[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81141.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3csuA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2b6hA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1a2kD.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2c5mB.bssp"
#ERROR : Can't open dsspfile "2bsqH.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "1a2kE.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "1dxrH.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "2bsqE.bssp"
#ERROR : Can't open dsspfile "3ea5C.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "3e2iA.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "1as2A.bssp"
#ERROR : Can't open dsspfile "2cxxC.bssp"
#ERROR : Can't open dsspfile "1as0A.bssp"

## Summary of PDB Search
:244
    7e-52  31%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    8e-52  10%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-48  10%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-47  25%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-43  10%  3cmvG  [x.x.x] PROTEIN RECA
    7e-43  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    1e-42  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    3e-42  10%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    8e-42  13%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    5e-41  10%  3cmvC  [x.x.x] PROTEIN RECA
    3e-40   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-40  16%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-39  12%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-39  12%  3cmvH  [x.x.x] PROTEIN RECA
    3e-39  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    5e-39  13%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    8e-39   9%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-38  13%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    5e-38  13%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    6e-38  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    9e-38  10%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    2e-37  11%  2b8tA  [x.x.x] THYMIDINE KINASE
    4e-37  15%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    8e-37   9%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-36   9%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-36   7%  1aroP  [e.8.1] T7 RNA POLYMERASE
    8e-36  11%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-35   8%  2akaB  [x.x.x] DYNAMIN-1
    3e-35   7%  2axzC  [x.x.x] PRGX
    5e-35   8%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    9e-35  35%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-34  10%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-34  17%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-34  11%  3cmvA  [x.x.x] PROTEIN RECA
    8e-34  17%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-33  15%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-33   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    7e-33  12%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    7e-33   9%  2cgtH  [x.x.x] 60 KDA GROEL
    1e-32  11%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-32  28%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-32  26%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-32  12%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-32   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-32  12%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-32  13%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    4e-32  17%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-31  10%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-31  17%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-31  13%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-31  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-31   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    1e-30  49%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-30   8%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-30   7%  4dcgA  [x.x.x] VP39
    1e-30   8%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-30  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-30  11%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-30  10%  2cckA  [x.x.x] THYMIDYLATE KINASE
    3e-30  13%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    5e-30  23%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-30   8%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    7e-30  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-30  12%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    9e-30  10%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-29   8%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-29  13%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-29  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-29   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    5e-29  11%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    5e-29  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-29   7%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    7e-29   6%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    8e-29  12%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    1e-28   8%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-28  15%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    1e-28   9%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-28   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-28  11%  3cmxA  [x.x.x] PROTEIN RECA
    2e-28  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    3e-28  11%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-28  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-28  16%  3c8uA  [x.x.x] FRUCTOKINASE
    4e-28  28%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-28  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-28  20%  2d2eA  [x.x.x] SUFC PROTEIN
    6e-28  13%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    7e-28  13%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    7e-28  10%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    9e-28   6%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    9e-28  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-27  23%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-27  12%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    3e-27  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    4e-27  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-27  34%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    4e-27   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    4e-27   8%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    5e-27  12%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    5e-27  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-27  11%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-27  12%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    7e-27  11%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-27  21%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-27   8%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    9e-27  11%  1e0jA  [c.37.1] DNA HELICASE
    1e-26  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    1e-26   7%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-26   9%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-26   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-26  11%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-26   7%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    3e-26  23%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-26  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-26  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-26   7%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    7e-26  11%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-26  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    8e-26  15%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    9e-26   8%  3cmvE  [x.x.x] PROTEIN RECA
    1e-25   9%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25   9%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-25  13%  3cmtD  [x.x.x] PROTEIN RECA
    2e-25  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    3e-25  10%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-25  11%  2b8tC  [x.x.x] THYMIDINE KINASE
    3e-25  13%  2bdtA  [x.x.x] BH3686
    4e-25  13%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    5e-25   9%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    5e-25  11%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-25  12%  3da4A  [x.x.x] COLICIN-M
    9e-25  14%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    1e-24  15%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    1e-24  11%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    1e-24  12%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    1e-24  15%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    1e-24  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-24  12%  2bhvA  [x.x.x] COMB10
    2e-24  11%  2bhvD  [x.x.x] COMB10
    2e-24  11%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-24  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-24  38%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-24  21%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-24   7%  2ctsA  [x.x.x] CITRATE SYNTHASE
    3e-24  10%  2bx2L  [x.x.x] RIBONUCLEASE E
    4e-24  10%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-24  21%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-24  10%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    6e-24  11%  2cckB  [x.x.x] THYMIDYLATE KINASE
    6e-24   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    8e-24  13%  2a1fF  [x.x.x] URIDYLATE KINASE
    1e-23  15%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    1e-23  13%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    1e-23   8%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-23  10%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-23  15%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-23  12%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-23  11%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-23  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-23  11%  1e0jB  [c.37.1] DNA HELICASE
    4e-23   9%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-23   9%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-23   9%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-23  11%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-23   9%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-23   9%  3adkA  [x.x.x] ADENYLATE KINASE
    6e-23  11%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    8e-23  15%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    8e-23   7%  2c0bL  [x.x.x] RIBONUCLEASE E
    9e-23  13%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-22  12%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    1e-22   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    1e-22  13%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-22   8%  3dlbB  [x.x.x] ARGONAUTE
    1e-22  11%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-22  11%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-22   9%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-22  12%  3be4A  [x.x.x] ADENYLATE KINASE
    2e-22  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-22  27%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-22   9%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-22  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-22  10%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-22   9%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-22   5%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    3e-22  10%  3ec1A  [x.x.x] YQEH GTPASE
    3e-22   8%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    3e-22   9%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-22  13%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-22   7%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    4e-22  14%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-22   9%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    5e-22  13%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    6e-22  11%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-22   9%  1adoA  [c.1.10] ALDOLASE
    6e-22   7%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    7e-22   9%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-22  11%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-22  11%  1eamA  [c.66.1] PROTEIN (VP39)
    8e-22  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-22  11%  2anbA  [x.x.x] GUANYLATE KINASE
    9e-22   9%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-22  10%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-21   6%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-21   9%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-21  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-21  10%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    2e-21  10%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-21  11%  1e6cA  [c.37.1] SHIKIMATE KINASE
    2e-21  13%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-21   9%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    3e-21   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    3e-21   9%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-21   9%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-21  11%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-21  11%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    7e-21  16%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    7e-21   9%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    1e-20  10%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-20  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-20  11%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-20   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    1e-20  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    1e-20  13%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-20   4%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-20  11%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-20  12%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    2e-20  13%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    2e-20  11%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-20  12%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-20  11%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-20  16%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-20   9%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-20   7%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    6e-20  13%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    7e-20   7%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-20   9%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-19  16%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    1e-19  12%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-19  10%  3cmvB  [x.x.x] PROTEIN RECA
    1e-19  17%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-19  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    2e-19  11%  3cmwC  [x.x.x] PROTEIN RECA
    2e-19  11%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-19  11%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-19  14%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    3e-19  10%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-19   9%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    5e-19  13%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    5e-19  13%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    5e-19   9%  2c9oC  [x.x.x] RUVB-LIKE 1
    6e-19  11%  2an9A  [x.x.x] GUANYLATE KINASE
    8e-19  10%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    1e-18   8%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-18   8%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-18   9%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    1e-18  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-18  14%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-18  14%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-18   5%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    2e-18  14%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-18  10%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  17%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-18  16%  3a00A  [x.x.x] GUANYLATE KINASE
    2e-18  13%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    3e-18   9%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-18  12%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-18  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-18  11%  2ancB  [x.x.x] GUANYLATE KINASE
    4e-18  11%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    5e-18   8%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    5e-18   7%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    5e-18   4%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    5e-18   9%  3bczC  [x.x.x] PROTEIN MEMO1
    6e-18  10%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    7e-18  11%  3cmuA  [x.x.x] PROTEIN RECA
    7e-18  18%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    8e-18  10%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-18  10%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-17   9%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-17  12%  3bm2B  [x.x.x] PROTEIN YDJA
    3e-17  14%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-17  12%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    4e-17  16%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    5e-17  15%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    8e-17  16%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-17   7%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    8e-17  15%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-16  13%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-16  10%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-16  11%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-16   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-16  13%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-16  14%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    3e-16  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    3e-16   8%  1e2hB  [c.37.1] THYMIDINE KINASE
