[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81275.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "2bteA.bssp"
#ERROR : Can't open dsspfile "2c1wC.bssp"
#ERROR : Can't open dsspfile "1bs2A.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "1e7zA.bssp"
#ERROR : Can't open dsspfile "3bicA.bssp"
#ERROR : Can't open dsspfile "2e8gA.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "2cwpA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "3bu2A.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "2c1wB.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"
#ERROR : Can't open dsspfile "1b70B.bssp"
#ERROR : Can't open dsspfile "3cglD.bssp"
#ERROR : Can't open dsspfile "1cjyB.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "3cglC.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "2arlA.bssp"
#ERROR : Can't open dsspfile "2c1sA.bssp"
#ERROR : Can't open dsspfile "1ei5A.bssp"
#ERROR : Can't open dsspfile "3c98A.bssp"
#ERROR : Can't open dsspfile "1cv7A.bssp"
#ERROR : Can't open dsspfile "2aekA.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"
#ERROR : Can't open dsspfile "3c5fA.bssp"
#ERROR : Can't open dsspfile "2bcrA.bssp"
#ERROR : Can't open dsspfile "2bcvA.bssp"
#ERROR : Can't open dsspfile "2bcqA.bssp"
#ERROR : Can't open dsspfile "3eeeA.bssp"
#ERROR : Can't open dsspfile "2ab5B.bssp"
#ERROR : Can't open dsspfile "2c1qA.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "2aelA.bssp"
#ERROR : Can't open dsspfile "2aelB.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "1b71A.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "3e4cB.bssp"
#ERROR : Can't open dsspfile "2cycA.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "2bvtA.bssp"
#ERROR : Can't open dsspfile "3cfiJ.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"

## Summary of PDB Search
:618
    7e-88  97%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    3e-87  97%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    3e-83  98%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    9e-56  39%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    4e-48  41%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    5e-44  14%  2bteA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    1e-40  13%  2c1wC  [x.x.x] ENDOU PROTEIN
    8e-40  12%  1bs2A  [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)
    4e-34  15%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    1e-32  14%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    5e-32  35%  1e7zA  [b.40.4] ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
    8e-30  11%  3bicA  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    1e-29  17%  2e8gA  [x.x.x] HYPOTHETICAL PROTEIN PH0536
    4e-29  12%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    1e-27  12%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    6e-27  45%  2cwpA  [x.x.x] METRS RELATED PROTEIN
    7e-26  11%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    9e-26  25%  3bu2A  [x.x.x] PUTATIVE TRNA-BINDING PROTEIN
    1e-24   7%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    2e-24   8%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    2e-24  10%  2c1wB  [x.x.x] ENDOU PROTEIN
    6e-24  13%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    1e-23  29%  1b70B  [a.6.1 - b.40.4 - b.153.1 - a.6.1 - d.104.1 - d.58.13]
    3e-23  10%  3cglD  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    4e-23  10%  1cjyB  [b.7.1 - c.19.1] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2)
    1e-22  13%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    1e-22   9%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    1e-21   7%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-21  11%  3cglC  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    2e-19   8%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-16  20%  2arlA  [x.x.x] GFP-LIKE NON-FLUORESCENT CHROMOPROTEIN
    2e-15  11%  2c1sA  [x.x.x] BIOTIN BINDING PROTEIN A
    2e-15  10%  1ei5A  [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
    3e-15   8%  3c98A  [e.25.1 (1dn1A)] SYNTAXIN-BINDING PROTEIN 1
    9e-15  10%  1cv7A  [d.22.1] GREEN FLUORESCENT PROTEIN
    2e-14   9%  2aekA  [x.x.x] TRICHODIENE SYNTHASE
    2e-14  12%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    4e-14  13%  3c5fA  [x.x.x] DNA POLYMERASE LAMBDA
    4e-14  14%  2bcrA  [x.x.x] DNA POLYMERASE LAMBDA
    6e-14  14%  2bcvA  [x.x.x] DNA POLYMERASE LAMBDA
    1e-13  14%  2bcqA  [x.x.x] DNA POLYMERASE LAMBDA
    3e-13  15%  3eeeA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    7e-13   8%  2ab5B  [x.x.x] MRNA MATURASE
