------------------------------------------
3bezD           ----------------------------------------------------------------------
3bf0A           ----------------------------------------------------------------------
2cbyD           ----------------------------------------------------------------------
3bezA           ----------------------------------------------------------------------
3bezC           ----------------------------------------------------------------------
3bppA           ----------------------------------------------------------------------
2cbyG           ----------------------------------------------------------------------
2cbyA           ----------------------------------------------------------------------
3bf0C           ----------------------------------------------------------------------
3bf0D           ----------------------------------------------------------------------
3bf0B           ----------------------------------------------------------------------
2deoB           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c8tA           ----------------------------------------------------------------------
2cbyB           ----------------------------------------------------------------------
3bezD           ----------------------------------------------------------------------
3bf0A           ----------------------------------------------------------------------
2cbyD           ----------------------------------------------------------------------
3bezA           ----------------------------------------------------------------------
3bezC           ----------------------------------------------------------------------
3bppA           ----------------------------------------------------------------------
2cbyG           ----------------------------------------------------------------------
2cbyA           ----------------------------------------------------------------------
3bf0C           ----------------------------------------------------------------------
3bf0D           ----------------------------------------------------------------------
3bf0B           ----------------------------------------------------------------------
2deoB           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxx
2c8tA           -------------
2cbyB           -------------
3bezD           -------------
3bf0A           -------------
2cbyD           -------------
3bezA           -------------
3bezC           -------------
3bppA           -------------
2cbyG           -------------
2cbyA           -------------
3bf0C           -------------
3bf0D           -------------
3bf0B           -------------
2deoB           -------------
1alqA           -------------
2deoA           -------------