    3e-16  11%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    5e-16  22%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    5e-16  16%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    5e-16   8%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    6e-16  14%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    9e-16  10%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    1e-15   9%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-15  17%  1chdA  [x.x.x] CHEB METHYLESTERASE
    3e-15  14%  2dftC  [x.x.x] SHIKIMATE KINASE
    6e-15  14%  2dftA  [x.x.x] SHIKIMATE KINASE
    8e-15  10%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-15  11%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-14  12%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-14  17%  3a00B  [x.x.x] GUANYLATE KINASE
    2e-14  11%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    3e-14  11%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    3e-14  14%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    5e-14  10%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-14   5%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    6e-14  15%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-14  12%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    9e-14  14%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-13   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-13  10%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-13  17%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-13  19%  2c5mD  [x.x.x] CTP SYNTHASE
    3e-13  11%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-13  13%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    7e-13  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12   7%  3dfdA  [x.x.x] PROTEIN YQBN
    2e-12  16%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12  15%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12  11%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-12  18%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    4e-12  14%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    4e-12   7%  2c9gA  [x.x.x] PENTON PROTEIN
    4e-12  10%  1e2nA  [c.37.1] THYMIDINE KINASE
    5e-12   7%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    5e-12  11%  2cdnA  [x.x.x] ADENYLATE KINASE
    5e-12   9%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    6e-12  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    8e-12  21%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    8e-12  12%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    9e-12  15%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-11  14%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-11  15%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    2e-11  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-11  14%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-11  14%  3dkvA  [x.x.x] ADENYLATE KINASE
    6e-11  14%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    7e-11  19%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-11  11%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    9e-11  13%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-10   9%  2bhvC  [x.x.x] COMB10
    1e-10   5%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    2e-10   6%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-10  20%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-10  11%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    6e-10  10%  1e2lA  [c.37.1] THYMIDINE KINASE
    7e-10  10%  1e2jA  [c.37.1] THYMIDINE KINASE
    8e-10   9%  3csuA  [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
    1e-09  10%  1e2mB  [c.37.1] THYMIDINE KINASE
    1e-09   9%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-09  10%  2b6hA  [x.x.x] ADP-RIBOSYLATION FACTOR 5
    3e-09  16%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-09  11%  1a2kD  [c.37.1] RAN
    3e-08  13%  2c9oA  [x.x.x] RUVB-LIKE 1
    3e-08  13%  1e2kB  [c.37.1] THYMIDINE KINASE
    3e-08  11%  1e2mA  [c.37.1] THYMIDINE KINASE
    5e-08  22%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    5e-08  12%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  24%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    2e-07  13%  2c95B  [x.x.x] ADENYLATE KINASE 1
    2e-07  14%  1e2jB  [c.37.1] THYMIDINE KINASE
    7e-07  12%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-06   6%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-06  13%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    4e-06   8%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    6e-06   9%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    1e-05  24%  2c5mB  [x.x.x] CTP SYNTHASE
    1e-05   4%  2bsqH  [x.x.x] TRAFFICKING PROTEIN A
    2e-05  11%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
    4e-05  16%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-05  14%  2c9oB  [x.x.x] RUVB-LIKE 1
    4e-05  12%  1a2kE  [c.37.1] RAN
    6e-05  25%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    6e-05  11%  1dxrH  [f.23.10 - b.41.1] PHOTOSYNTHETIC REACTION CENTER H SUBUNIT
    8e-05  13%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    8e-05   6%  2bsqE  [x.x.x] TRAFFICKING PROTEIN A
    2e-04  13%  3ea5C  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    2e-04  42%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    2e-04  21%  3e2iA  [x.x.x] THYMIDINE KINASE
    3e-04  20%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-04  10%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-04  47%  1as2A  [x.x.x] GIA1
    5e-04  42%  2cxxC  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    8e-04  35%  1as0A  [x.x.x] GIA1
:244

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKD
3b5jA           --HDITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLAL
3dmdC           EEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIA------
3dmdB           EEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
2d3wB           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVKGKDLLA
3cmvG           RLGEDRSMDVETISTGSLSLALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
3b60A           -TGDLEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGLREYT
1d1cA           FKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQLQ
2dwoA           -LTQSRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR
2ccjB           ------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTRE---PG
3cmvC           -LGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
3eiuA           AMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
2c03B           ----VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2dwpA           ------------------RVQKIWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR
3cmvH           ----DRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID---AE
2ccgA           ------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTRE---PG
3c95A           LAWHPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLD
3eiuB           AMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
3dm5A           ---HIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
2ccgB           -----------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVP
1e69A           ----MRLKKLY--LKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPP
1bifA           -----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYR
2b8tA           -----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDT
2dr3A           -------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHP
2c61B           AMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
2czvA           ------------------GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAI
1aroP           ----------------------------------------------------------------------
2bifA           --------------------------------IVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYR
2akaB           ------MEDLIPLVNRLQAFSAIGQADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVL
2axzC           ----------------------------------------------------------------------
1e9cA           ----------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS
2awnC           -----------VQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG------------------
2b8wA           -GPMCLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGI
2bbsA           -TTEVVMENVFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS------
3cmvA           ------VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
2c03A           ----VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2cjwB           ----------------------------TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATI
2c9yA           -----------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVA
2a2zD           -----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNV
2cgtH           VVLDKSFGAPTITKDGVSVAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVA
3b2qB           AMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
2awnB           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2d62A           IGAEVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADP
1e9sG           IVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
1e3mA           ---------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRH
2bjbA           LDALQTLGLRVDGVGSELTVSGRIEPGPGAR--VDCGLAG----TVLRFVPPLAALGSVPVTFDGDQARP
1cr4A           -EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL---AML
2awnD           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE-KRMN
3b2qA           AMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
2c04A           -PAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA---AD
2d4uB           -------------------------------------------NALKNCKENFTVLQTIRQQQSTLNGSW
1e9sF           IVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
2a5gA           -----------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVT
1b0uA           ---KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINL
2b92B           -GPMCLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGI
4dcgA           -----------------------------ILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRH
1e98A           ----------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS
2akaA           -KGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLE
3dt2A           -CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKF
2cckA           ------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVP
2dr3E           -------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHP
2bbsB           ------TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI---------
1e9fA           ----------------------------RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERS
1e9rA           IVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
3clvA           ------------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGALNDNY
2d4hB           -GPMCLIENTNGRLMALKILSAITQ---PMVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLGQND
1e3mB           --------------------------------------------DVLVNLAERAYTLNYTCPKPGIRITE
3czpB           LDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEE
2bbtB           -GFGELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG-----------
1e9dA           ----------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS
2a30B           -----------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNV
2awoC           -----------VQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
3bpbA           ----IIARTPARSLVDGSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDEFVEDPVLCTSRCAIITR
2bkhA           YQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVE
2a30D           -----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPECNVQSTNV
3bh0A           -EIESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGK
1cr1A           -EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---ML
2c61A           AMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
3a1wA           -------------------------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEG
3cmxA           --------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
4atjA           --------------------------------------------NIVRDTIVNELRSDPRIAASILRLHF
1dhjA           ----------------------------------------------------------------------
1e9sJ           IVSGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
3c8uA           -----------LAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFHL
2awoA           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2bc9A           -GPMCLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGI
2d2eA           ---QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENI
3bo6B           --NFHSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGD
2d4uA           ----------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSW
3d7wA           ----DYVSSGSFSNNI-PLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQ-----
1ai4B           --------------------QALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRKVYNPQSGYIANWNNS
1e9sD           IVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
2d3wD           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDL
2a2zB           -----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNV
1bg0A           -----SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPK
1e2dA           ----------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLR---FP
3d31A           ---MIEIESLSRKWKN-FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTD
2ck3C           APGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCI
1dkiA           VKSLLDSKGIHYNQGNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSN
1e59A           -------------------VTKLVL-VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSF
3bb1C           -RGWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISSEGPRPVMVSR
3bb1E           -RGWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVM
2dr3B           -------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA-LEEH
2d0kA           ----------------------------------------------------------------------
2d3wC           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVKGKDLLA
2axpA           --------------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSG
1e0jA           --REHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---ML
421pA           ----------------------------TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDVVIDG
3bgwA           EEIESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGK
2b8tB           -----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFK----P
1e3aB           AWTHQMKAKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLP
3bb1F           -RGWSGINTFAPATQLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVM
2bhjA           ---------------------------------------------------RIKNWGSGEILHDTLHHKA
2d3wA           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKAL
3bb1B           ---WSGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRMVSR
1e4yA           -------------------------------RIILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVK
2bkiA           TIKSYQGKSLGTMFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVE
3dt4A           -CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKF
3d3kA           ------------------LSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTLLCGPHVKGAQGISC
2a5jA           -------------------------------KYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNID
3cmvE           ---EDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
2d4hA           -GPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMW
3cddC           --------------------------------LKAGGKIYQGWTKIGITRSLEASGFQYKAFIEPIKQGQ
3cmtD           --------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
3b85A           -------------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTPAVEA
3dtbB           ---ASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKF
2b8tC           -----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDS
2bdtA           ------------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVG
2dr3C           -------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA-LEEH
2c7cH           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
3da4A           -RNLVLHPGISVYDAYHF---AKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGL
1cr2A           -EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---ML
1cr0A           -EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEES
3dauA           ----------------------------------------------------------------------
2a30A           -----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPNVQSTNV
1cfrA           ----------------------------------IISKSGEGNKYTINSASGLRDFINDEAIRLGGKISD
3crmA           ---------------------------SLPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGM
2bhvA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dekB           --------------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPI-----
1e9rD           IVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
3dhwC           ---MIKLSNITKVFHQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELLS
2d2fA           ---QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENI
2ctsA           -----------SSTNLKDILADLIPKEQAKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPEG
2bx2L           ---------------------------------------------------------------------W
3dt7A           -CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKF
2bbtA           --WEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFC
3cddF           ---VDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEQ
2cckB           --------------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGPT
1bglA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bwjA           ---------------------GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS--TGELLREE
3bgwD           EEIESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGK
1dg3A           -GPMCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKP
3czpA           LDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEE
3bb1G           -RGWSGINTFAPATKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRVSR
1e9rE           IVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
3cddD           ----------------LKAGGKIYQGWTKIGITRSLEASGAFDLETYK----FNDAQYKAFIEPIKQGQA
1e0jB           -EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---ML
3dfqA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bb1A           -RGWSGINTFAPATKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVM
3dfpC           ----------------------------------------------------------------------
3adkA           ----------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVS
3bjdB           -------------------------------------------NTRNFSLPQLQNLPIEEARIVADALAV
2dr3F           -------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA-LEEH
2c0bL           -----FISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRL-KHWE
3cr7C           ----------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNI
3ecpA           ----------------------------------------------------------------------
2c4rL           -----------------AGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAI
2a1fD           ----------------------------------------------------------------------
3dlbB           ------------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYR
2aumA           ----------------------------------------------------------------------
1e9sB           ---GGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
1accA           ----WSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEAKIAFGFNEGNLQYQGKDI--
3be4A           --------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIK
1draA           ----------------------------------------------------------------------
2awnA           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
1ak2A           -----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVA
2b8wB           -GPMCLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGI
1aldA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3ec1A           LCPVDVCLVSAAKGIGMAKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTT
2dflA           EVKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGG--------
1e2gA           ----------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLR----F
3cm0A           -----------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVA
2a2zA           -----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNV
1d6jB           -------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHALDGDNIRF
1bmfC           APGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK-KLYC
2dr3D           -------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHP
3dm9B           ---AVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTIE
1adoA           ----------------------------------------------------------------------
2bofX           ------------------------------------------------------NPNMSSAEWVRNNPND
3dfnC           ----------------------------------------------------------------------
3dt4C           -CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKF
1eamA           --------------GELFFLSKLQRH--GILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRH
2drcA           ----------------------------------------------------------------------
2anbA           ---------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQP
3dfnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2eg5G           -NSAYNQLVLAKVKCVRELLRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDLFP
3dfqD           ----------------------------------------------------------------------
3bk7A           ERETLVEYPRLVKDYGSFKLEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD------
2aunA           ----------------------------------------------------------------------
1e2kA           ----------------------------TLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYW---RV
1e6cA           ------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSG
1akeA           -------------------------------RIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVK
1e2fA           ----------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS
1cjaA           ----------IDKSFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVRL
3dfqC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3d3qB           -----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDI
1eilA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1e9sM           --SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVI---VDPN
3cr7A           -----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDFG
4dfrA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3cr7D           ----------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNI
3czjA           ----------------------------------------------------------------------
3cphA           -------------------------------KILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGITVDIN
3b9qA           GSEIKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFR
2cvfA           -------------TGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPE
2dpyB           PFNPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGRE
2aumB           ----------------------------------------------------------------------
1e9rF           ---GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
2ausC           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3cbnA           ---------------------------------------------------------RYTLRARGHPN--
2bv7A           ----------------FDCLGSPVFTPIKADISGNIDTNPTKFRTLQNILEVEKEMYGAEW---------
1e9sE           ---GGKLKRMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
1e4vA           -------------------------------RIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVK
1ek0A           ----------------------------TSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQ
5dfrA           ----------------------------------------------------------------------
3cmvB           RLGEDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT---CAFIDAE
1cjtC           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLK
3ch4B           ----------------------APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKE
3cmwC           ------VETISTGSLSLDIALG-AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
1e9sI           IVSGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
1drbA           ----------------------------------------------------------------------
3cueF           -------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELD
3bv4A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2c9oC           -----------------VIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYS
2an9A           ---------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQP
2ahwD           ------VKPPRINGVPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADKYKQTQGLGDRADRGISPL
3bs4A           --------------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPL
1e9rG           IVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
1av6A           ----PESANEVAKKGQLKLLLGSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWML---ID
2b8tD           -----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSIR
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cnlA           ---KQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKIL
1e9sH           ---GGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
1cs4C           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLK
3a00A           --------------------------------IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPR
2ccjA           ------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYD---------VI
3di4A           ----------------VPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHN-----LHDLTERFFSGKTRA
1e2iA           --------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIATQH
3d3qA           -----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDI
2ancB           ---------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQP
2dpyA           PFNPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGRE
3cioD           ---------------LRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIRGYSHN
1e1qB           APGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY-C
1dp0A           ----------------------------------------------------------------------
3bczC           ------------------------SHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCG
2bkeA           ALEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYI
3cmuA           ------VETISTGSLSLDIALG-AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
3bjqB           ----------------------------------------------------------------------
3bb1H           ---WSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVM
2ancD           -----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQP
1dekA           ----------------------------------LSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALA
3bm2B           ----------------------------------------------------------------------
2ancF           ---------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEGVDVFL
3bwdD           -----------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAG
3cbqA           -------------------------------KVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEERRIM
3dvlD           ----------------------SHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEET
2awoD           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEAERGV
2ahvA           ------VKPPRINGVPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADKYKSPTGLGDRADRGISPL
1culC           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLK
2a1fC           ----------------------------------------------------------------------
1e9sL           ---GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
2d7vA           --FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTL----Q
2czvB           --------------MDIRDKEAYELAKEWFDEVVVSKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVR
3dm5B           ---HIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
2a78A           -------------------------------KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKK
1d6jA           -------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNI
1e2hB           --------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR
2d7vB           --FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTL----Q
2cbzA           ---SITVRNATFTWARPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYV
2e85B           ----------------------------------------------------------------------
1dw9A           ----QINRNIRLDLA----DAILLSKAKKDLSFAEIDGTGLAEAFVTAALLGQQALPADAARLVGAKLDL
2a5vA           ------VRTAGHVIDS-AVLGSIEVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---------
3brwA           ---KLECNPTARIFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRT-------------
1dvrA           ---------------------------SESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIA
1chdA           ----------------------------------------------------------------------
2dftC           -------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTG
2dftA           -------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTG
3e70C           -AVKEAVSEILETSRR-IDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
3ed8A           ---RIELKGTDF-KEDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQN
3cr7B           -----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNI
3a00B           ------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPR
1ckvA           ----AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKI-
2a5vB           ----------------------YAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---------
1c9kC           --------------------------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKD
3dmdA           EEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
2b0lC           ----------------------------------------------------------------------
2bboA           --TEVVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFC
2aexA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1afrA           ---------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPD-----
3bb1D           -RGWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEG---PR
1cjuC           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD---IK
2c5mD           ----------------------------------------------------------------------
1e2nB           ----------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR
2a5fA           -------------------------------RILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVT
3c15C           ----------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD---IK
3dfdA           ----IDAEEVEVPISKRFVDKEFIFKAITTDRIDELEKENTTKELDSQRFYARIAVETTVY--------P
3c14C           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD---IK
3e8aC           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNL
1e9sA           ---GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
3do6A           KDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLR-----
1agpA           -------------------------------KLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQ
2c9gA           KARVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVL-----------
1e2nA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR
2dx7A           MKTIGIL-------GGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYILGKGEDPRPQL
2cdnA           ---------------------------GSHMRVLLLGPPGAGKGTQAVKLAEKLGIP--QISTGELFRRN
1d6aA           ----KSRSQVQLGIQIIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQ-VKTNFNRAFNPNPKV
1e2iB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM----
3ci2A           ----------------------------------------------------------------------
3c7kC           -------------------------------KLLLLGAGESGKSTIVKQMKIIHEDGF------------
1e2lB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYW-
3cnnA           FFKKQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILD
1ckeA           ---------------------------AIAPVITIDGPSGAGKGTLCKAMAEWHLLDSGAILHHHVDVAS
3c85A           ---------------------------------------------------QLINPGHAQVLILGGRIGA
3c7kA           -------------------------------KLLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSQS
3dkvA           -------------------------------NIVLMGLPGAGKGTQAERIVEKYGI--PHISTGDMFRAA
1azsC           --------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNL
1dwmA           ----------------------------------------------------------------------
3cqcA           -EALKQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHET----------
1e9rB           ----GKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
2bhvC           ----------------------------------------------------------------------
3cd9A           ----IELKGIDFKEDGLGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPI-
1d2zD           -LNFPAEIKKGFKYTAVFQIDEAANRLPPDQSKSKTSGKLNERPTVGVLLQLLVQAEAADFVALDFLNEP
1d8jA           ----------------------------------------------------------------------
3b85B           ------------------GQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVE
1e2lA           --------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASET
1e2jA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGAS
3csuA           -------------------------------------------PLYQKHIISINDLSRDDLNLVLATAAK
1e2mB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVMTYWRVLG
2axnA           -LTQSRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKL------------------TR
2b6hA           -------------------------------RILMVGLDAAGKTTILKLKLGEIVTTIPTIGFNVETVEY
1cjvC           -----------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKE
1a2kD           -------------------------------KLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL
2c9oA           --AKQAASGLVGQENAGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYS
1e2kB           ----------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR
1e2mA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRD-DIVYVPEPMTYWRVLGA
2bwjB           ------------------------EDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS--TGELLREE
1e9sK           ----GKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM
2bwjD           --------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---GELLRE
2c95B           ------------------------EKLKKTNIIFVVGGPGSGKGTQCEKIV--QKYGYTHLSTGDLLRSE
1e2jB           --------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR
1e2hA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWR----V
3cddE           --------------------------KIYQGWTKIGITRSLEASGAFDLEYKFLGNDAYKAFIEPIKQGQ
1e6vC           ----------------------------------------------------------------------
3cddB           ----------------LKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACT
3cr8B           ----------------------------------------------------------------------
2c5mB           ----------------------------------------------------------------------
2bsqH           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
3dsrB           ----------------------GTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM
2c9oB           ----------------GVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYS
1a2kE           -------------------------------KLVLVGDGGTGKTTFVKRHEFEKKYVATLGVEVHPLVFH
2bwjF           -------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---------
1dxrH           ----------------------------------------------------------------------
1dapA           --------EVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDR----------------
2bsqE           ----------------------------------------------------------------------
3ea5C           -------------------------------KLVLVGDGGTGKTTFVKRHEFEKKYVATLGVEVHPLVFH
2cxxA           -------------------------------TIIFAGRSNVGKSTLIYRL--------------------
3e2iA           -------------------------------WIECITGSFSGKSELIRRLRRGIYAKQK-VVVFKPASHN
1delA           ----------------------------------LSGVKRSGKDTTAD---FIMSNYSAVKYQLAGPIKD