    8e-13  12%  2c1qA  [x.x.x] BIOTIN BINDING PROTEIN A
    2e-12   9%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-12   8%  2aelA  [x.x.x] TRICHODIENE SYNTHASE
    3e-12   8%  2aelB  [x.x.x] TRICHODIENE SYNTHASE
    3e-12   9%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    4e-12  11%  1b71A  [a.25.1 - g.41.5] PROTEIN (RUBRERYTHRIN)
    2e-11  13%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-09   7%  3e4cB  [x.x.x] CASPASE-1
    1e-08   6%  2cycA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    9e-08  10%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-06  11%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    7e-06  13%  2bvtA  [x.x.x] BETA-1,4-MANNANASE
    8e-05   2%  3cfiJ  [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSI
    1e-04  10%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
:618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
2d5bA           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
2d54A           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
1a8hA           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
2ct8A           ----FYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKEL
2csxA           --KKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKEL
2bteA           -------------------------------------------------YEEPGIMVNSGPFDGTESEEG
2c1wC           ---RISLQGKAGYVSFPLFQFVEEKLKSRKTFATFISLLDN-YEMDTGVAEVVTPEEIAENNN------F
1bs2A           --KKVIIEFSSPNIAKPFHAGHLRSTIIGGFLANLYEKLGWEVIRMNYLGDWGKQFGLLAFERYGNEEAL
3c8zA           -GPTATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTL
3c8zB           -GPTATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTL
1e7zA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2amvA           --NLAENISRVLYPNDNFFEGKEVAATLQDIIRRFKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSVL
2cwpA           ----------------------------------------------------------------------
1c8kA           --NLAENISRVLYPNDNFFEGKEVAATLQDIIRRFKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSVL
3bu2A           ----------------------------------------------------------------------
1d2rA           ------------QPSGVITIGNYIGALRQFVELQH----EYNCYFCIVDQ-HAITVWQDPHELRQNIRRL
1axrA           --NLAENISRVLYPNDNFFEGKEVAATLQDIIRR-FKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLA
2c1wB           ----LFQFVDEEKLKSRKTFAT-------------FISLLDNYEMDTGVAEVVTPEEIA------ENNNF
2cfoA           -----VRVRLAPSPTGNLHIGTARTAVFNWLYARHRG--GKFILRIEDTD----------------RERS
1b70B           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2cfoB           -----VRVRLAPSPTGNLHIGTARTAVFNWLYARHRG------------------GKFILRIEDTDRERS
1abbA           DRNLAENISRVLYPEKELRLKQEYFVVAADIIRRFKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLA
3e3nF           -IQAVLDRNLAENISRVLYGKELRLKQEYFVVAATFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLA
3cglC           ----------------------------------------------------------------------
3dl5B           --RESFPLLTTKKVFIRSIFEELIWFIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREENDLGP--
2arlA           ----------------------------------------------------------------------
2c1sA           -TFSGSYQTAVTATNKQILVSPLKGAQQPPGTKGQQPTFGFTVFADSTTVFVGQCFVDRRGKEMLEMAWL
1ei5A           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2aekA           ----QISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAKDPQVMDTIECFMHGYVTWHLCDRKY----
3egbB           ---VEYTHDKDTDMFQVGRSTESIDFVVTDTQITQSTISRF--ACRIVCDRNEPYTARIFAAGFDSSKNI
3c5fA           -----------------------------DIIVVPYSEFACALLYFTGSAHFNRSMAALAKTKGMSLSEH
2bcrA           -----------------------------DIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSE-
2bcvA           -----------------------------DIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSE-
2bcqA           -----------------------------DIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSE-
3eeeA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2c1qA           --------------------------------------TVQWQFADSTTVFVGQCFVDRRGKEMLEMAWL
2azxA           ENKKPFYLYTGRGPSSEAHVGHLIPFIFTKWLQD----VFNVPLVIQTDDE--------KYLWKDLTLDQ
2aelA           ----QISLVKNYVVSDEISLHEALEKLTQDTLHSSKQFSDKDPQVMDTIECFMHGYVTWHLCDRKYRLSE
2aelB           ----QISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMSDKDPQVMDTIECFMHGYVTWHLCDRKYRLSE
2dlcX           --RHLKLYWGTA-PTGRPHCGYFVP----MTKLADFLKAGCEVTVLLADLHAFL---DNMKAPLEVVNYR
1b71A           ----------------------------ISDIFAETADQEREHAKRLFKFLEGGDLEIVAAFPAGIIADT
2cybB           ----------------------------------------------------------------------
3e4cB           --RLALIICNEEF----DSIPRRTGAEVITGMTMLLQNLGYSVDVKKTASDMTTELEAFAHRPEHKTSDS
