[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81311.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"

## Summary of PDB Search
:259
    2e-32  17%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-30  19%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-29  10%  3cmvG  [x.x.x] PROTEIN RECA
    1e-28   8%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-28   8%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-28  10%  3cmvC  [x.x.x] PROTEIN RECA
    1e-26   8%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-25   9%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-25  12%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-25  18%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    4e-25   7%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-25  12%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-24  10%  3cmvH  [x.x.x] PROTEIN RECA
    2e-24   7%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-24   8%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    9e-24   8%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-23  11%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-23  10%  2akaB  [x.x.x] DYNAMIN-1
    2e-23  12%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-23  10%  3cmvA  [x.x.x] PROTEIN RECA
    4e-23  13%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    6e-23  20%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-22   8%  4dcgA  [x.x.x] VP39
    5e-22  13%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    7e-22   9%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    7e-22   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    1e-21   9%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-21  14%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-21   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    4e-21  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-21   8%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-21  11%  1e0jA  [c.37.1] DNA HELICASE
    9e-21  12%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-20  18%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-20  13%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-20  14%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    2e-20   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-20  19%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-20   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-20   9%  3c8uA  [x.x.x] FRUCTOKINASE
    3e-20   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    4e-20  14%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    7e-20  10%  1e0jB  [c.37.1] DNA HELICASE
    7e-20   6%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-20   8%  2ctsA  [x.x.x] CITRATE SYNTHASE
    9e-20  12%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    9e-20  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-19   9%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-19   8%  2bifA  [c.37.1 - c.60.1] PROTEIN
    3e-19  13%  2cckA  [x.x.x] THYMIDYLATE KINASE
    3e-19  13%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-19   9%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    5e-19  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-19  20%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-19   9%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-19  18%  2d2eA  [x.x.x] SUFC PROTEIN
    8e-19  14%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-19  12%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    8e-19  13%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    9e-19   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-18  10%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-18  14%  3cmwC  [x.x.x] PROTEIN RECA
    2e-18  10%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-18  14%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-18   4%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-18  13%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-18  30%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    5e-18  20%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    5e-18   8%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-18   6%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    5e-18  13%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    6e-18  10%  3cmxA  [x.x.x] PROTEIN RECA
    8e-18   9%  3cmvE  [x.x.x] PROTEIN RECA
    8e-18  19%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-18   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-17  14%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-17  10%  3cmtD  [x.x.x] PROTEIN RECA
    1e-17  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-17  18%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-17   8%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-17  16%  3cmuA  [x.x.x] PROTEIN RECA
    2e-17  28%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-17   9%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-17   7%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    4e-17  12%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    6e-17  15%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    7e-17   9%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    7e-17  11%  3da4A  [x.x.x] COLICIN-M
    9e-17  14%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-16   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-16  13%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-16  13%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-16   7%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    3e-16  13%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-16  13%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-16  14%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-16   9%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    4e-16   7%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-16   9%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-16   7%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    6e-16   9%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    6e-16  11%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-16  14%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-16  13%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-15   7%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-15   8%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-15   8%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    2e-15   8%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-15   9%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-15   9%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-15  13%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15  13%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15  15%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    7e-15  15%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    7e-15   8%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    8e-15  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-14  10%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-14   9%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-14  13%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    2e-14  13%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-14   7%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-14   6%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-14   9%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    3e-14  10%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    3e-14   4%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-14  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    5e-14  11%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    6e-14  11%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    7e-14  11%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    9e-14   9%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    9e-14  14%  3cmvB  [x.x.x] PROTEIN RECA
    1e-13  23%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-13  14%  2c9gA  [x.x.x] PENTON PROTEIN
    1e-13  12%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    1e-13  13%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-13   6%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-13  11%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-13   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    1e-13   5%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-13   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-13   6%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-13   8%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-13   5%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-13   9%  1aroP  [e.8.1] T7 RNA POLYMERASE
    2e-13  11%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    3e-13   5%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-13   9%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    4e-13   5%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    8e-13   8%  2b8tC  [x.x.x] THYMIDINE KINASE
    2e-12  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    2e-12   8%  2axzC  [x.x.x] PRGX
    2e-12   7%  1eamA  [c.66.1] PROTEIN (VP39)
    2e-12  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-12  14%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-12  24%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-12   7%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    3e-12   5%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-12   8%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-12   5%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-12  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-12  20%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    3e-12   7%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    4e-12   9%  3dlbB  [x.x.x] ARGONAUTE
    4e-12   5%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-12  13%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    7e-12   8%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    8e-12  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    8e-12  15%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    8e-12  14%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    8e-12  20%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-12  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    9e-12  11%  1e2kA  [c.37.1] THYMIDINE KINASE
    1e-11   9%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-11  14%  1adoA  [c.1.10] ALDOLASE
    2e-11  13%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-11  13%  3ec1A  [x.x.x] YQEH GTPASE
    2e-11  14%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-11   5%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-11   6%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    3e-11   8%  3bczC  [x.x.x] PROTEIN MEMO1
    3e-11  12%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-11   5%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-11   7%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    4e-11   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    5e-11  10%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    5e-11  11%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-11   8%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    6e-11  13%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-11   7%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    6e-11   9%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    6e-11  22%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    7e-11   5%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    8e-11  18%  2bdtA  [x.x.x] BH3686
    1e-10  11%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-10  13%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-10   8%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-10  12%  3be4A  [x.x.x] ADENYLATE KINASE
    2e-10  11%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-10  13%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    2e-10   8%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-10   9%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-10  13%  3adkA  [x.x.x] ADENYLATE KINASE
    3e-10  13%  2an9A  [x.x.x] GUANYLATE KINASE
    3e-10  12%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    3e-10  19%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-10  17%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-10   8%  3dfdA  [x.x.x] PROTEIN YQBN
    4e-10   5%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-10  18%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    5e-10   8%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    5e-10   9%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    6e-10  13%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-10  14%  2anbA  [x.x.x] GUANYLATE KINASE
    6e-10  15%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-10  14%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-10   8%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-09  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-09   7%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-09   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    1e-09   9%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-09  12%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-09   6%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-09   8%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-09   9%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    2e-09   8%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    2e-09   9%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-09  15%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-09   8%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    3e-09  12%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    4e-09   8%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-09   8%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    4e-09   8%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    4e-09  18%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    4e-09  11%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    5e-09  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-09  13%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-09   9%  1e2hB  [c.37.1] THYMIDINE KINASE
    5e-09  12%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    6e-09   8%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    6e-09  14%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    7e-09  16%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-09  15%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    7e-09  10%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    9e-09  17%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-09  11%  2c9oC  [x.x.x] RUVB-LIKE 1
    9e-09  14%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    9e-09  17%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-08  14%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    1e-08  13%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-08  13%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-08   6%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-08  14%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-08  21%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  18%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-08  15%  2ancD  [x.x.x] GUANYLATE KINASE
    2e-08  10%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    3e-08  16%  1e2jB  [c.37.1] THYMIDINE KINASE