3cddA           --EEIVLKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACTVDIGGITGYV
1as2A           -------------------------------KLLLLGAVESGKSTIVK----------------------
2cxxC           -------------------------------TIIFAGRSNVGKSTLIYRL--------------------
1as0A           -------------------------------KLLLLGAVESGKSTIVKQMKIIH----------------


                         .         .         *         .         .         .         .:140
query           DRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLS
3b5jA           ANWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLS
3dmdC           ------------ASDTFRAGAIEQLEEHAKRI-GVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTA
3dmdB           AGAIQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQ--------------------HAKARGIDVVLIDTA
2d3wB           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGFQDLMEEKIALLKMPEDLLTRSVNVGFS
3cmvG           DPIYARKLG---VDIDNLLCSQPDTGEQALEICDALAR--SGAVDVIVVDSVAALTPKAEIEGLAARMMS
3b60A           LASLRNQVALVSQNVHLFNDTVANIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLS
1d1cA           ANPILEAFGNAKTTRNNNSSRFGKFIEIQ--FNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLL
2dwoA           REA--VKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKS----------------YLAKEGGQIAVFDAT
2ccjB           GVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGK-------VVLCDRYIDSSLAYQG
3cmvC           ---DPIYARKLGVDIDNLLCSQPDTGEQALEICDALAR--SGAVDVIVVDSVAALTPKAEIEGLAARMMS
3eiuA           GITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVK
2c03B           PAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE-------------------EKARLEARDLILVDTA
2dwpA           REA--VKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSY----------------LAKEGGQIAVFDAT
3cmvH           HALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTIEGEIGDSHMGLAARM
2ccgA           GVPTGEEIRKIVLEGNDMDIRTEAMLF-------AASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQG
3c95A           NLKFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALD---ITFVDKRIEKLLFNYRARNFPGTLD
3eiuB           GITNEEAQYFMSDFEKTGALERAVVFLNLADDPADITNYAEALRQMGAAGYPGYMYTDLATLYERAGIVK
3dm5A           PGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKS-------------------KGVDIIIVDTA
2ccgB           TG-----EEIRKIVLEGNDMDIRTEAMLF-----AASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQG
1e69A           AKDIRDRFAGTGLGVDFYSIVGIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLS
1bifA           RD--MVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKF----------------LSEEGGHVAVFDAT
2b8tA           RS-IRNIQSRTGTSLPSVEVESAPEILNYIMSNSVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPF
2dr3A           VQV-RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYI----------------------VHDLTD
2c61B           GITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTNYAEALRQMGYPGYMYTDLATLYERAGIVK
2czvA           LLSVQKFKSYLIYVESNDLRVIRYSIEKGVDAIIPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSN
1aroP           ------------------------NDFSDIELAAIPFNTLADHYGERLARE---QLALEESYEMGEARFR
2bifA           RD--MVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRK----------------FLSEEGGHVAVFDAT
2akaB           QLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPP
2axzC           IEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEV
1e9cA           TEI----GKLLSSYLQKKSDVEDHSVHLLFSA-NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKEN
2awnC           --------LGVGMVFQSYALYPHLSVAENMSF-GLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2b8wA           WCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFP
2bbsA           -----------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLS
3cmvA           ---DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA------------VDVIVVD----------
2c03A           PAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARL-------------------EARDLILVDTA
2cjwB           IL--LDMWENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVS
2c9yA           SG--SELGKKLKATMDAGKLVSDEMVVELIEKPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIE
2a2zD           QQMMYEKPERWSFTFQTYACLSRIRAQLASLN-EKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
2cgtH           AGMVPCSDSKAIAQVGTISANSDETVGKLIAE-AMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLS
3b2qB           GIT-NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERNYAEALRQMGRGYPGYMYTDLATLYERAGIVK
2awnB           TPPAERGVGMVFQSYALYPHLSVAENMSF----GLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2d62A           EKGVFVPPKERDVAVFQSYALYPHTVYDN--IAFPLKLRKVPKQEIDKRVREVAELGLTELLNRKPRELS
1e9sG           GDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL--------------------SVVPRGKT
1e3mA           P--VVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYV-PAQKVEIGPIDRIFTR
2bjbA           IAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASAS------------SQFVSGLLLSAAS--F
1cr4A           EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE-----------LFGNDTFHLYDSFAEAE
2awnD           DTPPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD
3b2qA           GIT-NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNY
2c04A           TQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEK----------------ARLEARDLILVDTA
2d4uB           VALLQTNRAGIRYMMDQNNIGSGSTVAELMESASLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYH
1e9sF           ---LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA--------------------LSVVPRGKT
2a5gA           YKKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDRDRIDEARQELHRIINDREMRDAIILIFANKQDLPD
1b0uA           VRDKDGQLKVLTMVFQHFNLWSHMTVLENVMEAPQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLS
2b92B           WMWILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVNSIGTINQQAMDQLYYVTELTHRIRSKSSFV
4dcgA           HDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFYIP
1e98A           TE-----IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKEN
2akaA           QQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISQSYLLEKSRVVFQSETERNYHIFYQLLA
3dt2A           DA--QGNLRAINPENGFFGVAPGTSVKTNPNKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWK
2cckA           TGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALK----------------EGKVVLCDRYIDSSL
2dr3E           VQ-VRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEK----------------------YIVHDLTD
2bbsB           ------KHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLS
1e9fA           TEI----GKLLSSYLQKKSDVEDHSVHLLFSA-NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKEN
1e9rA           ---LSKFGRDKDIILNPYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAK
3clvA           NENLCNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILVANK
2d4hB           SWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTLTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEAD
1e3mB           GRPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRV
3czpB           ERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYVKFWLAID
2bbtB           -----KIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLS
1e9dA           ----TEIGKLLSSYLQKKSDVEDHSVHLLFSA-NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKEN
2a30B           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNDAEPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
2awoC           TP--------PAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
3bpbA           PGAESRRGETEIIEETVQRFYPGKVERIEAPGTVEAGDIMMVGDHF--------YIGESARTNAEGARQM
2bkhA           AN-----PLLEAFGNAKTVRNNNSSRFGKFVNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCA
2a30D           LQMMYEKPERWSFTFQTYACLSRIRAQLASLN-GKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
3bh0A           KENIKRLIVTAGSINAQKIKAARRDF-------ASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKT
1cr1A           EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF-------------DELFGNDTFHLYDSFAE
2c61A           GIT-NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNY
3a1wA           VYKGYTINLIDLPGTYSLGYSSIDEKIARD-YLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILA
3cmxA           DPI---YARKLGVDIDNLLCSQPDTGEQALEICDALARKAEARMMSQAMRKLAGNLKQSNTLLIFINQIR
4atjA           EDCFVNGCDASILLDNTTSFRTEKDAFGNANSAGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLA
1dhjA           --------------------------MISLIAALAVDRVIGMENAMPWNLP---ASLAWFKRNTLDKPVI
1e9sJ           GDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY--------------------ALSVVPRGKT
3c8uA           DN----------RLLEPRGLLPRKGAPETFDFEG-FQRLCHALKHQERVIYP-----LFDRARDIAI---
2awoA           TPP----AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2bc9A           WMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFAL----------------AVLLSSTFVYNSIG
2d2eA           LELSPDERARKLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLN
3bo6B           KFHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSASSL
2d4uA           VALLQLNRAGIRYMMDQNNIGSGSTVAELMESISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYH
3d7wA           ------SYFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERY------AGHRDQIPLGIDQLIQSVTALR
1ai4B           PQKDYPASDLFAFLWGGADRVTEID--RLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLT
1e9sD           ---LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL--------------------SVVPRGKT
2d3wD           LALSPEDRAGEGIFMQYPVEIPGVSNQFFLQTALQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFS
2a2zB           QSTNVLQMMRWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
1bg0A           QW-----GDINTLVGLDPAGQFIISTRVRCYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYYPLGMS
1e2dA           ERSTEIGKLLSSYLQKKSDVEDHSVHLLFS-ANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
3d31A           LSPE---KHDIAFVYQNYSLFPHMNVKKN----LEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLS
2ck3C           YV-AIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQ-------------------------YLA
1dkiA           NP----YFNHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVG---ISVDMDYGPSSGSAG
1e59A           DFAYTSVLKRVLDELDQAWLPVEKSWKLNERH-YGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTK
3bb1C           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKG
3bb1E           VS--RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYDKLVAKAITDSFGKG
2dr3B           PVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEKYIVHD-------------------------LTD
2d0kA           -------------------ISLIAALAVDRVIGNENALPW-----------NLPADLAWFKRNTLNKPVI
2d3wC           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFS
2axpA           NEKHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPRVRGDEYIE
1e0jA           EESVEETAEDLIGLHNRVRLRQSDSLKREI----IENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAK
421pA           ETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKC
3bgwA           KENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEI-------------SNSNINIFDKAGQSVN
2b8tB           KILPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPF
1e3aB           FEMNPKVYNPQSGYIANWNNSPQKDIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLT
3bb1F           VS--RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYDKLVAKAITDSFGKG
2bhjA           TSCLIMNPKSLTRGPRDKPTPLEELLPHAIEFIYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDELI
2d3wA           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLTRSVNVGFS
3bb1B           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKG
1e4yA           SG--SELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCR---------------------NGFLLDGFP
2bkiA           AN-----PLLEAFGNAKTVRNNNSSRFGKFVEIKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCA
3dt4A           DA--QGNLRAINPENGFFGVAPGTSVKTNPNAIKTKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWK
3d3kA           GRHLANHDVQVILFLPNFVKMLESITNEL---SLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR
2a5jA           GKQLQIWDTAGQESFRSITRSYYRGAAGAL-LVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSD
3cmvE           ---DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARS--GAVDVIVVDSVAALTPKAEIEGLAARMMS
2d4hA           CVPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTSIGTINQQAMDQLYYVTELTHRIRSKSSP
3cddC           AC-TVDIGGERVITGYVDDWVPSYDESTITISVSGRDGQFNNQTLTQIADIVCKPFGIKVIVPFQRIQIE
3cmtD           ---DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARLTPKAEMGLAARMMSQAMRKLAGLLIFINQIR
3b85A           GEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTR
3dtbB           DAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWK
2b8tC           RTGTSLPSVEVESAPEILNYIMSNSFNDETKIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPF
2bdtA           GYRPPWESKNITDLTVNFLLAQNDVVLDYIAF-PDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDA
2dr3C           PVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYI-----------------------VHDLTD
2c7cH           --------SKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQD-ELDVVEGMQFDRGYLS
1dhiA           -------------------ISLIAALAVDRVIGMENAMPW-----------NLPASLAWFKRNTLDKPVI
3da4A           KQIKDIIKSGVVGTFPVSTKFTHATGDYNVITSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFS
1cr2A           EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE------------LFGNDTFHLYDSFEAE
1cr0A           VEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFG----------------NDTFHLYDSFAE
3dauA           -------------------ISLIAALAVDRVIGMENAMPW-----------NLPADLAWFKRNTLNKPVI
2a30A           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
1cfrA           GSFCNGDWYEWLIGIRAIEFFTNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNN-----VNLIT
3crmA           DIGTAKPSR-ELLARYPHRLIDIRDPAESYSAAEFRA----DALAAMAKATARGRIPLLVGGTMLYYKAL
2bhvA           -----------LRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNK
2bhvD           ----------LLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNK
1dekB           -------KDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLT---------KLEVITIMEQAFCYLN
1e9rD           GDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL--------------------SVVPRGKT
3dhwC           ESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTP-KDEVKRRVTELLSLVGLGDKHDSYPSNLS
2d2fA           LSPDERARKGLFLAFQYPVEVPGVTIANFLRLKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFS
2ctsA           IRFRGYSIPECQKMLPKAKGGEEPLPEGLFVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLH
2bx2L           EAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKYTGEIP
3dt7A           DAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWK
2bbtA           SQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEK---------------DNIVLGGITLS
3cddF           IEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKA
2cckB           GEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKDRYIDSSLAYQGYARGIGVEEVRALNEF
1bglA           --------------------------------------------------------------------VS
2a1fF           ---------------------------------------------------------------------S
2boeX           ----------------PFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQ---GTWF---AHHNPGQIT
2bwjA           LASESERSKLIRDIMERGDLVPSGIVLELLEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVIC
3bgwD           KENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEIS-------NSNINIFDKAGQSVNYIWSKT
1dg3A           GH-ILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNINQQAMDQLYYVTELTHRIRSKSDSADFV
3czpA           ERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYVKFWLAID
3bb1G           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKG
1e9rE           LSKFGRDKD---IILNPYDQRTKGWSFFNEIRNDYDWQRYAL--------------------SVVPRGKT
3cddD           CT--VDIGGERVITGYVDDWVPSYDESTITISVSGRDGQFNNQTLTQIADIVCKPFGIKVIVNFQRIQIE
1e0jB           EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE----LFGNDTFHLYDSFAEAETDRLLAK
3dfqA           --------------------------------------------------------------HSHPALTP
3dfoD           --------------------------------------------------------------HSHPALTP
3dfpD           --------------------------------------------------------------HSHPALTP
3bb1A           ---VSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAFGKG
3dfpC           --------------------------------------------------------------HSHPALTP
3adkA           SGSARGKMLSEIMEKGQLVPLETVLDMLRDAM-VAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLY
3bjdB           HATSRQIDSAASKLAQAYAAYQQLLYVLSLSDDVATAQTR----------RWLARAIYRVEERFPAADLS
2dr3F           PVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEK--------------------YIVHDLTD
2c0bL           AIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIILIDNPKVLELARQHIAALGRPDFSSKIKLYTGEIP
3cr7C           RFGLNGFSEADRNENIRRIAEVAKLFADSNSI-AITSFISPYRKDRDTARQLHEVTGLRDPKGLYKKARE
3ecpA           ---LHRAADWAKSVFSSAALGPRRTARLVNAKYSGKSITISSEGSKAAQEGAYRFIRNPN--VSAEAIRK
2c4rL           KKAAE--SRPAPFLIHQESNVIVRAFRDYLRQ-DIGEILIDNPKVLELARQHIAALGRPSKIKLYTGEIP
2a1fD           ----------------------------------------------------------------------
3dlbB           ILCEMSLEAWL-AQGHPLPKRVRNAYDRRTWELLRLGEEDPKEL----------PLPGGLSLLDYHASKG
2aumA           ----------------DQTWQPIDGRVALIAPASA-IATEVLEATLRQLEVHGVDYHLGRHVEARYRYLA
1e9sB           GDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL-LRETAK
1accA           --------------TEFDFNF-DQQTSQNIKNQLAELNATNIYTVLD-------KIKLNAILIRDKRFHY
3be4A           NGIGLEAKSIIESGNFVGDEIVLGLVKEKFD-LGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVI
1draA           -------------------ISLIAALAVDRVIGMENAMPW-----------NLPAELAWFKRNTLDKPVI
2awnA           TPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPS----------------------------
1ak2A           SGSEKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIE
2b8wB           WMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVY----NSIGTINQQAMDQLYY
1aldA           ---------------------------------------------------------------QYPALTP
3dftD           --------------------------------------------------------------HSHPALTP
3dymA           ------------IPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIG
3ec1A           LD-MIEIPLESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQTLFFGGLARLDYIK
2dflA           ------LSGKAVYIDTEGTFRWER----IENMAKALGLDIDNVMNNIYYIRAINTDHQIAIVDDLQELVS
1e2gA           PERSTEIGKLLSSYLQKKSDVEDHSVHLLFS-ANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKEN
3cm0A           R--GTPLGERVRPIMERGDLVPDDLILEELAERVIFDGFPRTLAQAEALDRLLSETGT----RLLGVVLV
2a2zA           QS-----TNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESE
1d6jB           GLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVY
1bmfC           IYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP------------------------
2dr3D           VQV-RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEK--------------------YIVHDLTD
3dm9B           QLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHA--------------------------KARGIDVVLID
1adoA           --------------------------------------------------------------HSHPALTP
2bofX           --------PRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAPSH
3dfnC           --------------------------------------------------------------HSHPALTP
3dt4C           DA--QGNLRAINPENGFFGVAPGTSVKTNPNAIIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWK
1eamA           HDPILNGLRDVRFVDEEYLRSIKKQLHPSKIILISDVRSPST------------ADLLSNYALQNVMISI
2drcA           -------------------ISLIAALAVDRVIGMENAMPF-----------NLPADLAWFKRNTLDKPVI
2anbA           RP-----GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQ
3dfnA           --------------------------------------------------------------HSHPALTP
3dftC           --------------------------------------------------------------HSHPALTP
2eg5G           NDFNSVFKLLPSFYRK-LEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCGLVTEIGTNKGSIY
3dfqD           --------------------------------------------------------------HSHPALTP
3bk7A           --------LTVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFYKTELLK-----PLGIIDLYDRNVEDLS
2aunA           ----------------DQTWQPIDGRVALIAPASA-IATEVLEATLRQLEVHGVDYHLGRHVEARYRYLA
1e2kA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPY----------------AVTDAVLAPHIG
1e6cA           MADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPQASLQAHQRPT
1akeA           SG--SELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLE
1e2fA           ----TEIGKLLSSYLQKKSDVEDHSVHLLFS-ANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKEN
1cjaA           PIAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIITLY
3dfqC           --------------------------------------------------------------HSHPALTP
3dfnD           --------------------------------------------------------------HSHPALTP
1dyhA           -------------------ISLIAALAVDRVIGMENAMPW-----------NLPADLAWFKRNTLDKPVI
3d3qB           GTAKTTEEEGIPHYIDILPPDASFSAYEFKK-RAEKYIKDITRRGKVPIIAGGTGLYILYNYAFEDKKQV
1eilA           ------------------------------------------------------VPAWDHFLTKSVGLMA
6aldA           ---------------------------------------------------------------SHPALTP
1e9sM           GDMLSKFGRDKDIILNPYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAK
3cr7A           LNKDLGFSEADRNENIRRIAEVAKLFADSNSI-AITSFISPYRKDRDTARQLHEVTGLRDPKGLYKKARE
4dfrA           -------------------ISLIAALAVDRVIGMENAMPW-----------NLPADLAWFKRNTLDKPVI
3dffA           ---------NVLVYTVFAGAAQPPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYR
3b55A           ------------------------------------------------------KWLEAHAKPLKTTNPT
3cr7D           RFGEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVRDPKGLYKKARE
3czjA           ------------IPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRLDNDIGVS
3cphA           GKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKS
3b9qA           AAA-SDQLEIWAERTGCEIVVAEKA--------KAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLME
2cvfA           RLVQM---AETRGLNPEEALSRFILFTPSDFKEQSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELS
2dpyB           DFIENILGPDGRARSVVIAAPADVSPLLRM-QGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQRALAI
2aumB           ----------------DQTWQPIDGRVALIAPASA-IATEVLEATLRQLEVHGVDYHLGRHVEARYRYLA
1e9rF           ---LSKFGRDKDIILNPYDQRTKGWSFFN-EIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAK
2ausC           ---------------------------------------------------------------KPPGPTS
3dfoC           --------------------------------------------------------------HSHPALTP
3cbnA           ---VTAGHRTTFEVTVD----PEIGETADCIIGVSSSDSISTLPDEKRAIARESLVRVIEIRGYGHPELT
2bv7A           ----PKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNL------------IRVNATKAYEMALKKY
1e9sE           GDMLSKFGRDKDIILNPYDQRTKGWSFFNE----IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
1e4vA           SGSELGKQA---KDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVL
1ek0A           VTINEHTVKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQIALVGNKIDLQ
5dfrA           ------------------------------------------------------ADLAWFKRNTLDKPVI
3cmvB           HALDPIYARKLGVDIDNLLCSQPDTGEQALEICD---ALARSGAVDVIVVDSVAALTPKAEIGLAARMMS
1cjtC           IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPP----------------------------
3ch4B           QYA-QEHGLNFQYKEAFRKDMIRWGEEKRQADTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFP
3cmwC           ---DPIYARKLGVDIDNLLCSQPDTGEQALEIC-DALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMG
1e9sI           L---SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA--------------------LSVVPRGKT
1drbA           -------------------ISLIAALAVDRVIGMENAMPW-----------NLPACLAWFKRNTLDKPVI
3cueF           GKTVKLQIWDTAGQERRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCD
3bv4A           ----------------------------------------------------------------HPALTP
3d1mB           -------------------------------------------------------PNVAEKTLGASGRYE
3d1mA           -------------------------------------------------------PNVAEKTLGASGRYE
2aunB           ---------------------TWQPIDGRVAL--IAPASAIATEVLEATLRQLEVHGVDRHVEARYRYLA
2c9oC           TE-IKKTEVLMENFRRAIGLRIKETKKKEIDVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHM
2an9A           RPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVL-----ATGVDVFLDIDWQGAQ
2ahwD           AQ-EGLVKWALCGHWG-QSPRISDLAEQNKIIAPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGK
3bs4A           QL-IIRILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDL
1e9rG           ---LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL----SVVPRGKTDEAEEWASYGRLLLRE
1av6A           GRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVA
2b8tD           NIQSRTGTSLPSVELNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPF
2e85A           ------------------------SAVTDVLLCVGNSMMGDDGAGPLL------AEKCAAAPKGNWVVID
2a1fE           ----------------------------------------------------------------------
3dyoA           -------SHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVS
3cnlA           DTPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEF-FEDFARKRGLLKK
1e9sH           GDMLSKFGRDKDIILNPYDQRTKGWSFFN-EIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAK
1cs4C           IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFP-----------------------------
3a00A           AGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVA--------------SVKQVSKSGKTCIL
2ccjA           MTREPGGVPTGEEIRKIVLEGNDMDIRTEAM-LFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQG
3di4A           LH--GTHVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLARALADHTGLP
1e2iA           RLDQGEISAGDAAVVMTSAQITMGMPYAVT-DAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYL
3d3qA           GTAKVTTEEEGIPLPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLYNYAFEISEDKKQV
2ancB           RPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVL-----ATGVDVFLDIDWQGAQ
2dpyA           DFIENILGPDGRARSVVIAAPADVSPLLRM-QGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQRALAI
3cioD           LFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVD
1e1qB           IYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATALAPYSGCSMGEYFRDNGKHALIIYDDLSKQARPPG
1dp0A           ------------------------------------------------------RDQFTRAPLDNDIGVS
3bczC           SCA-AHAYKQVDPSITRRIFILGPSHHVPLSRCAVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDE
2bkeA           DTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQI--------------------AIVDDLQELVS
3cmuA           ---DPIYARKLGVDIDNLLCSQPDTGEQALEICDALAR-----SGAVDVIVVDSVAALTPKAEIEGEIGD
3bjqB           ----------------------------------------------------------------------
3bb1H           VS--RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKT------------IDVLLYVDRLDAYRVD
2ancD           RPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVD-----VFLDIDWQGAQ
1dekA           AWGVFAANTDYPLTRKEFETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITD
3bm2B           --------------ALELLIN-RRSASRLAEPAPQNILRAGRAPDWHFFVIEGEGRERFSAVLEQGAIAA
2ancF           DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYALIVNDDFDTA
3bwdD           EDY---NRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFID
3cbqA           VDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILV
3dvlD           PQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGG--------------FDLSALIERINYAIQ
2awoD           GMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLE
2ahvA           AQE-GLVKWALCGHWG-QSPRISDLAEQNKIIYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGK
1culC           EA-IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPD------------------------------
2a1fC           ---------------------------------------------------------------------S
1e9sL           GDMLSKFGRDKDIILNPYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAK
2d7vA           QLEKHHLAHENCFIANSV--ETEVVT--------------------------------------------
2czvB           DT-VQKFKSYLIYVESNDLRVIRYSIEKGVAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSN
3dm5B           PG--AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFK------------------SKGVDIIIVDT
2a78A           VVLDGEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLV
1d6jA           RFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFIS-----------PYRKDRDTARQLHEVAT
1e2hB           VLGASETRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHAALLCYP
2d7vB           QLEKHHLAHENCFIANSV--ETEVVT--------------------------------------------
2cbzA           PQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEIL------------PSGDRTEIGEKGVNLS
2e85B           --------------------------------------------------------------------ID
1dw9A           DIPLRGCIDDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGI-ISAINFKLDVKKVADPEGGERAVITLD
2a5vA           RDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSS----------------------------
3brwA           --------YHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIY
1dvrA           KG--TQLGLEAKKIMDQGGLVSDDIMVNMIKNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIE
1chdA           ----------------------------------------------------------------------
2dftC           RSIADIFATDGEQIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRA
2dftA           RSIIFATDGEQEFRRIEEDVVRAALADHDGVLSGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNDRA
3e70C           AGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARG-------------------IDVVLIDTA
3ed8A           TP-----IGDGPVLLPDNHYLSYQTVLSK-----------------------------------------
3cr7B           RFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFPYRKDRDTARQLHEVETGLPFVEVYPVEVQ
3a00B           AG----EVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYG----------STVASVKQVSKSGKTCIL
1ckvA           EVDCDEISELLGRQFNVYDFLVDVSS--------------------------------------------
2a5vB           RDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSS----------------------------
1c9kC           GR-----PAHWRTARHLDTLITADLAPDDAILLECITTMVTNLL----------FALGDPEQWDYAAMER
3dmdA           AGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKA-------------------RGIDVVLIDTA
2b0lC           ----------------------------------------------------------------------
2bboA           SQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKF------------AEKDNIVLGEGGITLS
2aexA           ----------------------------------------------------------------------
1bccF           -------KWYYNAAFNKYGLMRDDTIYENDDV-KEAIRRLPENLYDDRMFRIKRALDLNMRQQILP---K
1afrA           ----------------------------------------------------------------------
3bb1D           PVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIL
1cjuC           NNLKEAIETIVAAMSNLVPPVELANP--------------------------------------------
2c5mD           ----------------------------------------------------------------------
1e2nB           VSETIANIYTTQHRLDQGEISAGDAAVVMTSAQPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC
2a5fA           YKNVKFNVWDVGGQDKIRPLWRHQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPD
3c15C           NNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMN------------------------------
3dfdA           TFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAIE-------------------------------
3c14C           NNLKEAIETIVAAMSNLVPPVELANPENQ-----------------------------------------
3e8aC           KEAI---ETIVAAMSNLVPPVELANPENQFRVDYILSVMN------------------------------
1e9sA           ---LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR-LLLRETAK
3do6A           ----------------------------------------------------------------------
1agpA           VVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKC
2c9gA           ----------------------------------------------------------------------
1e2nA           VGASETIANIYTTQHRLDQGEISAGDAAVV-MTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDR
2dx7A           IWTAKRLEECADFIIMPANFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFS
2cdnA           IEEGTKLGVEAKRYLDAGDLVPSDLTNELRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVL
1d6aA           NLQETWGKISTAIHDAKNGVLPKPLELVDASGAKWIVLR-------------------------------
1e2iB           -----TYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMT-------SAQITMGMPYAVTDAVLAPHI
3ci2A           ----------------------------------------------------------------------
3c7kC           --SGEDVKQYKPVVYSNTIQSLAAIVRAM-DTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAM
1e2lB           --------RVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPGEAGSPPAL
3cnnA           TPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSE--FFEDFARKRGLLKK
1ckeA           EDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVAN-----AASQVAAFPRVREALLRRQRAFR
3c85A           YDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLPHHQGNQTALEQLQRR
3c7kA           LAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFS-----------------------------
3dkvA           MKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDC-------------------------------
1azsC           KEAIETIVA---AMSNLVPPVELANPENQFRVDYILSVMN------------------------------
1dwmA           ----------------------------------------------------------------------
3cqcA           ------------FNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKM
1e9rB           LSKILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT------------------------------
2bhvC           --KMIPAFLITPISSQIAGKV-IAQVESDIFAHMGKAVLIPKGS---------------KVIGYYSNNNK
3cd9A           GDGPVLLPDNHYLSTCS---ALSKDPNEKRDHMVLL----------------------------------
1d2zD           ARPVDGPGALISLELLE-----------------------------------------------------
1d8jA           ------------------------------------------------------HPLTLDEILDETQHLD
3b85B           A------GEKLGFLPDPYLRPLHDALRDVEP--EVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTT
1e2lA           IANITQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLA---PHIGGEAGSPPPALTLIFDRHPIAA
1e2jA           EANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAAL
3csuA           LKANPQPELVIASCFFEASTRLSFETSMHVGFSDSGKKGETLADTISVISTYVDAIVMRHPQEGAARLAT
1e2mB           ASETIANIYTTQHRLDQGEISAGDAAVVMTSAMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC
2axnA           YLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDAT
2b6hA           KNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQD-MPN
1cjvC           AETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDF------------------------------
1a2kD           VFHTNRGPIKFNVWDTAGQEKFGGLRDIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNK
2c9oA           TEIKKTEVL---MENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDPSIFESLQKER
1e2kB           VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQIT----------------MGMPYAVTDAVLAPHI
1e2mA           SETIANIYT---TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAV------------LAPHIGGEAG
2bwjB           LASESERSKLIRDIMERGDLVPSGIVLELL----------------------------------------
1e9sK           ---LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY--------------------ALSVVPRGKT
2bwjD           ELASESERSKLIRDIMERDLVPSGIVLELL----------------------------------------
2c95B           VSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLY
1e2jB           VLGASETIANIYT-TQHRLDQGEISAGDAAVVM-------------------------------------
1e2hA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGIAALLCYPAARYLMG
3cddE           ACTVD-IGGERVITGYVDDWVPSYDESTTISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPF-
1e6vC           --------------------------------------------------------------------KY
3cddB           VDIGGEITGYVDDWVPSYDESTITISVSGRDKTADLVDTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQI
3cr8B           ---------------------------------------------------------LIDPEKREALKHE
2c5mB           ----------------------------------------------------------------------
2bsqH           -------------------------THNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSSIGQEIG
3dzvA           ----------------------------------------------------------------------
3dsrB           GITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPR----------------------------
2c9oB           TKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCSHVI------------------------------
1a2kE           TNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNK
2bwjF           ----------------------------------------------------------------------
1dxrH           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
2bsqE           -------------------------THNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMIGQEIG
3ea5C           TNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNK
2cxxA           ----------------------------------------------------------------------