2cycA           IGAPLQHYIGFEI-SGYIHLGTGLMA---GAKIADFQKAGIKTRVFLADW-HSWINDKLGGDLEVIQEVA
2ag6A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3cfiJ           -------------------------------INTVGYLEQKMFA---AMVADNQMAMVMLNPKNGQTWYW
1b25A           MDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSEYYRIRGWDERGIPKKE--------------------


                         .         .         *         .         .         .         .:140
query           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
2d5bA           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELV
2d54A           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELV
1a8hA           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELV
2ct8A           VDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLL
2csxA           VDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYKEPSYFFRLSKYQDKLLE
2bteA           KRKVIAWLEEKGLGKGRVTYRLRDWLISRQRYWGTPIPMVHCEACGVIRPKGKSPLEAHPEFYETTCPKC
2c1wC           LDAILETKVMKMAHDYLVRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGES-------
1bs2A           VKDPIHHLFDVYVRINKDIEEDSIPLEQSTNGKAREYFKRMEDGDEEALKIWKRFREFSIEKYIDTYA--
3c8zA           GDRETQLFREDMAALRVLPPHD-YVAATDAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGY
3c8zB           GDRETQLFREDMAALRVLPPHDYVAATD-AIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRAD-------
1e7zA           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
2amvA           VDLERLDWDKAWEVTVKTCAYTHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGMSLV
2cwpA           ----------------------------------------------------------------------
1c8kA           VDLERLDWDKAWEVVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAALRRMSLV
3bu2A           ----------------------------------------------------------------------
1d2rA           AALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGAAAAAAGLLTYPPLMAA
1axrA           IPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVA
2c1wB           LDAILETKVMKMAHDYLVRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGES-------
2cfoA           RPEYTENILEGLQWLGLTWDEGPYFQSDRLDLY--------RQAIQTLLDKGLAYYCYCTPEELEALRAE
1b70B           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2cfoB           RPEYTENILEGLQWLGLTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCY-----CTPEELEALRAEQKA
1abbA           IPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNR-V
3e3nF           IPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVA
3cglC           ----------------------------------------------------------------------
3dl5B           ------IYGFQWRHYNGEYKTMHDDYTGVGVDQLAKLIETLKNNPKDRPSALSQMALPPCHVLSQYYVTN
2arlA           ----------------------------------------------------------------------
2c1sA           LREEVPSRKDTWKATRVGTNVFTR----------------------------------------------
1ei5A           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2aekA           ------------------RLSEIYEKVKEEKTEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN----
3egbB           FLGEKAKWKNPDGHMDGLTTNGVLVMHPRQPGVWREI----SVCGDVYT--LRETRSAQQRGKETNVLQD
3c5fA           ALS--TAVVRNTHGCKVGPGRVLPTPTEKDVFRLL---------GLPYREPAE-----------------
2bcrA           -HALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR---------LLGLPYREPAE-----------------
2bcvA           -HALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR---------LLGLPYREPAE-----------------
2bcqA           -HALSTAVVRNTHGCKVGPGRVLPTPTEKDVFR---------LLGLPYREPAE-----------------
3eeeA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2c1qA           LREEVPSRKDTWKATRVGTNVFTR----------------------------------------------
2azxA           AYGDAVENAKDIIACGFDINKTFIFSDLDYGSSGFYKNVVKIQKHVTFN------QVKGIFGFTDSDCIG
2aelA           KTEDAQKFCKFYEQAANVGSPSEWAYPPVA----------------------------------------
2aelB           KTEDAQKFCKFYEQAANVGSPSEWAYPPVA----------------------------------------
2dlcX           AKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVGLIYPLMQAL
1b71A           HANLIASAAGEHHEYTEMYPSFARIAREEGYEEIARVFASIAVAEEFHEKRFLDFRCRNCGYVHEGTGAP
2cybB           -------------------------------------------------------PRAYVGYEPSGEIHL
3e4cB           TFLVFMSHGIREGICGKKHSEQVPD---------------------------------------------
2cycA           LKYFKVGMEKSIEVMGGDPKKVEFVLASEILEKGDYWQTVIDISKNVTLSRVMRSITIMGRQMGEAIDFA
2ag6A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------SGEIHL
2bvtA           ---------------------------------------------------------------ALFADYI
3cfiJ           KVAPVATTQPLLKAFDVSVAKQASPIIT------------------------------------------
1b25A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