    4e-08  18%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-08  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    4e-08  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-08   8%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-08   9%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    5e-08  15%  2cckB  [x.x.x] THYMIDYLATE KINASE
    5e-08  16%  2ancB  [x.x.x] GUANYLATE KINASE
    5e-08  11%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    6e-08  14%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    7e-08  17%  2ancF  [x.x.x] GUANYLATE KINASE
    1e-07  16%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-07  16%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-07  16%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-07  12%  2a1fD  [x.x.x] URIDYLATE KINASE
    2e-07   7%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-07  14%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-07  14%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-07  12%  421pA  [x.x.x] H-RAS P21 PROTEIN
    2e-07  12%  3dkvA  [x.x.x] ADENYLATE KINASE
    3e-07  10%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    3e-07  15%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    3e-07  13%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-07  13%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-07  14%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    4e-07  16%  1e2lA  [c.37.1] THYMIDINE KINASE
    4e-07   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    4e-07  16%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-07   9%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    4e-07  16%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-07   7%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    4e-07  10%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-07   6%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    4e-07  13%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-07  12%  2bhvD  [x.x.x] COMB10
    5e-07  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-07   9%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    7e-07   5%  2c4rL  [x.x.x] RIBONUCLEASE E
    8e-07  19%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    8e-07  13%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-07  16%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    9e-07   8%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    9e-07  16%  1e2mA  [c.37.1] THYMIDINE KINASE
    9e-07  22%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  16%  1e2nB  [c.37.1] THYMIDINE KINASE
    2e-06  12%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    2e-06  21%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    2e-06  10%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-06   7%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    2e-06   5%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-06  12%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    3e-06  13%  3a00A  [x.x.x] GUANYLATE KINASE
    3e-06  11%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-06  11%  2c9oA  [x.x.x] RUVB-LIKE 1
    5e-06  10%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-06   9%  1e2hA  [c.37.1] THYMIDINE KINASE
    9e-06  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    9e-06  13%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-05  16%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-05  15%  1chdA  [x.x.x] CHEB METHYLESTERASE
    1e-05   5%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    1e-05  12%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-05  24%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    2e-05  12%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-05  21%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-05  10%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-05   7%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-05   7%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    4e-05  14%  1e2nA  [c.37.1] THYMIDINE KINASE
    4e-05  14%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    4e-05  11%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    5e-05  16%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-05   5%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    6e-05  20%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    6e-05  17%  1e2kB  [c.37.1] THYMIDINE KINASE
    6e-05  17%  1e2mB  [c.37.1] THYMIDINE KINASE
    7e-05  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-04  23%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-04   6%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-04  17%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    2e-04  17%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    2e-04  13%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-04  17%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    3e-04  31%  1e2iB  [c.37.1] THYMIDINE KINASE
    5e-04   3%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    6e-04  19%  1e2lB  [c.37.1] THYMIDINE KINASE
    6e-04  26%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    7e-04  12%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    7e-04  29%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    8e-04  20%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
:259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS
2d3wB           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGGTVEFKGKDLLAL
3b5jA           --DITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3cmvG           LGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH---
2b8wA           --MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3dmdC           --VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
3cmvC           LGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2c61B           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2dwoA           LTQSRVQKIWVPVDHRP-SLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
2c03B           -AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
3b60A           --DLEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
3eiuA           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2awnD           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
3cmvH           LGEDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3eiuB           ---YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
3c95A           --HPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDN
3dmdB           ---KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
2b8tA           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDT-
2akaB           ---EDLIPLVNRLQDAFSAIGQNADL-DLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQ
2c9yA           ----------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVAS
3cmvA           ---MDVETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2ccjB           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
2awnB           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
4dcgA           -----------------------LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
2ccgA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3dm5A           --HIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
1bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
2cgtH           VLDKSFGAPTITKDGVSVAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAA
2bbsA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2akaA           ---------PHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQ
2c04A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR-
3dt2A           CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
1e0jA           IREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2c03A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
2d62A           ---VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPE
1e9sG           -SGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1cr4A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3dt4A           CFALRIASRLAKEEGWMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM--K
2awoC           ---------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2c61A           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
3c8uA           ---------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEV--------
2dwpA           -----------------RVQKIWVPVDHRNVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
2ccgB           ----------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
1e0jB           --LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3b2qB           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2ctsA           ---------ASSTNLKDILADLIPKEQAKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEG
2a30D           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2a2zD           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
1e98A           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
2cckA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
1e69A           -----------YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
1d1cA           KGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQIL
3dhwC           --MIKLSNITKVFHTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
2awoA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
3dt7A           CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2d2eA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDENILE
1e9rA           --GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG---
2dr3A           -----------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2dr3E           ---------RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
1e9cA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2bc9A           --MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3cmwC           -----VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2bjbA           LDALQTLGLRDGVGSELTVSGRIEPGPGARVD--CGLAG----TVLRFVPPLAALGSVPVTFDGDQARGR
2bbsB           -----TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2czvA           --------------GGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAIL
1e9sB           -SGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3d31A           --MIEIESLSRKWKN-FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
1b0uA           ---LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
2d4hB           --MCLIENTNGRLMALKILSAITQP---MVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGL
3bo6B           --FHSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDK
2a30B           ----------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVL
3cmxA           --------------GSLSLDIALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH---
3cmvE           LGEDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH---
2awnC           ---------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVFQSYALYPHLS--
1e9dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2d3wD           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3cmtD           -------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL-
1e9sD           -SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2d2fA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENIL
2b8wB           --MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3cmuA           -----VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2awnA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1e2dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
1e3aB           WTHQMKAKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPF
2a30A           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3czpB           ---KAVIELREALLE--AQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEEL
2dflA           VKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYID
3da4A           --LVLHPGISVYDAY---HFAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLK
2d3wA           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3bh0A           ---SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2a2zB           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
1e9sF           --GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
2bhjA           ---------------------------------------------------IKNWGSGEILHDTLHHKAT
1e9sE           -SGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
1e9sL           -SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
2d3wC           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3bpbA           -----PARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFPFVEDPVLCTSRCAIITRP
3b2qA           --PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2d4hA           --MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWC
1e3mA           --------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRHP
1e2gA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
1e9sJ           --GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2bbtB           --GELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
1e9sM           --GGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
3d3kA           --------------KKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLC----GPHVKGA
2b92B           --MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3ch4B           ---------------------APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPL-KE
1cs4C           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1e4yA           ------------------------------RIILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
1cjtC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1e9sH           ----KLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e9rF           --GGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2d7vA           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL---
2d7vB           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL---
2dr3D           ---------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
3bgwA           --------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
3dm9B           -EAVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
3dt4C           CFALRIASRLAKEEGWMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2dr3F           -----------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2cjwB           ---------------------------TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATII
3c15C           -------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1culC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1e9fA           ----------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERST
3d7wA           ----YVSSGSFSNNI-PLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFL--
3cddF           VITGYVDDWVPSYDESTITSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPF
2bwjA           ---------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELAS
3b85A           ------------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA
2dpyA           --PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
2dpyB           --PLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
3bgwD           ----------GVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
3cmvB           -----VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTC---AFIDAEH
3bk7A           -----------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAY--
2c9gA           ARVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVL------------
2dr3C           ---------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
1e9rG           -SGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1ai4B           ----------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPF
1e9rE           --GGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVI---VDPNG
2a2zA           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCN--