3e2iA           GNAIEAINISKASEITHDLTNVDVIGID------------------------------------------
1delA           --ALAYAWGVFAANTDYPCL--------------------------------------------------
3cddA           DDW-----VPSYDESTITISVSGRDKTADLVDCSIDYGQFNNQTLTQIADIVCKPFGIKVIVNFQRIQIE
1as2A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVF
3b5jA           GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVK-NADRIIV
3dmdC           GRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNAVKIDGIILTKLDADARGGAALSIS
3dmdB           GRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDADARGGAALSIS
2d3wB           GGEKKRNDILQMAVLEPELCILDESDSL-DIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHV
3cmvG           QAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEVGSETRVKVVKNKIAAPFKQAEFQI
3b60A           GGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTIEQ-ADEIVV
1d1cA           AGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA--MDIVGFSQEEQMSIFKIIAGILH
2dwoA           NTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEAS
2ccjB           YARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQRFKS
3cmvC           QAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEVGSETRVKVVKNKIAAPFKQAEFQI
3eiuA           GAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINVLPSLSRLMNSGIG
2c03B           GRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDKVGVTGLVLTKLDGDARGGAALSAR
2dwpA           NTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEAS
3cmvH           MSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETNKIAAPFKQAEFQI
2ccgA           YARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIH
3c95A           YAEQQRWLEHRRQVFTPEFL--QGYADELQMLVQKEKVALLKALWQYADEIV------------------
3eiuB           GAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINVLPSLSRLMNSGIG
3dm5A           GRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKETPIGSIIVTKLDGSAKGGGALSAV
2ccgB           YARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSDQEDLKFHEKVIEQEIIHNESQRFKS
1e69A           GGEKALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVM-EAADLVTM
1bifA           NTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENS
2b8tA           GPIAKLFTYADKITKLTAICNECGAEATHSLRK------IDGKHADYNDDIVKIGCQEFYSA--VCRHHH
2dr3A           IREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSGFGPGVVDGIIR
2c61B           GAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL----HRKGIYPPINV-LPSLSRLMNSGIG
2czvA           PYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASI---SMYPEIIL-
1aroP           KMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQ
2bifA           NTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYE--
2akaB           DIEFQIRDMLMQFVTKENCLILAVSPANSDL-ANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDV
2axzC           SSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFKNISINGYYDLEINYFLTDKNID
1e9cA           FSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG----HERYENGAFQERALRCFHQLMKDTTLNWKM
2awnC           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2b8wA           DFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKL
2bbsA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILVTSKMEHLKKADKILI
3cmvA           -------SVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKSNTLLIFINQGGNALKFYASVRLD
2c03A           GRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEVGVTGLVLTKLDGDARGAALSARH
2cjwB           EGRAAVVFDCKFIETSAAVQHNVKELFE-------------------GIVRQVRLRRDSKEKN-ERRLAY
2c9yA           FSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLI--RRSDDNEKALKIRLQAYHTQTT
2a2zD           DWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLYKHESWLLHRTLKTNFDYLQEVPILT
2cgtH           PYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKLLIIAEDVEGEALATLVVNTMRGIVK
3b2qB           GAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR-----KGIYPPINVLPSLSRLMNSGIG
2awnB           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLKRLGRTMIYVTHDQVEAMTLADKIVV
2d62A           GGQRQRVALGRAIIRRPKVF-LDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQ---VEATGDRIA
1e9sG           DEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFV
1e3mA           VGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLANKALTLFATHYFELTQLPEKEGVA
2bjbA           TDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPPVAARRWDIEPDLTNAVAFLSAAV-
1cr4A           TDRLLAKLAYMRSGLGCDVIILDHISIRKMIDN--LMTKLKGFAKSTGVVLVVICHRGGALRQLSDTIIA
2awnD           AGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELMPNRQQVWLPVESRDVQVGANMSLG
3b2qA           AEALRQMGAAR---NEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDIT-HPIPDLS
2c04A           GRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFEKVGVTGLVLTKLDGDARGAALSARH
2d4uB           NALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDR------------------------
1e9sF           DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGSNEASKALTSARFV
2a5gA           AMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN--------------------------
1b0uA           GGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIF
2b92B           SFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRKFFPKKKCFVFDRPVHRRK
4dcgA           HGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYP-NQEYDY
1e98A           FSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGA----FGHERYENGAFQERALRCFHQLMKDTTLNWKM
2akaA           GATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITR---QAMDIVGFSQEEQMSIFKIIAGILH
3dt2A           NKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVGATAAA
2cckA           AYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSEDLKFHEKVIEGYQEIIRFKSV
2dr3E           IREFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVLAGTGCTSIFVSQVSVGVEHGVDGIIR
2bbsB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM-EHLKKADKILI
1e9fA           FSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENG-----------AFQERALRCFHQLMKDTTLNWKM
1e9rA           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDGDFS
3clvA           IDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI---------------------
2d4hB           GQPLTPDEYLTYSLPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYSNSKTKTLSGGIQV
1e3mB           GTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFELTQLPEKEGVA
3czpB           KQTQERF-KEREKTPYKRYKITEEDWRNRDK--WDQYVDAVGDVDRT--STEIAPWTLVEADKRFARVKV
2bbtB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS-KMEHLKKADKILI
1e9dA           FSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG----HERYENGAFQERALRCFHQLMKDTTLNWKM
2a30B           DWHDWMNNQFGQSLELDGIIYLQATPETCRNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVPILT
2awoC           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIESRLHKRLGRTMIYVTHDQVEAMTLADKIVV
3bpbA           IAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESY----AANCIW
2bkhA           GASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQILQKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKK
2a30D           DWHDWMNNQFGQSLELDGIIYLQATPETCLHEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVPILT
3bh0A           RQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQRDLKKMARELDVVVIALSQLSRQVEQRQDKRPM
1cr1A           AETDRLLAKLARSGLGCDVIILDHISIRKMIDNLMTKL--KGFAKSTGVVLVVICHGSGALRQLSDTIIA
2c61A           AEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPI-PDLSGYI
3a1wA           MTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ------------------------
3cmxA           NPETTTGGNALKFYASV-RLDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQAEFQILYGEGI
4atjA           GGPSWRVPLGRRDSLQAFNANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYN
1dhjA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQKLYL
1e9sJ           DEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFV
3c8uA           AGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRPADLEARLVQRWLDHGLNHDAAVARAQGNDL
2awoA           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYVTHDQVEAMTLADKIVV
2bc9A           TINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEATPDEYLTYSLKLKKGTSQKDETFN
2d2eA           EGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPFGALVITHYQRILNYIQPDKVHV
3bo6B           HNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGQSQALREEPFYRLMAE----
2d4uA           NALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN--------------
3d7wA           FPGGQTKTQAR--SILILIQMISEAARFNP------ILWRARQYINSGASFLPDVYMLELETSQSTQVQH
1ai4B           QSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQD
1e9sD           DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDFLEGTLAESLFAGSNEASKALTSARFV
2d3wD           GGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVA-DGVNSLRDGKRSFIIVTHYQRILDYIPDYVHV
2a2zB           DWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVPILT
1bg0A           KATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFLEDHLRIISKGGDLKTVYKRLVTAVD
1e2dA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-----RALRCFHQLMKDTTLNWKM
3d31A           GGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAEMLSVLHKKNKLTVLHITHDQTEARIMADRIAV
2ck3C           PYSGCSMGEYFRDNGKHALIIYDDLSKQAVA-YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDA
1dkiA           SSRVQRALKENFGYNQSVHQINRGDFSKQDWEA------QIDKELSQNQPVYYQGV-----GKVGGHAFV
1e59A           DDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGN-SLRALVKYLDN
3bb1C           IWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK-SDIPVVLIENSGRCNKNDSDEKVL-
3bb1E           IWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCNKN-DSDEKV
2dr3B           IREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQVSVGERGFGGPVEH
2d0kA           YGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAADVPEIFVIGGGRVYEQFLPKAQKLYL
2d3wC           GGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTHYQRI--LDYIKPDYVHV
2axpA           GKDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDII-------------------------------
1e0jA           LAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVDLRGSGALRQLSDTIIA
421pA           DLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR------------------------
3bgwA           YIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQARELDVVVIALSQLSRQVEQRQDKRPM
2b8tB           GPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHAD-------YNDDIVKIGCQEFYSAVCRHHHK
1e3aB           QSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQD
3bb1F           IWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK-KDIPVVLIENSGRCNKNDSDEKVL-
2bhjA           FATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYTNNGNIRSAITVFPQRSDGKGYQM
2d3wA           GGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIPDYVHV
3bb1B           IWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLPNGIA
1e4yA           RTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVY--HVKFNPPKVEGKDDVTGEELTT
2bkiA           GASEDIRERLHLSSPDNFRYLNRGCTRYFANK------ETDKQILQNRKSPEYLKAGSLKDPLLDDHGDF
3dt4A           NKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVGATAAA
3d3kA           DQPWYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYH
2a5jA           LESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL-----------------
3cmvE           QAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAE
2d4hA           DESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLLPRLCIRKFFPKKKCFVFDRPVHRRKL
3cddC           QGETPHELLARLAK-QRGVLLTSDTFGNLVITRASKTKAGVSLIL--GDNVKAARGRF-SWRQRFSKFTI
3cmtD           MKNPETTTGGNALKFYASVRLDIRRIGAVKEGEN----VVGSETRVKVVKNKIAAPFKQAEFQILYGEGI
3b85A           LGFGSKVVTGDGLRLVRHILR-GVDDVHFSELTSSDVVQLVGHIVD------------------------
3dtbB           NKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHG-VFVGAAMR
2b8tC           GPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYN-------DDIVKIGCQEFYSAVCRHHHK
2bdtA           LRKKGERCLELVEEFESKGI--DERYFYNTSHLQPTNLNDIVKNLKTNPRFI------------------
2dr3C           IREFIEVLRQAIRDINAKRVVVDSVTTLYINKARSIILQLKRVLAGTGCTSIFVSQVSGV-EHGVDGIIR
2c7cH           PYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIAEDVEGEALATLVVNTMRGIVK
1dhiA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDPEIMVIGGGRVYEQFLPKAQKLYL
3da4A           GKEYQILLPGEIHIKES-----------------------------------------------------
1cr2A           TDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKL--KGFAKSTGVVLVVICHKSGALRQLSDTIIA
1cr0A           AETDRLLAKLAYMRSGCDVIILDHISIRK---MIDNLMTKLKGFAKTGVVLVVICHDLRALRQLSDTIIA
3dauA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEQFLPKAQKLYL
2a30A           DWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVPILT
1cfrA           SNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFDYAELEHIKSFLSVKTTFRPDRRLQL
3crmA           LEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHRSDLHAGLPSIRAVGYRQVWDYLDG
2bhvA           MGEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGSAFGDYLLMQLMRQSGMGINQVVNQIVV
2bhvD           MGEYLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPFGDYLLMQLMRQSGMGINQVIAPIVV
1dekB           GKSPIKGVFVFDD-EGKESVNFVAFNKITDVINNIEDQWSVRRLQALGTDLIVNNFDRMYWVKLFALDYL
1e9rD           DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFTLAESLFAGSNEASKALTSARFV
3dhwC           GGQKQRVAIARALASNPKVLLCDEATSALDPATTSILELLKDINRRLGLTILLITHEMDVVKRICDCVAV
2d2fA           GGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPFGALVITHYQRILNYIQPDKVHV
2ctsA           PMSQLSAAITALNSESNFARAYAEGIHRTKYIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDW
2bx2L           LFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEA--ADEIARQLRL
3dt7A           NKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSWQHGVFVGATAAA
2bbtA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM-EHLKKADKILI
3cddF           AGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTRIPQTGKLWNINTLVPV
2cckB           AINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYEIIRFKSVNADQPLENVVEDTYQTII
1bglA           EATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMAIT
2a1fF           QPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAG
2boeX           GQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQ
2bwjA           MDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKIEGTPEDVFLQLCTA
3bgwD           RQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISLKKMARELDVVVIALSQLSRQVEQRQDKRPM
1dg3A           SFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFLPRLCIRKFFPKKKCFVFDRPVHELDP
3czpA           KQTQERF-KEREKTPYKRYKITEEDWRNRDKQYVDAVGDVDRTSTEIAPWTLVEANDKRFARVK------
3bb1G           IWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVV---RSGASLSDIPVVLIENSGR-CNKNDSDEKV
1e9rE           DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFTLAESLFAGSNEASKALTSARFV
3cddD           QGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVS--LILGDNVKAARGRFS-WRQRFSKFTI
1e0jB           LAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHEEGR
3dfqA           EQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dfoD           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dfpD           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3bb1A           IWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALL-QVVRSGASLKSDIPVVLIENSGRCNKNDSDEKV--
3dfpC           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3adkA           VDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKGSVDDVFSQVCTHL-
3bjdB           RALEQEIAAQSRERHPSQYFSGSASRAQLQVFLRHQWFRTFRLYRDAA-DLLVNLTDVD-EAAALARYLY
2dr3F           IREFIEVLRQAIRDINAKRVVVDSVTTLYINKARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEDGIIR
2c0bL           LFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDITNLEAADEIARQLRLRDLGIVIDFIDMTPV
3cr7C           GVIKEFTGISAP-YEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKG----------------------
3ecpA           AGAMQTVKLAQE----FPELLAIEDTTSLSYRHQVAEELGKLGSIQD-KSRGWWVHSVLLLEATTFRTVG
2c4rL           LFSHYQIESQIESAFQREGSIVIDSTEALTAIDINSARGDIEETAFTNLEAADEIADFIDMTPVRHQRAV
2a1fD           -----QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAG
3dlbB           RLQGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPWERRRRTREIASWIGRRLGLGTPEAV
2aumA           GTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADIS------VLLSAF
1e9sB           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDGDFS
1accA           DRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILS-----GYIVEIEDTEG-LKEVINDRYDM
3be4A           SGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVLDVFHKQTAPLVKFYEDLGILKRV
1draA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQKLYL
2awnA           ------------------VFLLDEPLSNLDAALRVQMRIEISRLKRLGRTMIYVTHDQVEAMTLADKIVV
1ak2A           FSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLISDDNKKALKIRLEAYHTQTTPLVE
2b8wB           VTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEDGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKF
1aldA           EQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dftD           EQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dymA           VSEATRIDPNAWVERAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGSGQMAIT
3ec1A           GGRRSFVCYMANELTVHRTK-LEKADSLYANQLGELLSPPSKRY---AAEFPPLVPRSLSVKERKTDIVF
2dflA           KDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLRLAEVYDIAVIITNQVMHTLYHVPGIRIQ
1e2gA           FSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFHQLMKDTTLNWKM
3cm0A           EVPEEELVILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYARGVLKRVDGLGTPDEVYARIRAALG
2a2zA           CMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLGRNEEQGIPLEYLEKLHYKHESWL
1d6jB           VDVPVEVAEQRAPYEAPANPEVHVKNYELPVDAVKQIIDYLDT---------------------------
1bmfC           -YSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREA-YPGDVFYLHSRLLERAAKMNDA
2dr3D           IREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVH
3dm9B           TAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEVKIDGIILTKLDADARGGAALSIS
1adoA           EQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
2bofX           SAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAGSSQARIYFDAGHSAWHSPAQMA
3dfnC           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dt4C           NKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVGATAAA
1eamA           LNPVASSLKWRCPFPDQWIKDFYIPHGNKMPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYY
2drcA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQKLYL
2anbA           QIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAHYAEYDYLIVNDDFDTALTDLKTIIR
3dfnA           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dftC           EQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
2eg5G           SSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCIC---KGVELDARNAIDLLEMAINDLVV
3dfqD           EQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3bk7A           GGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMKNEKTALVVEHDVLMIDYVSDRLIV
2aunA           GTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLP
1e2kA           GEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAPPTLPGTNIVLGALPEDRHIDRLAKRQRP
1e6cA           LTGRPIAEEMEAVLREREALYQDVAHYVVDAAIVCELMQTMR----------------------------
1akeA           FDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRMTAPLIGYYSKEAEAGNTKYAK
1e2fA           FSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG---HERYENGAFQERALRCFHQLMKDTTLNWKMV
1cjaA           TGYD--VGTEGSISMQEGFLATVRECASFDLDAFERELLKCHNLSISPQAIPFILRMLR-----------
3dfqC           EQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3dfnD           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
1dyhA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRVYEQFLPKAQKLYL
3d3qB           KLKLKELEHLNNNKLHEYLASFDESAKDIHPNNRKRVLRAIEYYENYDTLLIGIESRETLYLRINKRVDI
1eilA           AGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALEADKLRQAGVAFTRGDEAL--MQQRKVM
6aldA           EQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
1e9sM           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAKALTSARFVLSDKLPEHVTMPDGDFS
3cr7A           GVIKEFTGISAPYEAANPEVHVKNYELPVQD----AVKQIIDYLDTKGYLP-------------------
4dfrA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRVYEQFLPKAQKLYL
3dffA           KLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLVGEVADD-IRSIIDEFDPTLVVTCAAI---GEHPDHEAT
3b55A           ASLNDLKPLKNV--GSASIVGLGEATHGAHEVFTKHRIV-KYLVSEKGFTNLVLEEGWDRALELDRYVLT
3cr7D           GVIKEFTGISAPY-EAPANPEVHVKNYELPVQD--AVKQIIDYLDTKGYL--------------------
3czjA           EATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGSGQMAIT
3cphA           DMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVG------------
3b9qA           ELIACKKAVGK-----IVSGAPNEILLVLDGNTGLNMLPQAREFNEVGITGLILTKLDGSARGGCVVSVV
2cvfA           RQLHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRI
2dpyB           GEPPATKGYPPSVFAKLPALVE------------------------------------------------
2aumB           GTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADIS------VLLSAF
1e9rF           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFS
2ausC           HEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPE-DKIRAV
3dfoC           EQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3cbnA           LDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR--------KGRELKVEIIVEYEG--------
2bv7A           HGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTRMNAEL----
1e9sE           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPD
1e4vA           EFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRTAPLIGYYSKEAEAGNTKYAK
1ek0A           EGGERKVARGEKLAEEKGLLFFE--TSAKTGENVNDVFLGIGEKIP------------------------
5dfrA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEQFLPKAQKLYL
3cmvB           QAMRKLAGNLKQ-SNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGE-NVVGSETRVKVVKNKIAAPFK
1cjtC           ----------------------------------------------------------------------
3ch4B           GVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRS---------------------------
3cmwC           LAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNP------ETTTGGNALKFYASVRLDIRRIG
1e9sI           DEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFV
1drbA           MGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEQFLPKAQKLYL
3cueF           LKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS--------------------
3bv4A           EQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILF
3d1mB           GKITRNSERFKEPNYNPDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRVTEGWDEDGHHSEESL
3d1mA           GKITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAWPGVKLRVTEGWDEDGHHSEESL--
2aunB           GTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVL------LSAF
2c9oC           LDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLDRVMIIRTMLYTPQEMKQIIKI
2an9A           QIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEEYDYLIVNDDFDTALTDLKTIIR
2ahwD           LNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVM
3bs4A           NLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYR
1e9rG           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHDGDFS
1av6A           SSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNK
2b8tD           GPIAKLFTYADKITKLTAICNECGAEATHSLRKI------DGKHADYNDDIVKIGCQEFYSA-VCRHHHK
2e85A           GGSAPENDIVAIRELRPRLLIVDATDMGLNPGE-----IRIIDPDDIAEMFMMTTHNMPLDQLKEDIGEV
2a1fE           -----QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAG
3dyoA           EATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMAIT
3cnlA           GGVPDIERALMLFFTEAGRVSFERPED-------------------------------------------
1e9sH           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFLSDKLPEHVTMPDGDFS
1cs4C           ----------------------------------------------------------------------
3a00A           DIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYK-ELKDFIFAE--------------
2ccjA           YARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLQEDLKFHEKVIEGYQEIIHRFKS
3di4A           LHEAELVHDVLNVFCTGFQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEA-----SCHPLLVEI
1e2iA           MGSMTPQAVLAFVALIPPTLPGTNILGALPEDRHIDRLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQ
3d3qA           KLKEYLASFDKESAKDIHPNNRKRVLRAIEYKLLSSRKKVQQFTENYDTLLIGIESRETLYLRINKRVDI
2ancB           QIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEEYDYLIVNDDFDTALTDLKTIIR
2dpyA           GEPPATKGYPPSVFAKLPALVE------------------------------------------------
3cioD           TPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILVIKRASTAYSYG-----
1e1qB           REAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAPTNVISITDGQIFLETELFYKGIR
1dp0A           EATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMITV
3bczC           HSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNRFRYSYYDESQGEIYRSIEH
2bkeA           KDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAVYDIAVIITNQVV---PGIRIQLKK
3cmuA           SHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQI----RMKIGVMFGNPETTTGGNALKFYASVRLDIRR
3bjqB           ---QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAYNTKRNTKRIDF
3bb1H           NLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPDEFFSKRSEALLQVVRSGASLKKDSDIPVVLI
2ancD           QIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYLIVNDDFDTALTDLKTIIR
1dekA           VINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDK-----FNSGYDYYIVPDTRQDHEMDAA
3bm2B           GSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGGIWRSGALTES----PVVREAFG
2ancF           LTDLKTIIRAERLRMSRQKQRHDALISKLL----------------------------------------
3bwdD           HAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ------------------------
3cbqA           GARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQI-------------------------
3dvlD           KYRARRVSIDSVTSVFQQ--------YDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVF
2awoD           LYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQ------VQVELPMPNRQQVWLPVESRDVQVGANMSLG
2ahvA           LNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGIVMM
1culC           ----------------------------------------------------------------------
2a1fC           QPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAG
1e9sL           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFS
2d7vA           ----------------------------------------------------------------------
2czvB           PYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASISMPEIILKR---
3dm5B           AGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIVTKLDGSAKGGGALSAV
2a78A           GNKSDLEDVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKME-------------------
1d6jA           PGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKIIDYLDTKG---YLPAKK-------------
1e2hB           AARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLKRLDLAMLAAIRRVY--GLLANTVRY
2d7vB           ----------------------------------------------------------------------
2cbzA           GGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMKNKTRILVTHSMSYLPQVDVIIV
2e85B           GGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDP-----DDIAEMFMMTTHNMPLNYLKEDIGEV
1dw9A           GK--------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3brwA           QKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQDFKGFRGHGQTGTESVYCNFRNKEIYTEGDAQQL
1dvrA           LKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKK--RLAAYHAQTE
1chdA           ------------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQMPPGFTRSFAERLNK
2dftC           EKYRALMAKRAPLYRRVATMRVDTNRRNPG-AVVRHILS-------------------------------
2dftA           EKYRALMAKRAPLYRRVATMRVDTNRRNPG-AVVRHILS-------------------------------
3e70C           GRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQAQFNEAVKIDGIILTKLDADARGGAALSIS
3ed8A           ----------------------------------------------------------------------
3cr7B           RDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDA--VKQIIDYLDTKG-----------
3a00B           DIDMQGVKSVKAIPELNARFLFIAPPSGAHDK---VIVNDDLDKAYKELKDFIFAE--------------
1ckvA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1c9kC           AIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRL---------AAAADEVWL
3dmdA           GRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQAQFNEAVKIDGIILTKLDADARGGAALSIS
2b0lC           -----------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLDRVGITRSVIVNALRKLESAGV
2bboA           EGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMA-NKTRILVTSKMEHLKKADKILI
2aexA           ---------------EDELAHRCSSFMAPPVTDLGELELLILETAQVCQALAQVDGGANFSVDRWERKGG
1bccF           EQWTKYEEDVPYLEPYLKEVI-------------------------------------------------
1afrA           ----SFQERATFISHGNTARQAKEHGDIKLAQICGTIAADE------KRHETAYTKIVEKLFEIDPDGTV
3bb1D           QVVRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQ-TITEVALNKSESIFVD-KNLI--
1cjuC           ----------------------------------------------------------------------
2c5mD           ---KSCGLHVTSIKIDP-YINIDAGLTKDNNLIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQAL
1e2nB           YPAARYGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVY--GLLANTVRY
2a5fA           AMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWL-----------------------------
3c15C           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFS
3do6A           ----------------------------------------------------------------------
1agpA           DLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREI-------------------------
2c9gA           ----------------------------------------------------------------------
1e2nA           HPIAALLCYPAARYLMGSMTPQAVLAFVLPEDRHIDRLAKRQRPGERLDLAMLAAIRRVY-GLLANTVRY
2dx7A           KYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKIERGAECIIAGCTEVSVVLKQDDLKVPL
2cdnA           EFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRD-QLKTVDAVGTMDEVFARALRAL-
1d6aA           ----------------------------------------------------------------------
1e2iB           GGEAHAPPPALTLIFDRHPALLCYPAARYLMQAVLAFVALIPPTLPGTNIVLGALPE----DRHIDRLAK
3ci2A           ------------------------------PELVGEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRL
3c7kC           MRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQILRTRVKTTGIVETHFTFKNLHFRL
1e2lB           TLIFDRHPIAALLCYPAARYLMGS----MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRL--
3cnnA           GGVPDIERALMLFFTEAGRVSFERPE--------------------------------------------
1ckeA           ELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNRLLAEIKLVPAADALVLD
3c85A           NYKGQIAAIAEYP-DQLEGLLESGVDAAFNIYSEAGSGFARHVCKQLEPQFTSI----------------
3c7kA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1dwmA           ------------------------------PELVGMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWV
3cqcA           YNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFL----LHTILHSTGQYQECLQLADMVSS
1e9rB           ----------------------------------------------------------------------
2bhvC           MGEYLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG----------------------------
3cd9A           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1d8jA           IGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKYNV------------------------------------
3b85B           PAQKFL----TRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELSSDVVRHQLVGHIV------------
1e2lA           LLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERRVYGLLANTVRY
1e2jA           LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVRHIDRLAKRQRPRLDLAMLAAIRRVYGLLANTVRY
3csuA           EFSGNVPVLNAGDGSNQDLFTIQETQGRLDNLHVAMVGDLVHSLTQAGNRFYFIAPDALAMPQYILDMLD
1e2mB           YPAALMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLKRLDLAMLAAIRRVYGLLANTVRYL-
2axnA           NTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEAS
2b6hA           AMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHEL-------------------------
1cjvC           ----------------------------------------------------------------------
1a2kD           VDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPP--------
2c9oA           VEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKEIIQDVTLHDLDVANGEINKVVN
1e2kB           GGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF--------------------------
1e2mA           SPPALTLIFDRHPIAALLCYPAARYLMGMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR---
2bwjB           ----------------------------------------------------------------------
1e9sK           DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTFDDLRGFLEGTLAESLFAGSNEASKALTSARFV
2bwjD           ----------------------------------------------------------------------
2c95B           VDAGPETMTQRLLKRGETSGRVDDNEETIK----------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2hA           SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRV--YGLLANTVRY
3cddE           -GIKVIVNTDVGEPFQRIQTPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLI-----------
1e6vC           MNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEMEEPE----CPIRELVEPTEGAKAGDRIRY
3cddB           EQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLI---LGDNVKAARGRFSWRQRFSKFTI
3cr8B           ALSLPSLDLDWQQQCELE-MLMTGAYSPLTGAQCARVESAQQGSFWPSPITLTSRDRALADRRPGERLLR
2c5mB           ----------------------DAGTTKDNNLTTGKIYQVINKERKGGKTVQVVPHITDAIQEWVMRQAL
2bsqH           GVE-------------------------------------------------------------------
3dzvA           --------SANALLYIDAKPIADDPREFPQFQQTSALVLNLGHLSEREQSLLAASDYA----RQVNKLTV
3dsrB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           VDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPP--------
2bwjF           ----------------------------------------------------------------------
1dxrH           ------------------------------------------------YLELSVAGSARTALIPLGFCDV
1dapA           ----------------------------------------------------------------------
2bsqE           GVELEDVR--------------------------------------------------------------
3ea5C           VDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNL-------------------
2cxxA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1delA           ----------------------------------------------------------------------
3cddA           QGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAVKAARGRFSWRQRFSKFTIAAKADVTDSEIG
1as2A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
1as0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDGGQIVEEGRPEEIFTRPKEERTRSFLQRVLHH
3b5jA           MEKGKIVEQGKHKELLSEPE--------------
3dmdC           YVIDAPILFVGVGQGYDDLRPFEKEWFLERIF--
3dmdB           YVIDAPILFVGVGQGYDDLRPFEKEWFLERIF--
2d3wB           LYQGRIVKSGDFTLVKQLEEQGYGW---------
3cmvG           LYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGE
3b60A           VEDGIIVERGTHSELLAQH--GVYAQLHKMQF--
1d1cA           LGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPS
2dwoA           YQPLDPDKCDRDLSLIKVI---------------
2ccjB           VNADQPLENVVED---------------------
3cmvC           LYGEGINFYGELVDLGVKEKLIEKAGAWY-----
3eiuA           AGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGK
2c03B           HVTGKPIYFAGVSEKPEGLEPFYPERLAGRIL--
2dwpA           Y--QPLDPDKCDRDLSLIKVIDVGRRFLVNRVQD
3cmvH           LYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGE
2ccgA           NESQRFKSVNALENVVEDTYQTIIKYL-------
3c95A           ----------------------------------
3eiuB           AGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGK
3dm5A           AATGAPIKFIGTGEKIDDIEPFDPPRFVSRLL--
2ccgB           VNADQPLENEDTYQTIIKYLEK------------
1e69A           VNGVSAIVPV------------------------
1bifA           YESLDEEQDRDLSYIKIMDVGQSYVVNRVADHIQ
2b8tA           KVPNRPYLNSNSEEFIKFFK--------------
2dr3A           LDLDEIDGELKRSLIVWKMRGTSHSMRRHPF---
2c61B           AGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGK
2czvA           ----------------------------------
1aroP           AVASAIGRAIEDEARFGRIRDLEAKHFKKFMQVV
2bifA           --NSYESLDEEQDRDLSYIKIMDVGQSYVVNRVA
2akaB           LENKLLPLRRGYIGVVNRSQKDIDGKKDITAA--
2axzC           SYLNAVNIINIFKIIGKEDIHRSLVEELTKI---
1e9cA           VDASKSIEAVHEDIR-------------------
2awnC           LDAGRVAQVGKPLELYHYPADRFVAGF-------
2b8wA           AQLEKLQDEELD-PEFVQQVADFCSYIFSNS---
2bbsA           LHEGSSYFYGTFSELQ-NLRPDFSSKLMSF----
3cmvA           IRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQA
2c03A           VTGKPIYFAGVSEK-PEGLEPFYPERLAGRIL--
2cjwB           QKRKE-----------------------------
2c9yA           PLIEYYRKRGIHSAIDASQTPDVVFASILAAF--
2a2zD           LDVNEDFKD-------------------------
2cgtH           VAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIG
3b2qB           AGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGK
2awnB           LDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
2d62A           VNKGELQQVGTPDEVYYKPVNTFVAGFIGSPPNF
1e9sG           LSDKLPEHVTMPDGDFSIR---------------
1e3mA           NVHLDALEHGDTIAFHSVQDGAASKSYGLAV---
2bjbA           VSGGTVRITGWPRVSV------------------
1cr4A           LERNQLVLVRILKCRFTGDTGI------------
2awnD           IRPEHLLPSDIADVILEGEVQVVEQ---------
3b2qA           GYITEGQIVVARERKGIYPPINVLPSL-------
2c04A           VTGKPIYFAGVSEK-PEGLEPFYPERLAGRIL--
2d4uB           ----------------------------------
1e9sF           LSDKLPEHVTMPDGDFSIRSWLEDPNG-------
2a5gA           ----------------------------------
1b0uA           LHQGKIEEEGDPEQVFGNPQSPRLQQFLKGSLKK
2b92B           LAQLEKLQDEELDPEFVQQVADFCSYIFSNS---
4dcgA           FHMYFMLRTVYCNKTFPTTKAKVLF---------
1e98A           VDASKRIEAVHEEIRVLSED--------------
2akaA           LGNIKFEKGAGEGAVLKDKTALNA----------
3dt2A           EHKGKVIMHDPFAMRPFFGFGKYLAHWLSM----
2cckA           NADQPLENVEDTYQTIIKYLEK------------
2dr3E           LDLDEIDGELKRSLIVWKMRGTSHSMRRHPF---
2bbsB           LHEGSSYFYGTFSELQNLRDAERRNSILTETLHR
1e9fA           VDASKSIEAVHEDIR-------------------
1e9rA           IRSWLEDPNGGNLFITWREDMGPALRPLISAWVD
3clvA           ----------------------------------
2d4hB           NGPRLESLVLTYVNAISSG---------------
1e3mB           NVHLDALEHGDTIAFHSVQDGAASKSY-------
3czpB           LRNDAIEAAYKKDK--------------------
2bbtB           LHEGSSYFYGTFSELQ-NLRPDFSSKLMDSF---
1e9dA           VDASKSIEAVHEDIR-------------------
2a30B           LDVNEYES--------------------------
2awoC           LDAGRVAQVGKPLELYHYPADRFV----------
3bpbA           VNERVIMPAGYPRTREKIARLGYRVIEVD-----
2bkhA           IGLDDEEKLDLFRVVAGVLHLGNIDFEEAGCNLK
2a30D           LDVNEYES--------------------------
3bh0A           LSDLRESGEQDADIIEFLYRDDYYDKESESK---
1cr1A           LERNQLVLVRILKCRFTGDTGI------------
2c61A           TEGQIVVARELHRKGIYPPINVLPSLSRL-----
3a1wA           ----------------------------------
3cmxA           NFYGELVDLGVKEKLIEKAGAWYSYKGEK-----
4atjA           FSNT-GLPDPTLNTTYLQTLRGLCPLNGN-----
1dhjA           THIDAEVEGDTHFPDYEPDDWESVSSEFHDA---
1e9sJ           LSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITW
3c8uA           ANARAIEAARLPADLTW-----------------
2awoA           LDAGRVAQVGKPLELYHYPADRFVAGFIGSP---
2bc9A           LPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQ
2d2eA           MMDGRVVATGGPELALELEAKGYEW---------
3bo6B           ----------------------------------
2d4uA           ----------------------------------
3d7wA           STDGVFNNPIALAIAPGVIVTLTNIRDVIASL--
1ai4B           GPTGSLNISVGAKILYEAVQGDKSPIPQA-----
1e9sD           LSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITW
2d3wD           LYQGRIVKSGDFTLVKQLEEQGYGW---------
2a2zB           LDVNEDFKD-KYESL-----VEKVKEFLSTL---
1bg0A           NIESKLPFSHDDRFGFFCPTNLGTTMRASVHIQ-
1e2dA           VDASKSIEAVHEDIRV------------------
3d31A           VMDGKLIQVGKPEEIFEK----------------
2ck3C           FGGGSLTALPVIETQAGDVSAYIPTNVISIT---
1dkiA           ID-GADGRNFYHVN--------------------
1e59A           MSEEEILELNIPTGVPLVYEFDENFKPLKRY---
3bb1C           PNGI-AWIPHLVQTITEVALNKSESIFVDKNL--
3bb1E           LPNGIAWIPHLVQTITEVALNKSESIFVD-----
2dr3B           GVDGIIRLDLDEIDGELKRSLIVWKMRGTSH---
2d0kA           THIDAEVEGDTHFPDYEPDDWESVFS--------
2d3wC           LYQGRIVKSGDFTLVKQLEEQGYGW---------
2axpA           ----------------------------------
1e0jA           LERNQQGDMPNLVLV-------------------
421pA           ----------------------------------
3bgwA           LSDLRESGEQDADIIEFLYRDDYYDKESESK---
2b8tB           VPNR-PYLNSNSEEF-------------------
1e3aB           GPTGSLNISVGAKILYEAVQGDKSPIPQAVDLFA
3bb1F           -PNGIAWIPHLVQTITEVALNKSESIFVDKNL--
2bhjA           PDGTIRGDAATLEFTQLCIDLGWKPRYGRF----
2d3wA           LYQGRIVKSGDFTLVKQLEEQGYGW---------
3bb1B           W------IPHLVQTITEVALNKSESIFVDK----
1e4yA           RKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEA-
2bkiA           IRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNID
3dt4A           EHKGKVIMHDPFAMRPFFGFGKYLAHWLSM----
3d3kA           SFGCKFV---------------------------
2a5jA           ----------------------------------
3cmvE           FQILYGEGINFYGELVDLGVKEKLIEK-------
2d4hA           AQLE-KLQDEELDPEFVQQVADFCSYIFSNS---
3cddC           KADSAGLPTVGGIKARYRPLIIVNEEVTTAEGAA
3cmtD           NFYGELVDLGVKEKLIEKAGAW------------
3b85A           ----------------------------------
3dtbB           SEAKVIMHDPFAMRPFFYNFGKYLAHWLSMA---
2b8tC           VPNRPYL-NSNSEEFIKFFKNK------------
2bdtA           ----------------------------------
2dr3C           LDLDEIDGELKRSLIVWKMRGTSHSMRRHPF---
2c7cH           VAAVKAPGFGDRRKAMLQDIATLTGGTVI-----
1dhiA           THIDAEVEGDTHFPDYEPDDWESVFS--------
3da4A           ----------------------------------
1cr2A           LERNNLVLVRILKCRFTGDTGI------------
1cr0A           LERNQLVLVRILKCRFTGDTGI------------
3dauA           THIDAEVEGDTHFPDYEPDDWESVFS--------
2a30A           LDVNEYESVEKVKEFL------------------
1cfrA           A---------------------------------
3crmA           KLSYAEMTERGIIATRQLAKRQFTW---------
2bhvA           IREGSRVFISPNTDIFPIPREEVIAEFLK-----
2bhvD           IREGSRVFISPNTDIFPIPRENEIAEFLK-----
1dekB           DKFNSGYDYYIVPDTRQDHEMDAARAMGATVIH-
1e9rD           LSDKLPEHVTMPDGDFSIRS--------------
3dhwC           ISNGELIEQDTVSEVFSH----------------
2d2fA           MMDGRVVATGGPELALELEAKGYEW---------
2ctsA           SHNF------------------------------
2bx2L           RDLGGLIVIDFIDMTPVRHQRAVENRLREAVRQ-
3dt7A           EHKGKVIMHDPFAMRPFFGFGKYLAHWLSMAHRP
2bbtA           LHEGSSYFYGTFSELQNLRSAERRNSILTETLH-
3cddF           IDEIGLDEELIASILFSEDDAGRLAVISVVR---
2cckB           K---------------------------------
1bglA           VDVEVASDTPHPARIGLNCQLAQVAERVN-----
2a1fF           MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKL
2boeX           EVLETMAYAG------------------------
2bwjA           IDSIFL----------------------------
3bgwD           LSDLRESGEQDADIIEFLYRDDYYDKESE-----
1dg3A           EFVQQVADFCSYIFSNSKTKTLSGGIQ-------
3czpA           ----------------------------------
3bb1G           LPNGIAWIPHLVQTITEVALNKSESIFVDKNL--
1e9rE           LSDKLPEHVTMPDGDFSIR---------------
3cddD           KDSAGLPTVGGIKADV------------------
1e0jB           PVSITDLRGSGALRQL------------------
3dfqA           HETLYQKADD------------------------
3dfoD           HETLYQKADD------------------------
3dfpD           HETLYQKADD------------------------
3bb1A           LPNGIAWIPHLVQTITEVALNKSESIFVDKNL--
3dfpC           HETLYQKAD-------------------------
3adkA           ----------------------------------
3bjdB           GELGEEDEKGSHPRLLAKLLEAIGLEADFQAVST
2dr3F           LDLDEIDGELKRSLIVWKMRGTS-----------
2c0bL           RHQRAVENRLREA-----VRQDRARIQISHISRF
3cr7C           ----------------------------------
3ecpA           LLHQEWWMRPDDPADADEKESGKWLAAAATSRLR
2c4rL           ENRLREAVRQDRARIQISHISRFGLLEMSRQRLS
2a1fD           MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKL
3dlbB           RAQAYRLSIPKLMGRRAVSKPADALRV-------
2aumA           HRHGLPAIHGPVATGLGLQERLASLASVSRLL--
1e9sB           IRSWLEDPNGGNLFITWREDMGPALRPL------
1accA           LNISSLRQDGKTFIDFKK-YNDKLPLYI------
3be4A           NAKLPPKE--------------------------
1draA           THIDAEVEGDTHFPDYEPDDWESVFS--------
2awnA           LDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
1ak2A           YYSKRGIASQTPDVVFASILAAFSK---------
2b8wB           FPKKKCFVFDRPVHRRKLAQLEKLQDEEL-----
1aldA           HETLYQKADD------------------------
3dftD           HETLYQKADD------------------------
3dymA           VDVEVASDTPHPA---------------------
3ec1A           SGLGWVTCNDPGAQLVVHA-PKGVDVFIRQSL--
2dflA           LKKSRGNR--RIARVVDAPHLPEGEVVFA-----
1e2gA           VDASKSIEAVHEDIRV------------------
3cm0A           I---------------------------------
2a2zA           LHRTLKTNF-------------------------
1d6jB           ----------------------------------
1bmfC           FGGGSLTALPVIETQAGDVSAYI-----------
2dr3D           GVDGIIRLDLDEIDGELKRSLIVWKMRGTSH---
3dm9B           YVIDAPILFVGVGQGYDDLRPFEKEWFLERIF--
1adoA           HETLYQKA--------------------------
2bofX           S---WLQQADISNSAHGIA---------------
3dfnC           HETLYQKADD------------------------
3dt4C           EHKGKVIMHDPFAMRPFFGFGKYLAHWLSMAHR-
1eamA           LNKIVRNKVVVNFDYPNQEYD-------------
2drcA           THIDAEVEGDTHFPDYEPDDWESVFS--------
2anbA           AERLRMSRQKQRHDALISK---------------
3dfnA           HETLYQKADD------------------------
3dftC           HETLYQKADD--GRPFP-----------------
2eg5G           EGHLEEEKLDSFNLPVYIPSAEEVKCI-------
3dfqD           HETLYQKADD------------------------
3bk7A           FE-GEPGRHGRALP--PMGMREGMNRFLASV---
2aunA           AIHGPVATGLGLQE--------------------
1e2kA           GERLDLAMLAAIRRVYGLLANTVRYLQCGGSWR-
1e6cA           ----------------------------------
1akeA           VDGTKPVAEVRADL--------------------
1e2fA           DASKSIEA--------------------------
1cjaA           ----------------------------------
3dfqC           HETLYQKAD-------------------------
3dfnD           HETLYQKA--------------------------
1dyhA           THIDAEVEGDTHFPDYEPDDWESVFS--------
3d3qB           LGHGLFNEVQHLVEQGFEASQSQAIGYKELVPV-
1eilA           GLLCLQDPFGLPLEIYYGPAEIFHEPFLPSAPVS
6aldA           HETLYQKADD------------------------
1e9sM           IRSWLEDPNGGNLFITWREDMGPALRPLISAW--
3cr7A           ----------------------------------
4dfrA           THIDAEVEGDTHFPDYEPDDWESVFS--------
3dffA           RDAALFATHEKNVPVRLWEDLPYAVFKSGAVELP
3b55A           GKG---NPSQHLTPVFKTKELDLLDWIRQYNANP
3cr7D           ----------------------------------
3czjA           VDVEVASTPHPARIGLNCQLAQVAERV-------
3cphA           ----------------------------------
3b9qA           EELGIPVKFIGVGEAVEDLQPFDPEAFVNAIF--
2cvfA           TERG------------------------------
2dpyB           ----------------------------------
2aumB           HRHGLPAIHGPVATGLGLEQQER-----------
1e9rF           IRSWLEDPNGGNLFITWREDMGPALRPLISAWVD
2ausC           MKEFEGEIIQRTRKVYYIEILEIDGRDVL-----
3dfoC           HETLYQKA--------------------------
3cbnA           ----------------------------------
2bv7A           ----------------------------------
1e9sE           GD--------------------------------
1e4vA           VDGTKPVAEVDLEKIL------------------
1ek0A           ----------------------------------
5dfrA           THIDAEVEGDTHFPDYEPDDWESVF---------
3cmvB           QAGEGINFYGELVDLGVKEKLIEKAGAWYSY---
1cjtC           ----------------------------------
3ch4B           ----------------------------------
3cmwC           AVKEGENVVGSETRVKVV----------------
1e9sI           LSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITW
1drbA           THIDAEVEGDTHFPDYEPDDWES-----------
3cueF           ----------------------------------
3bv4A           HETLYQKA--------------------------
3d1mB           HYEGRAVDITTSDRDRSKYGMLARLAVEAGF---
3d1mA           HYEGRAVDITTSDRDRSKYGMLARLAVEAGF---
2aunB           HRHGLPAIHGPVATGLGLEQQER-----------
2c9oC           RAQTEGINSEEALNHLGEIGTKTTLRYSVQLL--
2an9A           AERLRMSRQKQRHDALISK---------------
2ahwD           MQVQKMVKKATLHPKSVRI---------------
3bs4A           RADYVLKTRS------------------------
1e9rG           IRSWLEDPNGGNLFITWREDMGPALRPLISAW--
1av6A           IVRNKVVNQEYDYFHMYFMLRTVYCNKTFPTT--
2b8tD           VPNRPYLNSNSEEFIKFFKNKKR-----------
2e85A           IFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGW
2a1fE           MNRVVGDHMGMLATVMNGLAMRDSLFRAD-----
3dyoA           VDVEVASDTPHPARIGLNCQLAQ-----------
3cnlA           ----------------------------------
1e9sH           IRSWLEDPNGGNLFITWREDMGPALRPLISAWVD
1cs4C           ----------------------------------
3a00A           ----------------------------------
2ccjA           VNADQPLENVVEDQTIIKYLEK------------
3di4A           FAPAEGLGDWPSPSVNGY----------------
1e2iA           LSGTGPRPHDTLFTLFRAPELLAPNGDLYNVFAW
3d3qA           LGHGLFNEVQHLVEQGFEASQSQA----------
2ancB           AERLRMSRQQRHDALISKL---------------
2dpyA           ----------------------------------
3cioD           ----------------------------------
1e1qB           PAINVGLSVSRVGSAAQTRAMKQVAGTMKLEL--
1dp0A           DVEVASDTPHPARIGLNCQLAQVAERVNWLGLGP
3bczC           LDKGSIIEQLDPVSFSNYLKKYHNT---------
2bkeA           SRGNRRIARVVDAPHLPEGE--------------
3cmuA           IGA-------------------------------
3bjqB           GYEGDPYSIVPSALEAKVPRELRDASQVPGIDLG
3bb1H           ENSGRCNKNDSDEKVLPNGIAWI-----------
2ancD           AERLRMSRQKQRHDALIS----------------
1dekA           RAMGATVIHVVRPGQKSNDTHITEAGLPIRD---
3bm2B           CREQDKIVLGTPQLVPDPTP------FVTYFHH-
2ancF           ----------------------------------
3bwdD           ----------------------------------
3cbqA           ----------------------------------
3dvlD           VSDNVVILRNVLEGERRRR---------------
2awoD           IRPEHLLPSDIADVILEGEVQVV-----------
2ahvA           QVQKMVKKATLHPKSVRIPGYLVDIVVVDPDQSQ
1culC           ----------------------------------
2a1fC           MNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKL
1e9sL           IRSWLEDPNGGNLFITWREDMGPALRPLISAW--
2d7vA           ----------------------------------
2czvB           ----------------------------------
3dm5B           AATGAPIKFIGTGEKIDDIEPFDPPRFVSRLL--
2a78A           ----------------------------------
1d6jA           ----------------------------------
1e2hB           LQCGGSWREDWGQLSGPQSNAGPRPHIGDTLFTL
2d7vB           ----------------------------------
2cbzA           MSGGKISEMGSYQELLARD--GAFAEFLRTYA--
2e85B           IFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGW
1dw9A           ----------------------------------
2a5vA           ----------------------------------
3brwA           QRKRHIGNDI-VAVVFQDENTPFVPDMI------
1dvrA           PIVDFYKKTGIWAGVDASQPPATVWADILNKL--
1chdA           LCQISVKEAEDGERVL------------------
2dftC           ----------------------------------
2dftA           ----------------------------------
3e70C           YVIDAPILFVGVGQGYDDLRPFEKEWFLERIF--
3ed8A           ----------------------------------
3cr7B           ----------------------------------
3a00B           ----------------------------------
1ckvA           ----------------------------------
2a5vB           ----------------------------------
1c9kC           VVSGIGVK--------------------------
3dmdA           YVIDAPILFVGVGQGYDDLRPFEKEWFLERIF--
2b0lC           IESRSLGMKGTYIKVLNNKFLIELENL-------
2bboA           LHEGSSYFYGTFSELQ-NLQPDFSSKLMSFDQ--
2aexA           GGISCVLQDGCVFEKAGSISVVHGNLSEEAAKQM
1bccF           ----------------------------------
1afrA           LAFADMMRKKISMPAH------------------
3bb1D           ----------------------------------
1cjuC           ----------------------------------
2c5mD           EPQVCVIELGTVGDIESMPFIEAFRQFQFKVKRE
1e2nB           LQCGGSWREDWGQLSG------------------
2a5fA           ----------------------------------
3c15C           ----------------------------------
3dfdA           ----------------------------------
3c14C           ----------------------------------
3e8aC           ----------------------------------
1e9sA           IRSWLEDPNGGNLFITWREDMGPALRPLISAWVD
3do6A           ----------------------------------
1agpA           ----------------------------------
2c9gA           ----------------------------------
1e2nA           LQCGGSWREDWGQLSGPRPHIGDT----------
2dx7A           IDPMDVIAEVAVKVALEK----------------
2cdnA           ----------------------------------
1d6aA           ----------------------------------
1e2iB           RERLDLAMLAAIRRVYGLLANT------------
3ci2A           FVDKLDNIAQVP----------------------
3c7kC           FDVGGQRSERKKWIHCFEDVTAIIFCV-------
1e2lB           ----------------------------------
3cnnA           ----------------------------------
1ckeA           STTLSIEQ--------------------------
3c85A           ----------------------------------
3c7kA           ----------------------------------
3dkvA           ----------------------------------
1azsC           ----------------------------------
1dwmA           IVNDHGVVTSVP----------------------
3cqcA           ERHKLY-------LVFSK---EELRKLLQKL---
1e9rB           ----------------------------------
2bhvC           ----------------------------------
3cd9A           ----------------------------------
1d2zD           ----------------------------------
1d8jA           ----------------------------------
3b85B           ----------------------------------
1e2lA           LQCGGSWREDWGQLSGPRP---------------
1e2jA           LQCGGSWREDWGQLSGPRPHIGDTLFTLFRAP--
3csuA           EKGIAWSLHSSIEEVM------------------
1e2mB           ----------------------------------
2axnA           YQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHI
2b6hA           ----------------------------------
1cjvC           ----------------------------------
1a2kD           ---EVVMDPALAAQYEHDLEVAQT----------
2c9oA           KYIDQGIAELVPGVLFVDEV--------------
1e2kB           ----------------------------------
1e2mA           ----------------------------------
2bwjB           ----------------------------------
1e9sK           LSDKLPEHVTMPDGDFSIR---------------
2bwjD           ----------------------------------
2c95B           ----------------------------------
1e2jB           ----------------------------------
1e2hA           LQCGGSWREDWGQLSGPRP---------------
3cddE           ----------------------------------
1e6vC           I---------------------------------
3cddB           KGGIKADVTDSEIGRIIVNEEVTTAEGAAKRGQW
3cr8B           DGEGYMLAILTLSDVWKDGERWHLAGEVEGAALP
2c5mB           IPVDEPIELGGTVDIESMPFIEAFRQFQFKVKRE
2bsqH           ----------------------------------
3dzvA           VDLVGYGASDIRNEVGEK----------------
3dsrB           ----------------------------------
2c9oB           ----------------------------------
1a2kE           ---EVVMDPALAAQYEHDLEVA------------
2bwjF           ----------------------------------
1dxrH           KKDKIVVTSILSEQFANVPRLQSRLREEDKVSAY
1dapA           ----------------------------------
2bsqE           ----------------------------------
3ea5C           ----------------------------------
2cxxA           ----------------------------------
3e2iA           ----------------------------------
1delA           ----------------------------------
3cddA           RYRPLIIVNEEVTAEGAA----------------
1as2A           ----------------------------------
2cxxC           ----------------------------------
1as0A           ----------------------------------