2d5bA           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
2d54A           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
1a8hA           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
2ct8A           ELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTR-------------------------------PRSRV
2csxA           LYEKNPEFQPDYRRNEIISFVKQGLKDLSVTR---------------------------------PRSRV
2bteA           GGPAKRDTDTMDTFFDSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYIG---GVEHAVLHLLYSRFF---
2c1wC           -----KRGQEMMGLHNWVQFYLQEKRKNIDYKGYVARQNKSRPDEDDQVLNLQF----NWKEMVKPVGSS
1bs2A           ----------RLNIKYDVYSGESQVSKESMLKAIDLFKEKGLTHEDKGAVL-------------------
3c8zA           ESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERP------------------------GEPSWPS
3c8zB           --ATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDA------------LLWRAERPGEPSWPSPFG
1e7zA           ----------------------------------------------------------------------
3bicA           -------------------AALAKKQLKNPEDLIWHTPEGISPLYSKRDTMDLPEELPGYPTMYTFR---
2e8gA           ----------------------------------------------------------------------
3bicB           ------------------WAALAKKQLKNPEDLIWHTPESIKPLYSKRDTMDLPEELPGYPTMYTFR---
2amvA           EEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAE
2cwpA           ----------------------------------------------------------------------
1c8kA           EEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAE
3bu2A           ----------------------------------------------------------------------
1d2rA           DILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGAR-IMSLVDPTKKMSKSDPNP
1axrA           DRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY--ELEPHKFQNKTNGITPRR
2c1wB           -----KRGQEMMGLHNWVQFYLQEKRKNIDYKGYVARQNKSRPDEDDQVLN-------------------
2cfoA           QKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVSWQGADLGGDMVIARA
1b70B           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
1cjyB           ---DIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGLFGS
2cfoB           KGQAPRYDN----------RHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVS--------
1abbA           AAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF--QNK
3e3nF           AAFPGDVDR--LRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKT
3cglC           --------------------------------------------------------EIKGKGKGQPNEGT
3dl5B           DNSCNLYQRSCD-LGLGSPFNIASYAI--LTMMLAQVCGYEPGE--------------------------
2arlA           ------------------------------------------------------------------KLTV
2c1sA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
1cv7A           -------------------------------------------------------SGEGEGDATYGKLTL
2aekA           ----------------------------------------------------------------------
3egbB           GSLIDLCGATLLWRTADGLFHTPTQKH-------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3eeeA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
2azxA           KISFPAIAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRTRDVAPRIGYPKPAL------LHSTFFPA
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2dlcX           DEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEP----KQVKKKINS
1b71A           -ELCPACAHPKAELLGINW---------------------------------------------------
2cybB           GHMMTVQKLMDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGSEYQLSRDYVLDVLKM
3e4cB           ----------------------------------------------------------------------
2cycA           KLIYPMMQVADIFYQGVTIAHAGMDQRKAHVIAIEVAQ--------------------------------
2ag6A           ------FDIIILLADLHAYLNQKGE-LDEIRKIGDYNKKVFEAMGLKAKYVYGSSFQLDKD-YTLNVYRL
2cybA           GHMMTVQKLMDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGLDESR--AKFVLGSEY
2bvtA           RKADAIGGVNTVSAHVENFVTGGSFYDT----SGDTLRAVLPGGSHHAELVAYLD----DIAELADASRR
3cfiJ           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
2d5bA           PWGIPLPWDENHVTFVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
2d54A           PWGIPLPWDENHVTAVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
1a8hA           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
2ct8A           KWGIPVPFDPEHTIYVWFDALFNYI----SALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYEL
2csxA           KWGIPVPFDPEHTIYVWFDALFNYISALED----KVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYEL
2bteA           ------TKFLHDLGMVKVEEPFQGLFTQGMVLAWTDFGPEGSVVRLPEPTRIRLPESALSLEDVRKMGAE
2c1wC           FIGV-SPEFEFALYTIVFLASQEKMSREVVREYELQIVVNRHGRYI---------GTAYPVLLST-----