5dfrA           ----------------------------------------------------------------------
1e59A           -------------------------VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFD
3dtbB           ---------EGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
3bb1E           ---SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
1dhiA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
1bg0A           ----SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHG-----GFKLTDK
1dhjA           ----------------------------------------------------------------------
1bmfC           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
3dauA           ----------------------------------------------------------------------
2b8tC           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSR
2c7cH           ---------------AREIELEDKFENMGAQMVKEVASKANDAAGDGTTTA--TVLAQAIITEGLKAVAG
2axzC           ----------------------------------------------------------------------
1eamA           -----------------------LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
3ed8A           ---IELKGTDFKEDGNI-LGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNT
3cm0A           ----------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVAR
1cr2A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA------
1e1qB           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1drbA           ----------------------------------------------------------------------
3czpA           -----------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEE
2d0kA           ----------------------------------------------------------------------
3d3qA           ---------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
3do6A           --ILYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLREPSLGP
2a5gA           ----------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY
3dlbB           -----------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEV------
2drcA           ----------------------------------------------------------------------
2bkiA           ---------PHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
3ecpA           -------------------------------------------------SALHRAADWAKSVFSSAALGD
3d3qB           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDGT
1cr1A           EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKV---GLAMLE
3a1wA           -------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGV
1d6jB           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRR------------
1ckvA           ---AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGE
1e2kA           ----------------------------LLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGAS
2b8tB           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPS
1adoA           ----------------------------------------------------------------------
1e9sI           -SGGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3ec1A           -----------------KVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTL
1e9rD           --GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3cddC           ---------------------------------AGGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQGQA
2axpA           ------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGN
3bczC           ------------------VCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGS
3dfnC           ----------------------------------------------------------------------
3bb1B           ---SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVS
1dg3A           --MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPG
2bx2L           ----------------------------------------------------------------------
2ck3C           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
3crmA           --------------------------SLPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMD
1e2fA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3dfpC           ----------------------------------------------------------------------
3dymA           -----------------------------RELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLL------
3c7kA           ---------------------------------LLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTI
1cr0A           --LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVG--------
2bofX           ----------------------------------------------------VNPNMSSAEWVRNNPN--
2bdtA           -----------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGG
3bb1F           ---SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPR----
1e9rB           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
2d4uA           ---------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSLQ
3be4A           -------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKN
2bkhA           ---SLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIV--
3clvA           -----------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTVN
3cr7C           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3e8aC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN---
3adkA           ----------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSS
2an9A           ---------------------------QGTLYIVSAPSGAGKSSLIQ-----------------------
1ak2A           ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
2awoD           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--
1e9sA           -SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3dfdA           ---IDAEEVEVPISVDKEGNVVPFKAITTDRIDELEKENTTKELD-------SQRFYARIAVETTVYPTF
1draA           ----------------------------------------------------------------------
2ccjA           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYD------------
2a5vA           -----VRTAGHVISAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---------R
1bglA           ----------------------------TRELNYGPHQWRGDFQFNISRYSQ------QQLMETSHRHLL
3dfoC           ----------------------------------------------------------------------
2anbA           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLY--------------
3dfqC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2eg5G           ---YNQLVLAKVKCVRELLRANLPNINKCIKVADLGCASGPNTLIVQSIDKVGQLERPTIQIFLNDLFPN
2cvfA           -------------------SLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPER
2b8tD           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKY-LVFKPKSIR
2ahwD           -----VKPPRINGRVVLSAQEAVNYIPDEATLCVLGAGGGATTLITALADKYKQTQTPRNLSIRGISPLA
1afrA           --------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDG-
2a1fF           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3c14C           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
4atjA           -------------------------------------------------------SDPRIAASILRLHFE
1azsC           -------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1akeA           ------------------------------RIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
1e6cA           -----------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGM
1dw9A           IQSQINRNIRLDLA----DAILLSKAKKDLSFAIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLD
2dr3B           ---------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH--
1cjuC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1eilA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------NLAERAYTLNYTCPTF--IDKPGI
2cbzA           ---ITVRNATFTWARPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDK---------------
1dkiA           KSLLDSKGIHYNQGNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNN
3bb1C           ---SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSIS------------
1e9sK           ----KLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e2hB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
1accA           -----------QETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKIAFGFNEPN-GNLQYQGKDIT--
2a5vB           --MFVVRTAGHVISAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---------R
3cr7D           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3dfqA           ----------------------------------------------------------------------
2bkeA           LEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCH-----------------------
2a5jA           ---------------------------------IIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDG
3bb1G           -GWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQS--------
2c9oC           -------------ACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
1dekA           ------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY
2axnA           LTQSRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGK----------------------------
3brwA           KVKLECNPTARIFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHL------------------------
3b9qA           --IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSL------------------------
3bb1H           ---SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
4dfrA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2bbtA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP---------------
1d6jA           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR-------
2ancD           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLY--------------
3bjdB           ------------------------------------------------LPQLQNLPIEEARIVADALADS
1e2jB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR-
3cnlA           -----------HKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILD
3b55A           ----------------------------------------------------------------------
3cr7A           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1e4vA           ------------------------------RIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
3cd9A           ---IELKGIDFKEDGNIHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGD
2cckB           -----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGV--
2ancB           ---------------------------QGTLYIVSAPSGAGKSSLI------------------------
2bv7A           ---------------FDCLGSPVFTPIKADISGNIDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALM
2b0lC           ----------------------------------------------------------------------
2ancF           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
421pA           ----------------------------EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
3dkvA           ------------------------------NIVLMGLPGAGKGTQAERIVE--KYGIPHISTGDMFRAAM
1ek0A           ---------------------------------LLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQR
1dwmA           ----------------------------------------------------------------------
3a00B           -----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1e2iA           -------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYT
3cqcA           --LKQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIRE------------------------
1e2lA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRGASETIAN
2ahvA           -------------VPVLSAQEAVNYIPDEATLCVLGAGLEATTLITALALSIISPTGLGDRADRGISPLA
3dfqD           ----------------------------------------------------------------------
3di4A           -------------VLVPPREGRCFEVKAGQFFRISSVEGPQVGDLN-----LHNLHDLTERFFSGKTR--
3dftC           ----------------------------------------------------------------------
1d2zD           ---PAEIKKGFKYTDVFQIDEAANRLPPDQSKSKTSGKLNERPTVGVLLQLLVLFSAADFVALDFLNEST
1cjvC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEA
3d1mB           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dekB           ------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKD----
3cioD           ---------------RTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRR-
2c4rL           ISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIK
3ci2A           ----------------------------------------------------------------------
3dmdA           --VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTI------------------------
6aldA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e2mA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRD-DIVYVPEPMTYWRVLGAS
2bboA           --EVVMENVTAFWEGTPVLKDINFKIERGQLLAVAGSTGAGKTSLL------------------------
1e2nB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVMTYWRVLGA
3dffA           -----------------------------------------------LLAISPHLDDAVLSF-GAGLAQA
2bwjB           ----------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELAS
1e2jA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWASETIAN
1d6aA           -----------------KISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQV-KTNFNRAFNPNPKVL
3cddD           -------------------EEIVLKAGGKIYQGWTKIGSLEASGAFDLTYKFNDAQYKAFIEPIKQ--GQ
2dx7A           ----------------------------------------------------------------------
3a00A           -----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
3dvlD           ----EHQAIAKMRTMIEGFDDIHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETP
2c9oA           LAKQAASGLVGQENCGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
3e70C           --KEAVSEILETSRR-IDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAA------
1e2hA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVL----
2e85A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3dm5B           --HIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVA-----------------------
1chdA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1av6A           -----------------------LQRHGILDGATVVYIGSAPGTHIR-----------------------
3cueF           ------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIG------------
3bb1A           -GWSGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3cr7B           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAY--------
2aunA           ----------------------------------------------------------------------
2d4uB           ---------------------------------------------------------------------Q
3cbnA           --------------------------------------------------------RYTLRARGHPNV--
1e2nA           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWVL
1c9kC           ------------------------------MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDG
1cfrA           ---------------------------------IISKSGEGNKYTINAYASHIDINTTEFSKVLSGLRDF
1dvrA           --------------------------SESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK
3dyoA           ----------------------------------------------------------------------
3bwdD           ----------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSA------------
1e2kB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR-
1e2mB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY-VPEPMTYWR
3bb1D           ---SGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3cnnA           ------------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAG---------------
1dp0A           ----------------------------TRELNYGPHQWRGDFQFN------ISRYSQQQLMETSHRHLL
3cbqA           ---------------------------------LVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYE--
2ax4A           ----------------------------GCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRG
3cddB           --------IVLKAGGKIY-----QGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAF------------
2ax4B           ----------------------------GCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRH
1e2iB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY----------
3bs4A           ----------------------------SLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQ
1e2lB           ----------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY---------V
2bwjD           -------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----------