1bs2A           IDLTKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDRYEKYHFDKMIYVIASQQDLHAAQFFEILKQMGFEW
3c8zA           PFGRGRPGWHVECSAIAL-----------------TRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTRRF
3c8zB           RGRPGWHVECSAIALTRI--------------------GTGLDIQGGGSDLIFPHHEYSAAHAESGERRF
1e7zA           ----------------------------------------------------------------------
3bicA           PWTIRQYAGKQQGLSVAFDLATHRGYDSDNPRGDVGMAGVAI--DTVEDTKILFDGIPLEKMSVSMTMNG
2e8gA           ----------------------------------------------------------------------
3bicB           PWTIRQYAGKQQGLSVAFDLATHRGYDSDNPRGDVGMAGVAIDTVEDTKILF--DGIPLEKMSVSMTMNG
2amvA           -IIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEY
2cwpA           ----------------------------------------------------------------------
1c8kA           -IIAERIGEEYISDLDQLRKLLSYVDDEAFIRAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHE
3bu2A           ----------------------------------------------------------------------
1d2rA           KAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADL
1axrA           WLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDEAFIRDVAKVKQENKLKFAAYLEREYKVHNPNSL
2c1wB           ----------------------------------------------------------------------
2cfoA           APRGEIGYPLYNLVVVVDDIAMGIT-------------------DVIRGEDHIGNTPKQILLYEALGATP
1b70B           ----------------------------------------------------------------------
3cglD           TNTVTLEVTKGGPLPFGWHILCPQKAFVHHPDNDYLKLSFPEGYTWERSMHFEDGGLCCITNDISLTGFY
1cjyB           KFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRGSTMEEELENITTKHIVSWIHRMIMALVSDSALNTRE
2cfoB           -------WQGADLGGDMVIARAAPRGEIGYPLYNLVVVVDDIAMDVIRGEDHIGNTPKQILLYEALGATP
1abbA           TNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDD-------------------------
3e3nF           NGITPRRWL--VLCNPGLAEIIAERIGEEYDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREY
3cglC           NTV-TLEVTKGGPLPFGWHILCPQFNKVHHPDNIHLKLSFPEGYTWERSMHFEDGGLCCITNDISLGNCF
3dl5B           ----------------------------------------------------------------------
2arlA           TKGGPLP--------FAWDILSPSIPFTKYPEDDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIGNCF
2c1sA           ----------------------------------------------------------------------
1ei5A           GASEVAFKLMNIALGVSSSEVSRVEADSAWFGSWLDDETGLVLSLEDAGHGRMKARFGTSPEMRSAVTTI
3c98A           -------------------------------------SMRMLSSCCKMTDIM-TEGITIVEDINKRREPL
1cv7A           KTTGKLPVPW-PTLVTTLVQCFSRYPDHMKQH-DFFKSAMPEGYVQERTIFFKDDGNYTRAEVKFEGDTL
2aekA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3eeeA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
2azxA           LQGAQTKSASDPNSSIFLTDTAKQIKKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFYLTFFLEDDDKLEQ
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2dlcX           AFCSPGNVEENGLLSFVQYVIAPIQELKFGHFEFFIDRPEKFGGPITYKSFEEMKLAF------------
1b71A           ----------------------------------------------------------------------
2cybB           ARITTLNRARRSMDEVSRRKEDPMVSQMIYPLMQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLGYSS
3e4cB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2ag6A           ALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNPLHYEGVDVVGGMEQRK-----IHMLARELLPKK
2cybA           QLSRDYVLDVLKMARITTLNRARRSMDEVSRRKEDPMVSQMIYPLMQALDIAHLGVDLAVRENLPRLGYS
2bvtA           DDGTLIPIVEYLRDVKGVSNFLYAWGPGGGFGGDVYLRTYPGDAFVDVLGLDTYDSDAFLAGLVADLRMI
3cfiJ           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
2d5bA           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
2d54A           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
1a8hA           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
2ct8A           PKKVFAHGWWTV-EGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELA
2csxA           PKKVFAHGW-WTVEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELA
2bteA           LRPHEDGTLHLW-KPAVMSKSKGNGVMVGPFVKEQGADIARITILFAAPPENEMVWTEEGVQGAW--RFL
2c1wC           ----------------------------------------------------------------------
1bs2A           AKDLQHVNFG---MVQGMSTRKGTVVFLDNILEETKEKMHEVMKKNENKYAQIEHPEEERMLSFEGDTGP
3c8zA           ARHYVHTGM-IGVLVSQLRA------------QGVDPSAIRLGLFS-GHYREDRFWSNEVLDEAN--ARL
3c8zB           ARHYVHTGM-IGVLVSQLRA------------QGVDPSAIRLGLFS-GHYREDRFWSNEVLDEA--NARL
1e7zA           ----------------------------------------------------------------------
3bicA           VIPVLANF---------IVTGEEQGVPKEKLTGTIQNDILKEFMVR-NTYIFPPEPSMKIIADIFEYTAK
2e8gA           ----------------------------------------------------------------------
3bicB           VIPVLANF---------IVTGEEQGVPKEKLTGTIQNDILKEFMVR-NTYIFPPEPSMKIIADIFEYTAK
2amvA           KRQLLNCLHVI-TLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITA-----------------
2cwpA           ----------------------------------------------------------------------
1c8kA           Y-KRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVV-----------
3bu2A           ----------------------------------------------------------------------
1d2rA           AQVVI-----------------------------------------------------------------
1axrA           FDVQVKRI--HEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTV---------------------------
2c1wB           ----------------------------------------------------------------------
2cfoA           PNFAHTPLIL-NSTGQKLSKRDGVTSISDFRAMGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKHFSF
1b70B           ----------------------------------------------------------------------
3cglD           YDIKFTGLNF-PPNGPVVQKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGG-----------------
1cjyB           GRAGKVHNFMLGLNDVKSSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELAEKWAKMNKLP
2cfoB           PNFAHTPLIL-NSTGQKLSKRDGVTSISDFRAMGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKHFSF
1abbA           ----------------------------------------------------------------------
3e3nF           KVHINPNSLFDVQVKR------------------------------------------------------
3cglC           YYDIKFTGLNFPPNGPVVQKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGG-----------------
3dl5B           ----------------------------------------------------------------------
2arlA           TYHVKFSGLNFPPNGPVMQKKTQGWEPSSERLFARGGMLIGNNFMALKLEGGG-----------------
2c1sA           ----------------------------------------------------------------------
1ei5A           RRDGETIELVRASENLRLSMKRVKGEAKHDIIGRYHSDELDADLLLVSEGGAIYGAFEGFLGK------S
3c98A           -PSLEAVYLIT-PSEKSVHSLISDFKDP------PTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTL
1cv7A           VNRIELKGIDFKEDGNILGHKLEYNYISHNVITADKQKNGIKAHFKIRHNIEDGSV--------------
2aekA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3eeeA           ------------------------------LRDLYGNDVVDESL-KSVGWEPDRITPLEDIDDDEVRRIF
2ab5B           -------GLFEGDGWITISKKGKYLLYELGIEHIRDIQLLYKIKNILGIKKLKKDGTIKECKFNVRKNHL
2c1qA           ----------------------------------------------------------------------
2azxA           IRKDYTSGALTGELKKALIEVLQPLIAEHQARRKEVTDEIVK----------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
1b71A           ----------------------------------------------------------------------
2cybB           PVCLHTPILV-GLDGQKMSSSKGNYISVRDPPEEVERKIRKAYCPAGVVEENP-----------------
3e4cB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2ag6A           VVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYF-LEYPLTIK
2cybA           SPVCLHTPILVGLDGQKMSSSKGNYISVRDPPEEVERKIRKAYC--------------------------
2bvtA           AEIVGTNGSSPAQWFTKVLAAIKADPVAAYMETWANFDAGQHFV--------------------------
3cfiJ           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAKRLRPLVRELKFHVALEEAMAYVKALNRYINE
2d5bA           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNRYINE
2d54A           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNRYINE
1a8hA           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNRYINE
2ct8A           NEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDE
2csxA           NEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDE
2bteA           NRIYRRVAEDREALLETSGVFQAEALEGKDYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKD
2c1wC           ----------------------------------------------------------------------
1bs2A           YLQYAHSRLRSVERNASGITQEKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVSSCYDV
3c8zA           ARWRSATALPEAPDATDVIARVRQ------------------YLADDLDTPKALAALDGWCTDALSYGGH
3c8zB           ARWRSATALPEAPDATDVIARVRQ------------------YLADDLDTPKALAALDGWCTDALSYGGH
1e7zA           ----------------------------------------------------------------------
3bicA           --HMPKFNSISISGYHMQE---AGADAILELAYTLADGLEYSRTGLQAGLTIFAPRLSFFWGIGMNFYME
2e8gA           ------------------------------------------------DTSKDYRL-LVAEKSVELFIRT
3bicB           --HMPKFNSISISGYHMQE---AGADAILELAYTLADGLEYSRTGLQAGLTIFAPRLSFFWGIGMNFYME
2amvA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1c8kA           ----------------------------------------------------------------------
3bu2A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
2cfoA           ERINKAGARFDWDKLNWLNRQYIQQLEPEEFAELIPLWQGAGYAFDEERDRPWLFDLAQLLQPGLNTLRE
1b70B           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
1cjyB           FPKIDPYVFDCYVFKPDCPTIIHFVLANINFRKYAPGVPRETEEEKEIA-DFDIFDDPESPFSTFNQYPN