2a78A           ---------------------------------MVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKV
1ckeA           ----------------------------APVITIDGPSGAGKGTLCKAMLQWHLLDSGAIYRV-------
3cphA           ---------------------------------LIGDSGVGKSCLLVRFVEDKFNPSF------------


                         .         .         *         .         .         .         .:140
query           TPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVG
2d3wB           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDR------FDFQDLMEEKIALLKMP
3b5jA           DPNWLRRQVGVVLQDNVLLNR--SIIDNISLANPGMSVEKVIYAAKL----------AGAHDFISELREG
3cmvG           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALA-RSGAVDVIV---------------VDSVAALTP
2b8wA           MWCVPHPKGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSS---TFVYNSIGTINQQAMDQLYYVTEL
3dmdC           GAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQ---------------------------------HA
3cmvC           PIY---ARKLGVDIDNLLCSQPDTGEQALEICDALA-RSGAVDVIV---------------VDSVAALTP
2c61B           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPHGMHVLVILTDITNYAEALRQMGYPGYMYT
2dwoA           EAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKS--------------------------------YL
2c03B           AAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE---------------------------------EKA
3b60A           TLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEA-----------ARMAYAMDFINKMDNG
3eiuA           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMGMHVLVILTDITNYAEALRQMGPGYMYT
2awnD           PPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRL---------------GRTMIYVTHDQV
3cmvH           PIYAR---KLGVDIDNLLCSQPDTGEQALEICDALA----------RSGAVDVIVVDSVAALTPKAEIEG
3eiuB           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYYT
3c95A           LKILRENPQVREKYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKR-----------------IEKLL
3dmdB           GAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQ---------------------------------HA
2b8tA           RSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQ--FFDDRICEVANILAENGFVVI
2akaB           LVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPIN-----LRVYSPHVLNLTLVDL
2c9yA           GSELGKK--LKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGF----------PRTVRQAEMLDDL
3cmvA           PIYAR---KLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDS-------------------VAA
2ccjB           GEEIRKIVLE---GNDMDIRTEAMLFAASRREHLVLKVIPALKEGKV---------------------VL
2awnB           PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVN------------------QVAEVLQ
4dcgA           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIIDVRSPSTADLLSNYALQNVMISILNPVASSLKWRC
2ccgA           GEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGK------------------------VVL
3dm5A           GAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVD---------------------------------YF
1bifA           DMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKF--------------------------------L
2cgtH           GMNPCSDSKAIAQVGTISANSDETVGKLIAEAMDKV-GKEGVITVED--------------GTGLQDELD
2bbsA           QNSWIMPGTIKENIIGVSYDEYR--------YRSVIKACQLEEDISK-----------------------
2akaA           QILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYL----------LEKSRVVFQSE
2c04A           -PAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE-------------------------------EKA
3dt2A           AQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSD------------GGVYWEGID
1e0jA           EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLY---------------------D
2c03A           AAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE---------------------------------EKA
2d62A           KGVFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVRE----------------VAELG
1e9sG           SK---FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA------------------------------
1cr4A           EET---AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTF----------------------
3dt4A           FDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSD------------GGVYWEGID
2awoC           PPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEINQRVNQVAE-----------------------VLQ
2c61A           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEY---------------LAYEHG
3c8uA           --VPDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHA--LKHQE---------------------RV
2dwpA           EAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKS--------------------------------YL
2ccgB           GEEI-----RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEG-------------------KVVL
1e0jB           EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL---------------------YD
3b2qB           ITNEEAQYFMSDFEK-TGALERAVVFLNLAAAEYLAYEHGMHVLVILTDITNYAEALRQMGRGYPGYMYT
2ctsA           IRFRGYSIPCQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLS-----------KEWAKRAALPSH
2a30D           STNVLQMMRWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVY---------------SDRYIFASNLYE
2a2zD           STNVLQMMYEKPERWSFACLSRIRAQLASLNEKPVLFFERSVYS---------------DRYIFASNLYE
1e98A           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVD-------------------RY
2bifA           DMVKTYKSFEFFLPDNEEGLKIR---------KQCALAALNDVRK-----------------------FL
2cckA           GEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALK------------------------------EG
1e69A           GSAYVEL-VFEENGEEITVARGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIR
1d1cA           QANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLL--------------EKSRVVFQS
3dhwC           SESELTKAQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTE---------------LLSLVG
2awoA           PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVN------------------QVAEVLQ
3dt7A           AQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWE------------GID
2d2eA           LSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVA--------------EFWTKVKKALEL
1e9rA           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------------------
2dr3A           QVRQNMA-QFGWDVKPYEEKGMFAMVDAFTAGIGKE----------------------------------
2dr3E           QVRQNMA-QFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVV-
1e9cA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVD-------------------RY
2bc9A           MWCVPHPKKPGHILVLLDTEGLGD-------VEKGDNQNDSWI-----------------------FALA
3cmwC           PI---YARKLGVDIDNLLCSQPDTGEQALEICDALA----------------------------------
2bjbA           PIAPDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASA------------------------------
2bbsB           QNSW-----IMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEK----------------------
2czvA           LSNPKPSLVRDTVQKFKSYLIYVDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSL
1e9sB           SKF---GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV---------------------------
3d31A           SPE---KHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTA------------------RDLK
1b0uA           RDKDGQLKVADKNQLRLL-RTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGI
2d4hB           GQNDSWIFLSSTFVYNSIGTINQQAMDQLYYVTELTRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADG
3bo6B           FHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPD------------
2a30B           QMMYEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQ
3cmxA           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALA-RSGAVDVIVAALTPKAEARMMSQAMRKLAGNLK
3cmvE           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALA-RSGAVDVIV---------------VDSVAALTP
2awnC           ---VAENMSFGLKLAGAKKEVINQRVNQVA------------------------------------EVLQ
1e9dA           EIGK----LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQG---------------VTLVVDRY
2d3wD           ALSDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD------FQDLMEEKIALLKMP
3cmtD           --DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSVDSVAALTPKAEMGLAARMMSQAMRKLAGNLK
1e9sD           SKFGR---DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV--------------------------
2d2fA           ELSPDERARKGLFFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELL----------DWD
2b8wB           MWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLL------------------SSTFVYNSI
3cmuA           PIYAR---KLGVDIDNLLCSQPDTGEQAL-----------------------------------------
2awnA           PP--------------------------------------------------------------------
1e2dA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVD------------------RYA
1e3aB           EMNPKVYNPQSGYIANWNNSPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRL
2a30A           STNVLQMMYESFTFQTYACLSRIRAQLALKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
3czpB           ERPPQWRF-WRRLPPKGRTGIFFGNWYSQLYARVEGHIKEA-----------------------------
2dflA           TEGTFRWERIENMAKALGLDIDN---------VMNNIYYIRAINT-----------------------DH
3da4A           IIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGGSWTYNGVVRSYDDKYDFNASTHRGI
2d3wA           ALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRG----QETLDRFDFQDLMEEKIALLKMP
3bh0A           ENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINI---------------------FD
2a2zB           STMYEKPERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDR--------------YIFASNLYE
1e9sF           --LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDW----------------------------------
2bhjA           SCLGSIPKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEH-----------LARLEAVTKEIE
1e9sE           --LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-----------------------------
1e9sL           --LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------------------
2d3wC           ALSPEDGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFD------FQDLMEEKIALLKMP
3bpbA           GAESRRGETEIIEETVQRFYPGKVERIEAPGTEAGDIMMVGDHF-----------------------YIG
3b2qA           ITNEEAQ-YFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAE--------------YLAYEHG
2d4hA           VPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVY----------NSIGTINQQAMDQLYYV
1e3mA           VVEQVLNEPF--IANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYI---------------GSYVPAQ
1e2gA           EIGKLLS----SYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGV---------------TLVVDRY
1e9sJ           SKF---GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV---------------------------
2bbtB           QNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEE------------------------------DISKF
1e9sM           --LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-----------------------------
3d3kA           QGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQ-----------VSSLKDLPTSPVDLV
2b92B           MWCVPHPKKPGHILVLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYN----SIGTINQQAMDQLYYVT
3ch4B           QYAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIIWLVSDTRRVSDIQWFREAYGAVTQTVRVVA
1cs4C           AIETIVAAMLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFY--------------------------
1e4yA           GSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDV
1cjtC           AIETIVAANLVPPVELANPENQFRVDYILSVMNVPDFDFP------------------------------
1e9sH           SK---FGRDKDIILNPYDQRTKGWSFFNEIRNDYDW----------------------------------
1e9rF           SKF---GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-----------------------------
2d7vA           ---EKHHLAHENCFIANSVETEVVT---------------------------------------------
2d7vB           ---EKHHLAHENCFIANSVETEVVT---------------------------------------------
2dr3D           QVRQNMA-QFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYE------------------------------
3bgwA           ENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSN--------------------------
3dm9B           GAIEQLEEGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDT------------------------AG
3dt4C           AQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAET------------SDGGVYWEGID
2dr3F           QVRQNMA-QFGWDVKPYEEKGMFAMVDAFTAGIGKSKE--------------------------------
2cjwB           LLDMWENH-DHMQVGDAYLI-VYSITDRASFEKASELRIQLRRARQT--------------EDIPIILVG
3c15C           EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMN----------------------------------
1culC           AIETIVAA-MSNLVPPVELANPENQFRVDYILSVMNVPDFDFPP--------------------------
1e9fA           EIGK----LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVT---------------LVVDRY
3d7wA           ---------SDAPAGAETQDFSGTTSSSQPFNGSYPDLERYAGHRDQIP--------------------L
3cddF           QRIQIEQGETPHELLARL---------AKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRF
2bwjA           ESERSKL--IRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYP-------------REVKQGEE
3b85A           GEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAY---------------------------
2dpyA           KDFIILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFR---------------------------
2dpyB           KDENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFR---------------------------
3bgwD           ENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNS---------------------NINIFD
3cmvB           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARS--------------------------------
3bk7A           ------------KPQYIKAEYEGTVYELLSKIDSSKLNSNFYKTELLKPL-------------------G
2c9gA           ----------------------------------------------------------------------
2dr3C           QVRQ-------NMAQFGWDVKPYEEKGMFAMVDAFTAGIGE-----------------------------
1e9rG           SK---FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-----------------------------
1ai4B           EMNPKVYNPQNNSPQKDYPASDLFAFLWGGADRVTEIDRL--LEQKPRLTADQAWDVIRQTSRQDLNLRL
1e9rE           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------------------
2a2zA           VQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFF-----------------ERSVYS
5dfrA           --------------------------------------------------------------------DL
1e59A           FAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAE--------TAEKYGDEQVKQW
3dtbB           AQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTN------------VAETSDGGVYWEGID
3bb1E           SRSRAGF--TLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDN---------LDK
1dhiA           ------------------ISLIAALAVDRVIGMENAMP-----WNLPA--------------------SL
1aroP           -----------------------NDFSDIELAAIPFNTLADHYGERL-----------------AREQLA
1bg0A           HPPKQWGDINTLVGLDPAGQFIISTRVRC--GRSLQGYPFN-----PCLTAEQYKEMEEKVSSTLSSMED
1dhjA           --------------------------------------------------------------------SL
1bmfC           VAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLA---------------------------
3dauA           ------------------ISLIAALAVDRVIGMENAMP----WNLPA---------------------DL
2b8tC           TGTSLPSVEVESAPEILNYIMSNSFNDEIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
2c7cH           MNPMDLKRGIDKAVTAISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDE---------------LD
2axzC           -------------------------------------------------------------------YEI
1eamA           DPLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCP
3ed8A           PIGDGPVL-----LPDNHYLSYQTVLSKDPNEKRDHMVL-------------------------------
3cm0A           GTPLGER--VRPIMERGDLVPDDLILE--LIREELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVL
1cr2A           ----------------------------------------------------------------------
1e1qB           VAIGQKR-STVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLA--------------------------
1drbA           ------------------ISLIAALAVDRVIGMENA-----MPWNLPA--------------------CL
3czpA           RAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYG----------EINDFEEQLSE
2d0kA           --------------------------------------------------------------------DL
3d3qA           TAKVTTEEEGIPHYIDILPPDASF--------SAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLY
3do6A           T---------------------------------------------------------------------
2a5gA           KNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQ---------ELHRIINDREMRDA
3dlbB           -------------DPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKEL------PLP
2drcA           ------------------ISLIAALAVDRVIGMENAMP-----FNLPA--------------------DL
2bkiA           NPLL-----EAFGNAKTVRNNNSSRFGKFVEIHFNE----------------------------------
3ecpA           PR---------RTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRF--------------------IR
3d3qB           AKVTTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKV------------PIIAGGTGLYIQS
1cr1A           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFH-------------LYDSFAEA
3a1wA           FTYKGYT--INLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVAD-----------SVNPEQSLYLL
1d6jB           ----------------------------------------------------------------------
1ckvA           VDCDEISELLGRQFNVYDFL-VDVSSTIGRAYT-------------------------------------
1e2kA           ETI---ANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHP
2b8tB           VEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGF------------------VVI
1adoA           ----------------------------------------------------------------------
1e9sI           SKF---GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY-------------------------------
3ec1A           DMIEIPL-ESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQT--------------
1e9rD           SKF-------------------------------------------------------------------
3cddC           CTVDIGGE-RVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFG
2axpA           EKLFEHFADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKI-------KAKAKVVYLHADPSVI
3bczC           CAAHAYK-QVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRI-----------DQKIYGELWK
3dfnC           ----------------------------------------------------------------------
3bb1B           RSRAGFT-LNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLL-----------YVDRLDAYRVDNLDK
1dg3A           HILVLLD-TEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGT----------INQQAMDQLYYVTELT
2bx2L           ----------------------------------------------------------------------
2ck3C           VAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAP--------------------------------
3crmA           IGTAKPSR-ELLARYPHRLIDIRDPAESYSAAEF---RADALAAMAKATARGRI--------------PL
1e2fA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVT-------------------LVVDRY
3dfpC           ----------------------------------------------------------------------
3dymA           HAEEGTWLNIDGFHMGIGGDDSWSPSVSA---------------------------------------LR
3c7kA           QSLAAIVRALGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAEL---------------------------
1cr0A           ----------------------------------------------------------------------
2bofX           ------DPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQA--------------AGKIPILVV
2bdtA           YRPPLTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEAL--------------------------------
3bb1F           ----------------------------------------------------------------------
1e9rB           --LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV---------------------------
2d4uA           TRNTLNRAGIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEA------------LPRDPRQSTA
3be4A           GIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFP--RTIPQAEGLAKILSEIGDSLTSVI
2bkhA           ---EANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGG----------FVSHYLLEKSRICVQGK
3clvA           LNDNNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNT--------------------------
3cr7C           FGLNKDLGFSEADRNENIRRIAEVAKLFAIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAE
3e8aC           NLKEAIETIVAAMSNLVPPVELANPENQ------------------------------------------
3adkA           GSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKV-----------------------------------
2an9A           ----------------------------------------------------------------------
1ak2A           GSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVI
2awoD           ----------------------------------------------------------------------
1e9sA           SK--------------------------------------------------------------------
3dfdA           KAKELRE-AYKTEDPVEVAKRVLSVGGEY-----------------------------------------
1draA           ------------------ISLIAALAVDRVIGMENAMP-----WNLPA--------------------EL
2ccjA           ----------------------------------------------------------------------
2a5vA           DVVERVAPSVLLGRRDGLSRVDEFEQRHVHETAILMARSSAISERIA-----------------------
1bglA           HAEEGTWLNIDGFHMGIGGDDSWSPSVSA-----------------------------------------
3dfoC           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2eg5G           DFNSVFKLLPSFYRKLEK-ENGRKIGSCLIGAMPGS----------------------------------
2cvfA           LVQMAETRGL---NPEEALSRFILFTPSDFKEQ-RRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGL
2b8tD           NIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRI-------------CEVANILA
2ahwD           QEGLVKWA-LCGHWGQSPRI-SDLAEQNKIIAYNYP----------------------------------
1afrA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1dyhA           ------------------ISLIAALAVDRVIGMAMPWNLP---------------------------ADL
3c14C           EAI---ETIVAAMSNLVPPV--------------------------------------------------
4atjA           DCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESA-------------CPRTVSCAD
1azsC           EAIETIVAAM---SNLVPPVELANPENQFRVDYILS----------------------------------
1akeA           GSEL--GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEF
1e6cA           TVADVVAAWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMR-----------------------
1dw9A           EDSILLLQDRIPTDPTYRFYELQVYGTTLKALVHEKFGDG------------------------------
2dr3B           ----------------------------------------------------------------------
1cjuC           EAIETIVAAM---SNLVPPVELANP---------------------------------------------
1eilA           --------------------------------------------------------------------PA
1e3mB           RITEGRHPVVEQVLNEPFIALNLSPQRRLIITGPNGGKSTYRQTALIA----------LAYIGSYVPAQK
2cbzA           ----------------------------------------------------------------------
1dkiA           PYFNHPKNLFAAISTRQYNW--------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9sK           SK---FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV---------------------------
1e2hB           LGASET---IANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLI
1accA           --------EFDFNFD-------QQTSQNIKNQLAELNATNIYTVLDK------------------IKLNA
2a5vB           DVVERVAPSVLLGRRDGLSRVDEFEQRHVHETAILMARSSAISERIA-----------------------
3cr7D           FGLNKDLENIRRIAEVAKLFADSNSIAITSFISPYR----------------------------------
3dfqA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2a5jA           KQIKLQIWDGQESFRSITRSYYRGAAGALLVYDITRRETFNHLT---------------SWLEDARQHSS
3bb1G           ----------------------------------------------------------------------
2c9oC           EIKKTEV-LMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEI------------NKVVNKYIDQGIAE
1dekA           AWGVFAANTDYP-LTRKEFEGIDYDRETNLNLTKL-----------------------------------
2axnA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1H           SRS-------------------------------------------------------------------
4dfrA           ------------------ISLIAALAVDRVIGMAMPWNLP---------------------------ADL
3dfnA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3bjdB           AASKLAALGLKGDRQAYAAY------QQLLYVLSLSDDTAQTRRWLAR--------------------AI
1e2jB           VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDA----------------------
3cnlA           TPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFE----------------------------------
3b55A           --------------------------------------------------------------------WL
3cr7A           FGLNKDLGFSEADRNENIRRIAEVAKLF------------------------------------------
1e4vA           GSELGKQ--AKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEF
3cd9A           GPVL----LPDNHYLSTCSALSKDPNEKR-----------------------------------------
2cckB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2bv7A           WLKRG--------------LRFIQVFLQSICDGERDENHPNLIR-------------------------V
2b0lC           ----------------------------------------------------------------------
2ancF           DVFLDIDWQGAQQIR-------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3d1mA           --------------------------------------------------------------------PN
1aldA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
421pA           VIDGETCLAGQEEYSAMRDQYMRTGEGFLCV--FAINNTKSFEDIHQ-------------YREQIKRVKD
3dkvA           KEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDC--------------------------------
1ek0A           VTIN------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3a00B           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYY----------------------------------
1e2iA           TQHR-----LDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLA---------------------------
3cqcA           ----------------------------------------------------------------------
1e2lA           IFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDA--------------------------------
2ahvA           QEGLVKWA-LCGHWGQSPRI-SDLAEQNKIIAYNYP----------------------------------
3dfqD           ----------------------------------------------------------------------
3di4A           ALHGTHVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSN
3dftC           ----------------------------------------------------------------------
1d2zD           PAR-------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3d1mB           --------------------------------------------------------------------PN
3bv4A           ----------------------------------------------------------------------
2bhvD           ---------LLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAH--------------MGKAVLIPK
1dekB           --------ALAYAWGVFAANTDYPLTRKEFEGIDYDRET---NLNLTKLEVITIMEQAFCYLNGKSPIKG
3cioD           -GYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITR---------------------------
2c4rL           KAAESRP--APFLIHQESNVIVRAFRDYLRQDIG-EILIDNPKVLEL-----------ARQHIAALGRPD
3ci2A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
1e2mA           ET---IANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYA----------------------------
2bboA           ----------------------------------------------------------------------
1e2nB           SETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLA-----------------------
3dffA           AQD-GANVLVTVFAGAAQPPYSPAAQRHTIWGLAPDDDAVLDIAALDHLRVAH-----------------
2bwjB           ESERS--KLIRDIMERGDLVPSGIVLELL-----------------------------------------
1e2jA           IYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAG--------SPPPALTLIFDRH
1d6aA           NLQETWGKISTAIHDAKNVLPKPLELVDASGAKWIVLRV-------------------------------
3cddD           ACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFG
2dx7A           ----------------------------------------------------------------------
3a00A           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNY-----------------------------------
3dvlD           QDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGF-------------------------DLSA
2c9oA           EIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKL----------------
3e70C           ----------------------------------------------------------------------
1e2hA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRH
2e85A           --------------------------------------------------------------------EK
2a1fC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2boeX           --------------------------------------------------------------------TW
1av6A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3bb1A           SRS-------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunA           ------------------WQPIDGRVALIAPASAIATVLEATLRQLE----------------VHGVDYH
2d4uB           TRNTLNRAGIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYE------------ALPRDPRQSTA
3cbnA           ---TAGHRTTFEVTVD----PEIGETADCIIGVSSSDSISTLPDEKRAI------ARESLVRVILRTENG
1e2nA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQI-----------------------------------
1c9kC           RPAH-----WRTARHLDTLITADLAPDDAILLECIT----------------------------------
1cfrA           INDEAIRLGSDGSFNKCN----GDWYEWLIGIRAIEFFLETNFIVVKMPNATSFDVMSIYKSCLSEFIYD
1dvrA           GTQLGLE--AKKIMDQGGLVSDDIMVNMIKDE--------------------------------------
3dyoA           -------------------------------------------------------------------RDQ
3bwdD           ----------------------------------------------------------------------
1e2kB           VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDA----------------------
1e2mB           VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTD-----------------------
3bb1D           SRS-------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1dp0A           HAEEGTWLNIDGFHMGIGGDDSWSPSVSA---------------------------------------DQ
3cbqA           ----------------------------------------------------------------------
2ax4A           FSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHE-----------------------
3cddB           ----------------------------------------------------------------------
2ax4B           FSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHE-----------------------
1e2iB           ----------------------------------------------------------------------
3bs4A           LIIRILS-RFGVDVIKYLENHRLAIVDTF-----------------------------------------
1e2lB           PEPMTYWRVLGASETIANIFTTQHRLDQGEISAGDA----------------------------------
2bwjD           ----------------------------------------------------------------------
2a78A           VLD-------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEH
2d3wB           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSLD-IDALKVVADGVNSLRDGKRSFIIVTHY
3b5jA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR--TVIIIAH
3cmvG           KAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEVVGSETRVKVVK
2b8wA           THRIRSKSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKK
3dmdC           KARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTK
3cmvC           KAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIKEGENVVGSETRVKVVK
2c61B           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVV------ARELHRKGIYPPIN
2dwoA           AKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISS-PDYKDCNSAEA
2c03B           RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTK
3b60A           LDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQA--ALDELQKNRTSLVIAH
3eiuA           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL------HRKGIYPPIN
2awnD           EAMTLADKIVVLDAGRVAQVGKHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPV
3cmvH           EIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAV-KEGENVVGSET
3eiuB           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL------HRKGIYPPIN
3c95A           FNYRARNFPGTLDYAEQQRWL-------------------------------------------------
3dmdB           KARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTK
2b8tA           ISGLDKNFKGEPFGPIAKLFTY-------ADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGC
2akaB           PGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDP--QGQRTIGVIT