2cfoB           ERINKAGARFDWDKLNWLNRQYIQQLEPEEFAELIPLWQGAGYAFDEERDRPWLFDLAQLLQPGLNTLRE
1abbA           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
1ei5A           DMYPLYSVGSDVWLLPVQRSMDAPSPGEWKLVFRRDDKGEITGLSVG----CWLARGVEYRRV-------
3c98A           TEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKA
1cv7A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3eeeA           AKVSEKTGKNVNEIWREVGRQNIKTFSEW--------FPSYFAGRRLVNFLMMMDEVHLQLT--KMIKGA
2ab5B           KNIIIPIFNKYPLTNKHYDYLYFKDNLLKDLSYYLRPIKPFNTTEDILNKNYFSSWLIGFFEAKCFSIYK
2c1qA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
1b71A           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2ag6A           RPEKFGGDLTVNSYEELESLFKNKELHPMDL--KNAVAEELIKILEP-----------------------
2cybA           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
2d5bA           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
2d54A           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
1a8hA           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
2ct8A           KQPWALNKERKKEELKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLKE---LKPYSKNTYKLG
2csxA           KQPWALNKERKKEELKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLK---ELKPYSKNTYKLG
2bteA           RPVTPVYRTAIRYYLQMLFPFAHWFWPDSLFEAG-----WPELDEKALEKDVVEVAVQVNGRVRGTIHIP
2c1wC           ----------------------------------------------------------------------
1bs2A           LWVAGQTEELATARLALYGAARQVLYNGMRLLGLTPVERM------------------------------
3c8zA           DTESPRLVATTVDALLGVD---------------------------------------------------
3c8zB           DTESPRLVATTVDALLGVD---------------------------------------------------
1e7zA           ----------------------------------------------------------------------
3bicA           IAKMRAGRRLWAHSLLLRAHCQTSGWSEQDPYNNIVRTAIEAMAAVFGGTQSLHT---NSFDEALGLPTV
2e8gA           IEGAKFRGQWDKKRSLAKEMIPDIQALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKFLSQA
3bicB           IAKMRAGRRLWAHLKMFQPKNSKSLLLRAHCQTSGWS---------------------------------
2amvA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1c8kA           ----------------------------------------------------------------------
3bu2A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
2cfoA           AIDQVFFIPSVAMAQLGQPQSATILAYLLEHLPAEPALTVAMGQQLI-----------------------
1b70B           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
1cjyB           QAFKRLHDLMHFNTLNNIDVIKEAMVES------------------------------------------
2cfoB           AIDQVFFIPSVEAMAQLGQPQSATILAYLLHLPAEPALTVAMGQQLI-----------------------
1abbA           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3c98A           DDPTMGEGPD------KARSQ---LLILDRGFDPSSPVLHELTFQAMS--YDLLPIENDVYKYETSGIGE
1cv7A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3eeeA           TPARLIAKPVAKDAIEMEYVSKRKMYDYFLGLIEGS---------SKFFKEEISVEEVER----------
2ab5B           KTASFEVSNNNVLAIKSYLKI-------------------------------------------------
2c1qA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
1b71A           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEAPVLFXXXXXXXXXXXXXXXWIGIEDFAKVELRVAEVLAAEKHPNADRLLVLRLSLGNEERTVVSGIA
2d5bA           EEAPVLF---------------------------------------------------------------
2d54A           EEAPVLF---------------------------------------------------------------
1a8hA           EEAPVLF---------------------------------------------------------------
2ct8A           ERKI------------------------------------------------------------------
2csxA           ERKI------------------------------------------------------------------
2bteA           KDAPL------------EVARAEALKVRNVRAHLEGKEVVKEIYVPG-----------------------
2c1wC           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
1e7zA           -------------------------PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIARTVVSGLV
3bicA           KSA-------------------------------------------------------------------
2e8gA           SREDREKVEEQVARIKFFLNTIGKINDPVIAVDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTND-
3bicB           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
2cwpA           -----------------------YDVDEFWKFQMKVGLVKKAEKIKRTKKLIKLIVDFGNEERTIVTGIA
1c8kA           ----------------------------------------------------------------------
3bu2A           ----------------------AAGFTADFTPKFVVGYVETKDKHPDADKLSVLSVDVATEKLQIVCGAP
1d2rA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
1b70B           -----------------------IERVFPIPRGVVFARVLEAHPIPG-TRLKRLVLDAG-RTVEVVSGAE
3cglD           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