2c9yA           MEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIR---RSDDNEK
3cmvA           LTPKAEIGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGE-NVVGSET
2ccjB           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNR-LDQEDLKFHEK
2awnB           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
4dcgA           PFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYIVRNKVVVNF
2ccgA           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQ-NRLDQEDLK
3dm5A           KSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTK
1bifA           SEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPD-YVNRDSDEA
2cgtH           VVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEA
2bbsA           FAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI--LVT
2akaA           TERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSE----EFKITRQAMDIVGFSQE
2c04A           RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTK
3dt2A           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWEVPIEGIIFGGRRPAGVPLVYEAL
1e0jA           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICH
2c03A           RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTK
2d62A           LTELLNRKPRELSGGQRQRVAL-GRAIIRRPKVFLDEPLSNLDAKLRVKRAELKKLQRQL-GVTTIYVTH
1e9sG           ----------------------------------------------------------------------
1cr4A           ---HLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAK---STGVVLVVICH
3dt4A           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRRPAGVPLVYEAL
2awoC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
2c61A           MHVLVILTDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGA-KGSVTQIPILSMPGD
3c8uA           IYPLFDR-ARDIAIGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVDLEARLVQRWLDHGL
2dwpA           AKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPD-YKDCNSAEA
2ccgB           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEIEG
1e0jB           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICH
3b2qB           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL------HRKGIYPPIN
2ctsA           VVTMLDNFPTNLHPMSQLSAAI------------------------------------------------
2a30D           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKHESWLLHRTL
2a2zD           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGREYLEKLHYKHESWLLHRTL
1e98A           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYE-----NGAFQERALRC
2bifA           SEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPD-YVNRDSDEA
2cckA           KVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIRLDQEDLKFHEK
1e69A           KPGRRDQKLSLLSGGEKALVGLALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK--HTQFIVITH
1d1cA           ETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEF---KITRQAMDIVGFSQE
3dhwC           LGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITH
2awoA           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
3dt7A           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRRPAGVPLVYEAL
2d2eA           LDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHY
1e9rA           ----------------------------------------------------------------------
2dr3A           --YEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQRVLAGTGCTSIFVSQ
2dr3E           -----DSVTTLYINKPAMARSI----------------------------ILQLKRVLAGTGCTSIFVSQ
1e9cA           AFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKR-----GAFGHERYENGAFQERALRC
2bc9A           VLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGPDEYLTYSL
3cmwC           ----------------------------------------------------------------------
2bjbA           SSQFVSGLLLSAASDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEP
2bbsB           --DNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKL-MANKTRILV-T
2czvA           RPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGV----VIGMEIPQAKA
1e9sB           ----------------------------------------------------------------------
3d31A           IEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITH
1b0uA           DERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTH
2d4hB           QPLTPDEYLTYSLKLKKGTSQCIRKFFPKKKCFVFDRPVHRRKLAQLEKQDEELDPEFVQQVADFCSYIF
3bo6B           --QENSQYSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSY-RNELRSGRDGGEMQALR
2a30B           DWHDWMNNQFGQSLELDGIIYL-----QATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL
3cmxA           QSNTLLIFINQIRNPETTTGGNALKFYASVRL---------DIRRIGAVKEGENVVETRVKVVKNKIAAP
3cmvE           KAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVK
2awnC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
1e9dA           AFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYE-----NGAFQERALRC
2d3wD           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRD--GKRSFIIVTH
3cmtD           QSNTLLIFINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVKEGENV-----VGSETRVKVVKNKIAAP
1e9sD           --------PRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFGTLAESLFAG
2d2fA           ESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHY
2b8wB           GTINQQAMDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQK
3cmuA           ----------------------------------------------------------------------
2awnA           -----------------------------------------LDAALRVQMRIEISRLHKRLGRTMIYVTH
1e2dA           FSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQER------ALRC
1e3aB           FLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLK-RTVVAAVPMPF
2a30A           WHDWMNNQFGQSLELDGIIY------LQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL
3czpB           ----------------------------------------------------------------------
2dflA           QIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQ
3da4A           IGESLTRLGAMFSGKEYQILLP------------------------------------------------
2d3wA           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHY
3bh0A           KAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKMARELDVVVIALSQ
2a2zB           SECMNETEWTIYQDWHDWMNNQGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTL
1e9sF           ----------------------------------------------------------------------
2bhjA           TTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAI
1e9sE           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2d3wC           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVT--HYQ
3bpbA           ESARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQ-DFNIIEIPE
3b2qA           MHVLVILTDITNYAEALRQMGA---ARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSV--TQIPILS
2d4hA           TELTHRIRSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSCIRKFFPKK
1e3mA           KVEIGPIDRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLANKKALTLFATH
1e2gA           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGA---------FQERALRC
1e9sJ           -------VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTESLFAG
2bbtB           AEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKL-MANKTRILVTS
1e9sM           ----------------------------------------------------------------------
3d3kA           INCLDCPENVFLRDQPWYKAAV-AWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLGEHAGR-IYLCDIG
2b92B           ELTHRIRSKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFRLCIRKFFPK
3ch4B           LEQSRQQRGWVFTPGVDDAESEC---------------------------------GLDNFFDWVIENHG
1cs4C           ----------------------------------------------------------------------
1e4yA           PDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGY
1cjtC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2dr3D           --KYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQ
3bgwA           -INIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLDVVVIALSQ
3dm9B           RSETNRNLDEKKIARVTKPNLV----------------IFVGDALAGNAIVEQARQFNEAVKIDGIILTK
3dt4C           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIIFGGRRPAGVPLVYEAL
2dr3F           --YEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQRVLAGTGCTSIFVSQ
2cjwB           NKSDLVRREVSVSEGRAAVVFDCKFIE--------------TSAAVQHNVKEL------FEGIVRQVRLR
3c15C           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e9fA           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYE------------NGAFQERALRC
3d7wA           GIDQLIQSVTALRFPGGQTKLIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQH
3cddF           SWRQRFSKFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQR--SIGKSNAEYTVTGW
2bwjA           FGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKR-LEAYYRASIPVIAYYETKTQLHKI
3b85A           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3bgwD           KAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKMARELDVVVIALSQ
3cmvB           ----------------------------------------------------------------------
3bk7A           IIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEH
2c9gA           ----------------------------------------------------------------------
2dr3C           --YEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILKRVLAGTGCTSIFVSQ
1e9rG           ----------------------------------------------------------------------
1ai4B           FLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRT-VVAAVPMPF
1e9rE           --YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFGTLAESLFAG
2a2zA           DRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPL
5dfrA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
1e59A           RRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI-IAAH
3dtbB           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIIFGGRRPAGVPLVYEAL
3bb1E           LVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENS
1dhiA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
1aroP           LEHSYEMGEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPE-AVAYITIKT
1bg0A           ELKGTYYPLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRNDAKTFLVWVNEEDHLRIISMQG
1dhjA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
1bmfC           -------------PYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRP--PGREAYPGDVFYL
3dauA           AWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
2b8tC           PIAKLFTYADKIT--KLTAICNEC--------------------GAEATHSLRKIDGKHADYNDDIVKIG
2c7cH           VVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEA
2axzC           VSNLLNVLPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFEHLISINGYY
1eamA           FPDQWIKDFYIPHGNK-------------------------MLQPFAPSYSAEMRLLSIYTGENMRLTRV
3ed8A           ----------------------------------------------------------------------
3cm0A           VEVPEEELVRRI----LRRAEL------EGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLG
1cr2A           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1drbA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
3czpA           YGIIVVKFWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDVDAVGD-VDRTSTEIAPWTLVEAN
2d0kA           AWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGR
3d3qA           NYAFEISEDKKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNLRAIEYYLQQFTENYDTLLIGIES
3do6A           ----------------------------------------------------------------------
2a5gA           IILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS--------------
3dlbB           GGLSLLDYHASKGRLQGREGGRVAWVADPKDPRKPIP---HLTGLLVPVGSLALSLPWEERRRRTREIAS
2drcA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
2bkiA           ----------------------------------------------------------------------
3ecpA           NPNVSAE--AIRKAGAMQTVKLAQEFPELLAIEDTT----SLSYRHQV--AEELGKLGSIQDKSRGWWVH
3d3qB           LLYNYAFEDKKQVKLKLKELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYTENYDTLLIGIES
1cr1A           ETDRLLAKLAYMRSGLGCDVIILDHI---------------SIRKMIDNLMTKLKGFAKSTGVVLVVICH
3a1wA           LEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY-------------
1d6jB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e2kA           IAALLCYPAARYLMGSMTPQAV--------------------------LAFVALIPPTLPGTNIVLGALP
2b8tB           ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGA--------EATHSLRKIDGKHADYNDDIVKIG
1adoA           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
1e9sI           ----------------------------------------------------------------------
3ec1A           -LFFGGLARLDYIKGGRRSFVCYMANELTVHRTKLEKADSLYANQLGELLSPPSKRYAAE---FPPLVPR
1e9rD           ----------------------------------------SMRELFHWTTIATFDDLRGFLELAESLFAG
3cddC           IKVIVNTDVGEQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSL---ILGDNVKAARG
2axpA           KKRLRVRGDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDIIFLVE--------------
3bczC           TGFERSLQTDEDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFFRYSY
3dfnC           -----HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTA
3bb1B           LVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLAS-DIPVVLIENSG
1dg3A           HRIRSKSDSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKK
2bx2L           FSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDI---EETAFNT
2ck3C           --------LQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGR--EAYPGDVFYL
3crmA           LVGGTMLYYKALLEGLPYT-VAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSI
1e2fA           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENG-----AFQERALRC
3dfpC           -----HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
3dymA           DQFTRAPLDNDIGVSEATRIDAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISR
3c7kA           ----------------------------------------------------------------------
1cr0A           -------------------------------------------------LMTKLKGFAKSTGVVLVVICH
2bofX           SNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGS
2bdtA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------KRSEALLQVVRSGASLKKD--IPVVLIENS
1e9rB           ----------------------------------------------------------------------
2d4uA           AAAEIKRNYDIYHNALAELIQL---LGAGKINEFFDQPTQGYQDGFEKQYVAYMEQNDHDIAVSD-----
3be4A           YFEIDDSEIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAP
2bkhA           EERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKLQNRKSPEYLKAGSLKDPLLD
3clvA           ----------------------------------------------------------------------
3cr7C           QRDPKGLYKKAREGVIKEFTGI------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2an9A           -------------------------------------------------MAQAVAEMSHYAEYDYLIVND
1ak2A           EFSIPDSLLIRRITGRLIHPQSGRSYHE------------EFNPPKEPMKDDITGEPLIRRDDNKKALKI
2awoD           ------------------------------------------------------------PNRQQVWLPV
1e9sA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1draA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
2ccjA           -----------------------------------------LNVSAEVGRERIIKNSNRLDQEDLKFHEK
2a5vA           ----------------------------------------------------------------------
1bglA           ----------------------------------------QCTADTLADAVLITTAHAWQHQGKTLFISR
3dfoC           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEEN-RRFYRQLLLTA
2anbA           ------------------------------------------------------------------IVND
3dfqC           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
3dfnD           -----HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2eg5G           ----------------------------------------------------------------------
2cvfA           IAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLER
2b8tD           ENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGC
2ahwD           ----------------------------------------------------------------------
1afrA           ---------------------------------------------------QICGTIAADEKRHETAYTK
2a1fF           ----------------------------------------GIDPAILDRMAVEIKELVEM-GVEVSVVLG
1dyhA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
3c14C           ----------------------------------------------------------------------
4atjA           LLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFPQLKDSFRNVGLNRSSDLVALSGGHTF
1azsC           ----------------------------------------------------------------------
1akeA           DVPDELIVDRIVGRRVHAPSVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGY
1e6cA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2dr3B           -----------------------------------------NKPAMARSIILQLKRVLAGTGCTSIFVSQ
1cjuC           ----------------------------------------------------------------------
1eilA           WDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDAAALERMADKLRQAGVAFTR
1e3mB           VEIGPIDRIFTRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLAKIKALTLFATH
2cbzA           ------------------------------------------------------------LKNKTRILVT
1dkiA           ----------------------------------------------------------------------
3bb1C           -------------------------------------------------------------IPVVLIENS
1e9sK           ----------------------------------------------------------------------
1e2hB           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIR
1accA           KMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKIL------SGYIVEIEDT
2a5vB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3dfqA           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2bkeA           -------------------------------------------------HLHQLTRLAEVYDIAVIITNQ
2a5jA           SNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF---
3bb1G           -----------------------------------------------EALLQVVRSGASLSDIPVVLIEN
2c9oC           LVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRT
1dekA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3brwA           -----------------------------------------------KGFRGGLDVTHGQTGTESVYCNF
3b9qA           -----------------------------------------LDGNTGLNMLPQAREFNEVVGITGLILTK
3bb1H           ----------------------------------------------------------------------
4dfrA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR
3dfnA           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2bbtA           ---------------------------------------------------------------------T
1d6jA           ----------------------------------------------------------------------
2ancD           -----------------------------------------------------------YAEYDYLIVND
3bjdB           YRVEERFPAADLSRALEQEIAAQSRERHPSQYVFSGSASRQLQVFLRHQWFRTFRLYRDAA--DLLVNLT
1e2jB           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3b55A           EAHAKPLKTTNPTASLNDLKPLKNVGSASIVGLGEAT----HGAHEVFTKHRIVKYLVSEKGFTNLVLEE
3cr7A           ----------------------------------------------------------------------
1e4vA           DVPDELIVDRIVRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGY
3cd9A           ----------------------------------------------------------------------
2cckB           ----------------------------------------RLDQEDLKFHEKVIEGYQEIIRFKSVNADQ
2ancB           ------------------------------------------------------------AEYDYLIVND
2bv7A           NATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVN-YTATIDVIY
2b0lC           ----------------------------------------YSELEAIEHIFEELDGNEGLLVASKIITRS
2ancF           ----------------------------------------------------------------------
3dftD           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLLTA
3dfoD           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
3dfpD           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2a1fD           ---------------------------------------------AILDRMAVEIKELVEMGVEVSVVLG
3d1mA           VAEKTLGASGRYEGKITRNSERELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISPGVKLRVTEG
1aldA           --YQY---PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2a1fE           -----------------------------------------------------------EMGVEVSVVLG
421pA           SDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-------------
3dkvA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1dwmA           -----------------------------------------------NMAAATVERENRN-VHAIVLKEG
3a00B           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------ILHSTG
1e2lA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3dfqD           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
3di4A           LTRALADHTGLPLHEAELLNVFCTGFTRDTGQYFKASPVRPGDYLEFFAEIDLLGNL-SACPGGDCSSEA
3dftC           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLLTA
1d2zD           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3d1mB           VAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEEGADRLMTQRCKDKLNALAINQWPGVKLRVT
3bv4A           ---------ALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2bhvD           GSKVIGYYSNNNKMGEYRLDVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYIGITFGDYLLMQLMRQ
1dekB           VFVFDDEGKESVNFVAFNKI---------------------TDVINNIEDQWSVRRLMQALGTDLIVNNF
3cioD           ----------------------------------------------------------------------
2c4rL           FSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSIDINSARGDIEETAFNTNLEAADEIA
3ci2A           -----------------------------------------LVGKSVEEAKKVILQDKPE-AQIIVLPVG
3dmdA           -------------------------------------------------------------------LTK
6aldA           --HSH---PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTA
2aexA           ----------------------------------------APPVTDLGELRRRPLETQAQVCQALAQVDG
1e2mA           ----------------------------------------------------------------------
2bboA           ---------------------------------------------------------------------T
1e2nB           ----------------------------------------------------------------------
3dffA           --RHGRFLDSIYRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLVGE--VADDIRSIIDEFDPTLVVTCA
2bwjB           ----------------------------------------------------------------------
1e2jA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
1d6aA           ----------------------------------------------------------------------
3cddD           IKVIVNTDVGEPFQQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAG---VSLILGDNVKAARG
2dx7A           -------------------------------------------------LKTAKILEERGAECIIAGCTE
3a00A           ----------------------------------------------------------------------
3dvlD           LIERINYAIQKYRARRVS-----------IDSVTSVFQQYDASSVVRRELFRLVARLK-QIGATTVMTTE
2c9oA           -DPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLH
3e70C           -----------------------------------------GDALAGNAIVEQARQFNEAVKIDGIILTK
1e2hA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
2e85A           CAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPD-----DIAEMFMMTTH
2a1fC           ----------------------------------------------ILDRMAVEIKELVEMGVEVSVVLG
3dm5B           -------------------------------------------------------------------VTK
1chdA           -----------------------------------------------EAIRHVLQPLPLSSPAVIITQHM
2boeX           F---AHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSSWIDEFAAGLKNRPAYIIVEPD
1av6A           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2aunA           LGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAAS-PRPLIGFSD
2d4uB           AAAEIKRNYDIYHNALAELIQL---LGAGKINEFFDQPTQGYQDGFEKQYVAYMEQND------------
3cbnA           YDEIRGYGHPELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR---------KGRELKVEI
1e2nA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1cfrA           LRSSLNNV-NLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFL
1dvrA           ----------------------------------------------------------------------
3dyoA           FTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISR
3bwdD           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1dp0A           FTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISR
3cbqA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYLxxxxxxxxx
2d3wB           -RILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL---------
3b5jA           RLS-TVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYL---------
3cmvG           NKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA----------
2b8wA           KCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYI---------
3dmdC           LDADARGGAALSISYVIDAPILFVGVGQGYDDLR---------------
3cmvC           NKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA----------
2c61B           VLPSLSRLMNSGIGAGKTREDHKAVSDQMY-------------------
2dwoA           MDDFMKRISCYEASYQPLDPDKCDRDLSLIKVI----------------
2c03B           LDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYP-----------
3b60A           RLSTIEQ-ADEIVVVEDGIIVERGTHSELLAQHGVYAQLH---------
3eiuA           VLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGYA---------------
2awnD           ESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQL---------
3cmvH           RVKVVPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA----------
3eiuB           VLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGYA---------------
3c95A           -------------------------------------------------
3dmdB           LDADARGGAALSISYVIDAPILFVGVGQGYDDLR---------------
2b8tA           QEFYSA--VCRHHHKVPNRPYLNSNSEEFIKFFK---------------
2akaB           KLDLMDEGTDARDVLENKLLPLRGYIGVVNRSQKDIDGK----------
2c9yA           ALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVF----------
3cmvA           RVKVVKNK-IAAPFKQAEFQILYGEGINFYGELVDLGVK----------
2ccjB           VIEGYQEIIQRFKSVNADQPLENVVEDTY----QTIIKYL---------
2awnB           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPAD--------------
4dcgA           DYPN-----QEYDYFHMYFMLRTVYCNKTFPTTKAKVLFL---------
2ccgA           FHEKVIEGYQEIIHNESQRFKADQPLENVVEDTYTIIKYL---------
3dm5A           LDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE---------------
1bifA           TEDFMRRIECYENSYESLDEEQDRDLSYIKIMDVGQSYV----------
2cgtH           LATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDI---------------
2bbsA           SKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKL---------
2akaA           EQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKT---------------
2c04A           LDGDARGGAALSARHVTGKPIYFAGVSEKPEGLRLAGRIL---------
3dt2A           SWQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKYL---------
1e0jA           LKNPDKGKAHEEGRPVSITDLRGSGALR---------------------
2c03A           LDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE---------------
2d62A           DQ---VEATGDRIAVNKGELQQVGTPDEVYYKPV---------------
1e9sG           -------------------------------------------------
1cr4A           LKDLLRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYM---------
3dt4A           SWQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKY----------
2awoC           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPA---------------
2c61A           DIT-HPIPDLSGYITEGQIVVARELHRKGIYPP----------------
3c8uA           NHDAAVARAQGNDLANARAIEAARLPADLTW------------------
2dwpA           MDDFMKRISCYEASYQPL--DPDKCDRDLSLIKV---------------
2ccgB           YQEIIHNESQRFKSVNAD-----QPLENVVEDTQTIIKYL---------
1e0jB           LKNPDKGKAHEEGRPVSITDLRGSGALRQLSD-TIIALE----------
3b2qB           VLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY----------------
2ctsA           -------------------------------------------------
2a30D           KTNFDYLQEVPILTLD------VNEYESLVEK---VKEFL---------
2a2zD           KTNFDYLQEVPILTLD-VNEDFKDKYESLV---EKVKEFL---------
1e98A           FHQLMKDTTLNWKMVDASKRIEAVHEEIRVLSEDAIRTA----------
2bifA           TEDFMRRIECYENSYESL-------------------------------
2cckA           VIEGYQEIIRFKSVNA------DQPLENVVEDTYTIIKYL---------
1e69A           NKI-VMEAADLLHGVTMVNGVSAIVPVEV--------------------
1d1cA           EQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTA--------------
3dhwC           EMDVVKRICDCVAVISNGELIEQDTVSEVFSHPK---------------
2awoA           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPAD--------------
3dt7A           SWQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKYL---------
2d2eA           QRILNYIQPDKVHVMMDGRVVATGGPELALELEAKGYEWL---------
1e9rA           -------------------------------------------------
2dr3A           VSPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSM---------
2dr3E           VSVGVEHGVDGIIRLDLDEIDGELKRSLIVWKMR---------------
1e9cA           FHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA------------
2bc9A           KLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR---------------
3cmwC           -------------------------------------------------
2bjbA           DLTNAVAFLSAAVVSGGTVRITGWPRVSVQPADHILAIL----------
2bbsB           SKMEHLKKADKILILHEGSSYFYGTFSELQNLRDSFDQFS---------
2czvA           SISMYP---EII-------------------------------------
1e9sB           -------------------------------------------------
3d31A           DQTEARIMADRIAVVMDGKLIQVGKPEEIFEK-----------------
1b0uA           EMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQSLQQFL---------
2d4hB           SNSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDL--------------
3bo6B           EEPFYRLMAE---------------------------------------
2a30B           KTNFDYLQEVPILTLD------VNEYESLVE--KVKEF-----------
3cmxA           FKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSY----------
3cmvE           VVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLI----------
2awnC           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPA---------------
1e9dA           FHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA------------
2d3wD           YQRILYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL---------
3cmtD           FKQAEFQILYGEGINFYGELVDLGVKEKLIEKA----------------
1e9sD           SNEASKALTSARFVLSDKLPEHVTMPDGDFSIRS---------------
2d2fA           QRILNYIQPDKVHVMMDGRVVATGGPELALELEAKGYEWL---------
2b8wB           DETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQ----------
3cmuA           -------------------------------------------------
2awnA           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPA---------------
1e2dA           FHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA------------
1e3aB           DKWYSASGYETTQDGPTGSLNISVGAKILYEAV----------------
2a30A           KTNFDYLQEVPILTLD------VNEYESLVEK---VKEFL---------
3czpB           -------------------------------------------------
2dflA           VMHTLYHVPGIRIQLKKS-RG-NRRIARVVDAPH---------------
3da4A           -------------------------------------------------
2d3wA           QRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL---------
3bh0A           LSRQVEQRQDKRPMLSDLSGQLEQDADIIEFLYR---------------
2a2zB           KTNFDYLQEVPILTLD-VNEDFKDKYESLV---EKVKEFL---------
1e9sF           -------------------------------------------------
2bhjA           TVFPQRSDGKHDFRLWNSQLIRYAGYQMPDG-TIRGD------------
1e9sE           -------------------------------------------------
1e9sL           -------------------------------------------------
2d3wC           RI-LDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL---------
3bpbA           E----ESYAANCIWVNERVIMPAGYPRTREKIARLGYRVI---------
3b2qA           MPGDDITHPIPDLSGYITEGQIVVARERKGIYPPI--------------
2d4hA           KCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYI---------
1e3mA           YFELTQLPEKEGVANVHLDALEHGDTIAFHSVQDGA-------------