1abbA           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3c98A           AR--------------------------------------------------------------------
1cv7A           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
3eeeA           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
1b71A           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGEALALVTVEGEVPPGAVVK
2d5bA           ----------------------------------------------------------
2d54A           ----------------------------------------------------------
1a8hA           ----------------------------------------------------------
2ct8A           ----------------------------------------------------------
2csxA           ----------------------------------------------------------
2bteA           ----------------------------------------------------------
2c1wC           ----------------------------------------------------------
1bs2A           ----------------------------------------------------------
3c8zA           ----------------------------------------------------------
3c8zB           ----------------------------------------------------------
1e7zA           NHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRI-
3bicA           ----------------------------------------------------------
2e8gA           -----LTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPLE
3bicB           ----------------------------------------------------------
2amvA           ----------------------------------------------------------
2cwpA           DQIPPEELEGKKFIFVVNLKPKKFSGVESQGMLILAETDGKVYLIPVPEEVPVGA---
1c8kA           ----------------------------------------------------------
3bu2A           NVEAGQKVVVAKVGAVPSIKDAELRGVASSGICSKELGAPQEKGIVLSDDYTVGQ---
1d2rA           ----------------------------------------------------------
1axrA           ----------------------------------------------------------
2c1wB           ----------------------------------------------------------
2cfoA           ----------------------------------------------------------
1b70B           NAGVALALPGTEPGLGQKVGERVIQGVRSFGMALSPRE--------------------
3cglD           ----------------------------------------------------------
1cjyB           ----------------------------------------------------------
2cfoB           ----------------------------------------------------------
1abbA           ----------------------------------------------------------
3e3nF           ----------------------------------------------------------
3cglC           ----------------------------------------------------------
3dl5B           ----------------------------------------------------------
2arlA           ----------------------------------------------------------
2c1sA           ----------------------------------------------------------
1ei5A           ----------------------------------------------------------
3c98A           ----------------------------------------------------------
1cv7A           ----------------------------------------------------------
2aekA           ----------------------------------------------------------
3egbB           ----------------------------------------------------------
3c5fA           ----------------------------------------------------------
2bcrA           ----------------------------------------------------------
2bcvA           ----------------------------------------------------------
2bcqA           ----------------------------------------------------------
3eeeA           ----------------------------------------------------------
2ab5B           ----------------------------------------------------------
2c1qA           ----------------------------------------------------------
2azxA           ----------------------------------------------------------
2aelA           ----------------------------------------------------------
2aelB           ----------------------------------------------------------
2dlcX           ----------------------------------------------------------
1b71A           ----------------------------------------------------------
2cybB           ----------------------------------------------------------
3e4cB           ----------------------------------------------------------
2cycA           ----------------------------------------------------------
2ag6A           ----------------------------------------------------------
2cybA           ----------------------------------------------------------
2bvtA           ----------------------------------------------------------
3cfiJ           ----------------------------------------------------------
1b25A           ----------------------------------------------------------