1e2gA           FHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA------------
1e9sJ           SNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWL-------------
2bbtB           -KMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKL---------
1e9sM           -------------------------------------------------
3d3kA           IPQQVFQEVGINYHSPFGCKFV---------------------------
2b92B           KKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQV---------------
3ch4B           VEQRLEEQLENLIEFIRS-------------------------------
1cs4C           -------------------------------------------------
1e4yA           YSKEAEAGNTKYAKVDGTKPVAEVRAD--------LEKIL---------
1cjtC           -------------------------------------------------
1e9sH           -------------------------------------------------
1e9rF           -------------------------------------------------
2d7vA           -------------------------------------------------
2d7vB           -------------------------------------------------
2dr3D           VSVGERGFGGPGVHGVDGIIRLDLDEIDGELKRSL--------------
3bgwA           LSRQVEQRQDKRPMLSDLSGQLEQDADIIEFLYR---------------
3dm9B           LDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEK-----------
3dt4C           SWQHGVFVG--AAMRSEATAAAEHKGKVIMHDPFAMRPFF---------
2dr3F           VSPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMR---------------
2cjwB           RDSKE-KNERRLAYQKRK-------------------------------
3c15C           -------------------------------------------------
1culC           -------------------------------------------------
1e9fA           FHQLMKDTTLNWKMVDASKSIEAVHEDIRV-------------------
3d7wA           STDGVFNNPIALAIAPGV-IVTLTNIRDVIASLAIML------------
3cddF           RIPQTGNINTLVPVIDEIGLDEELIASILFSEDD---------------
2bwjA           NAEGTPEDVQLCTAID---------------------------------
3b85A           -------------------------------------------------
2dpyA           -------------------------------------------------
2dpyB           -------------------------------------------------
3bgwD           LSRQVEQRQDKRPMLSDLSGQLEQDADIIEFLYR---------------
3cmvB           -------------------------------------------------
3bk7A           DVLMIDYVSDRLIVFE-GEPGRHGRALPPMGMREGMNRFL---------
2c9gA           -------------------------------------------------
2dr3C           VSG-VEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSM---------
1e9rG           -------------------------------------------------
1ai4B           DKWYSASGYETTQDGPTGSLNISVGAKILYEAVQ---------------
1e9rE           SNEASKALTSARFVLSDKLPEHVTMPDGDFSIR----------------
2a2zA           EYLEKLHYKHESWLLHR--TLKTNFDYLQEVPILTLDV-----------
5dfrA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
1e59A           GNS-LRALVKYLDNMSEEEILELNIPTGVPLVYE---------------
3dtbB           SWQHG-VFVGAAMRSEAKVIMHDPFAMRPFFG-----------------
3bb1E           GRCNKN--DSDEKVLPNGIAWIPHLVQTITEVAL---------------
1dhiA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
1aroP           TLACLTSADNTTVQAVASAIGRAIEDEARFGRIR---------------
1bg0A           DLKTVYKRLVTAVDNIESKLPFSHDDRFGFLTFC---------------
1dhjA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVS----------
1bmfC           HSRLLERAAKMNDAFGGGSLTALPVIETQAGDVS---------------
3dauA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
2b8tC           CQEFYSAVCRHHHKVPNR-PYLNSNSEEFIKFF----------------
2c7cH           LATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQD----------------
2axzC           DLEIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIH--------------
1eamA           TKSDAVNYAKKMYYLNKIVRNKVVVNFDYPNQE----------------
3ed8A           -------------------------------------------------
3cm0A           TPDEVYARIRAA-------------------------------------
1cr2A           -------------------------------------------------
1e1qB           -------------------------------------------------
1drbA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
3czpA           DKRFVKVLRTINDAIEA--------------------------------
2d0kA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
3d3qA           RETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQA-----------
3do6A           -------------------------------------------------
2a5gA           -------------------------------------------------
3dlbB           WIGRRLGLGTPEAVRAQAYRLSIPKLMGRRAV-----------------
2drcA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
2bkiA           -------------------------------------------------
3ecpA           SVLLLEATTFRTVGLLHQEWWMRPDDPADADEKESGKWL----------
3d3qB           RETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAI----------
1cr1A           GSGALRQLSDTIIALERNQLVLVRILKCRFTGD----------------
3a1wA           -------------------------------------------------
1d6jB           -------------------------------------------------
1ckvA           -------------------------------------------------
1e2kA           EDRHIDRLAKRQRPGERL-------------------------------
2b8tB           CQEFYSAVCRHH-HKVPNRPYLNSNSEEF--------------------
1adoA           DDRVNPCIGGVILFHETLYQKA---------------------------
1e9sI           -------------------------------------------------
3ec1A           SLSV-KERKTDIVFSGLGWVTCNDPGAQLVVAPKGVDVFI---------
1e9rD           SNEASKALTSARFVLSDKLPEHVTMPDGDFSIRS---------------
3cddC           RFS-WRQRFSKFTIKADSAGLPTVGGIKADVTDSEIGRYR---------
2axpA           -------------------------------------------------
3bczC           YDESQGEIYRSIEHLDKGSIIEQLDPVSFSNYLKKYHNT----------
3dfnC           DDRVNPCIGGVILFHETLYQKADD-------------------------
3bb1B           RCNSDEKVLPNGIAWIPHLVQTITEVALNKSESIVDKNLI---------
1dg3A           KCFVFDRP-----------------------------------------
2bx2L           NLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQ---------------
2ck3C           HSRLLERAAKMNDAFGGGSLTALPVIETQAGD-----------------
3crmA           RAVGYRQVWDYLDGKLSYAEMTERGIIATRQLAK---------------
1e2fA           FHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA------------
3dfpC           DDRVNPCIGGVILFHETLYQKAD--------------------------
3dymA           KTYRIDGSGQMAITVDVE-VASDTPH-----------------------
3c7kA           -------------------------------------------------
1cr0A           DLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYM---------
2bofX           SQARIYFDAGHSAWHSASWLQQADISNSAHGIATNTSNY----------
2bdtA           -------------------------------------------------
3bb1F           GRCNKNDSDEK--VLPNGIAWIPHLVQTITEVAL---------------
1e9rB           -------------------------------------------------
2d4uA           -------------------------------------------------
3be4A           LVKFYEDLGILKRV------NAKLPPKEV--------------------
2bkhA           DHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGV-----------------
3clvA           -------------------------------------------------
3cr7C           -------------------------------------------------
3e8aC           -------------------------------------------------
3adkA           -------------------------------------------------
2an9A           DFDTALTDLKTIIRAERLRMSRQKQRHDALISKLL--------------
1ak2A           RLEAYHTQTTPLVEYYSKAIDASQTPDVVFASIL---------------
2awoD           ESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQL---------
1e9sA           -------------------------------------------------
3dfdA           -------------------------------------------------
1draA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF----------
2ccjA           VIEGYQEIIHRFKSVNADQPLENVVEDTY----QTIIKYL---------
2a5vA           -------------------------------------------------
1bglA           KTYRIDGSGQMAITVDVEVASDTPHPARIGLNC----------------
3dfoC           DDRVNPCIGGVILFHETLYQKADDGRPFP--------------------
2anbA           DFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD------------
3dfqC           DDRVNPCIGGVILFHETLYQKADGRPF----------------------
3dfnD           DDRVNPCIGGVILFHETLYQKADGRPF----------------------
2eg5G           -------------------------------------------------
2cvfA           HRFRPEGLMAYFRITERGIEDVE--------------------------
2b8tD           QE-FYSAVCRHHHKVPNRPYLNSNSEEFIKFNKK---------------
2ahwD           -------------------------------------------------
1afrA           IVEKLFEIDPDGTVLAFADMMRKKISMP---------------------
2a1fF           GGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSL----------
1dyhA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYE------------------
3c14C           -------------------------------------------------
4atjA           GKNQCRFIMDRLYNFS-NTGLPDPTLNTTYLQT----------------
1azsC           -------------------------------------------------
1akeA           YSKEAEAGNTKYAKVDGTKPVAEVRADLEK-------------------
1e6cA           -------------------------------------------------
1dw9A           -------------------------------------------------
2dr3B           VSVGERGFGGPGVEHGVDGIILDLDEIDGELKRSLIVW-----------
1cjuC           -------------------------------------------------
1eilA           GD--EALMQQRKVMGLLCLQDPFGLPLEIYYGPA---------------
1e3mB           YFELTQLPEKEGVANVHLDALEHGDTIAFHSVQDGA-------------
2cbzA           HSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFL---------
1dkiA           -------------------------------------------------
3bb1C           GRCNKNDSDEK--VLPNGIAWIPHLVQTITEVAL---------------
1e9sK           -------------------------------------------------
1e2hB           R--VYGLLANTVRYLQCGGSWREDWGQLSGPQSNAG-------------
1accA           EGLKEV-INDRYDMLNISSLRQDGKTFID--------------------
2a5vB           -------------------------------------------------
3cr7D           -------------------------------------------------
3dfqA           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
2bkeA           VVPG---IRIQLKKSRGNRRIARVVDAPHLPEGEVVFAL----------
2a5jA           -------------------------------------------------
3bb1G           SGRC-NKNDSDEKVLPNGIAWIPHLVQTITEVAL---------------
2c9oC           MLYTPQEMKQIIKIR----------------------------------
1dekA           -------------------------------------------------
2axnA           -------------------------------------------------
3brwA           RNKLPYTEGDAQQLQRKR-HIGNDIVAVVFQDEN---------------
3b9qA           LDGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQPFDP-----------
3bb1H           -------------------------------------------------
4dfrA           VYEQFLPKAQKLYLTHIDAEVEGDTHFPDYE------------------
3dfnA           DDRVNPCIGGVILFHETLYQKADD-------------------------
2bbtA           SKMEHLKKADKILILHEGSSYFYGTFSELQNLR----------------
1d6jA           -------------------------------------------------
2ancD           DFDTALTDLKTIIRAERLRMSRQKQRHDALISKLL--------------
3bjdB           DVD-EAAALARYLYGELGEEDEKGSHPRLLAKL----------------
1e2jB           -------------------------------------------------
3cnlA           -------------------------------------------------
3b55A           GWDRALELDRYVLTGKG---NPSQHLTPVFKTK----------------
3cr7A           -------------------------------------------------
1e4vA           YSKEAEAGNTKYAKVDGTKPVAEVRAD----------------------
3cd9A           -------------------------------------------------
2cckB           PLENVVEDTYQT-------------------------------------
2ancB           DFDTALTDLKTIIRAERLRMSRQQRHDALISKL----------------
2bv7A           EMYTRMNAELNYKV-----------------------------------
2b0lC           VIVNALRKLESAGVIESRSLGMKGTYIKVLNNKFLIELE----------
2ancF           -------------------------------------------------
3dftD           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
3dfoD           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
3dfpD           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
2a1fD           GGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLF---------
3d1mA           WDEDGHHSEESL--HYEGRAVDITTSDRDRSKYGMLARLA---------
1aldA           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
2a1fE           GGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSL----------
421pA           -------------------------------------------------
3dkvA           -------------------------------------------------
1ek0A           -------------------------------------------------
1dwmA           SAMTKDFRCDRVWVIVNDHGVVTSVP-----------------------
3a00B           -------------------------------------------------
1e2iA           -------------------------------------------------
3cqcA           QYQECLQLADMV-SSERHKLYLVFSKEELR-------------------
1e2lA           -------------------------------------------------
2ahvA           -------------------------------------------------
3dfqD           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
3di4A           SCH-----PLLVEIFAPAEGLGDWPSPSVN-------------------
3dftC           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
1d2zD           -------------------------------------------------
1cjvC           -------------------------------------------------
3d1mB           EGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLA---------
3bv4A           DDRVNPCIGGVILFHETLYQKA---------------------------
2bhvD           SGQILRDKIAPIVVIREGSRVFISPNTDIFFPIEVIAEFL---------
1dekB           DRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDH----------------
3cioD           -------------------------------------------------
2c4rL           RQLRMTPVRHQRAVENRLREAVRQDRARIQISHISRFGLL---------
3ci2A           TIVTMEYRIDRVRLFVDKLDNIAQVP-----------------------
3dmdA           LDADARGGAALSISYVIDAPILFVGVGQGYDDLWFLERIF---------
6aldA           DDRVNPCIGGVILFHETLYQKADGRP-----------------------
2aexA           GANFSVDRWERKEGLQDGCVFEKAGVSISVVHGN---------------
1e2mA           -------------------------------------------------
2bboA           SKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKL---------
1e2nB           -------------------------------------------------
3dffA           AI---GEHPDHEATRDAALFATHEKNVPVRLWEDLPYAV----------
2bwjB           -------------------------------------------------
1e2jA           IRRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF---------
1d6aA           -------------------------------------------------
3cddD           RFS-WRQRFSKFTIKDSAGLPTVGGIKA---------------------
2dx7A           VSVVLKQDDLKVPLIDPMDVIAEVAVKVAL-------------------
3a00A           -------------------------------------------------
3dvlD           RIEEYGPIARYGVFVSDNVVILRNVLEGERRRRTLE-------------
2c9oA           DLDVANGEINKVVNKYIDQGIAELVPGVLFVDEV---------------
3e70C           LDADARGGAALSISYVIDAPILFVGVGQGYDDLWFLERIF---------
1e2hA           IRRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF---------
2e85A           NMPLNYLIDDIGEVIFLGIQPDIVGFYYPMTQPI---------------
2a1fC           GGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSL----------
3dm5B           LDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE---------------
1chdA           PPGFTRSFAERLNKLCQISVKEAEDGERVLPG-----------------
2boeX           LISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIY------------
1av6A           -------------------------------------------------
3cueF           -------------------------------------------------
3bb1A           -------------------------------------------------
3cr7B           -------------------------------------------------
2aunA           ISVLLSAFHRHGLPAIHGPVATGLGLQE---------------------
2d4uB           -------------------------------------------------
3cbnA           IVEYEGH------------------------------------------
1e2nA           -------------------------------------------------
1c9kC           -------------------------------------------------
1cfrA           SVKTTFRPDRRLQLAHEGSLMTHLQTRTWTINPTGIRYY----------
1dvrA           -------------------------------------------------
3dyoA           KTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQ------------
3bwdD           -------------------------------------------------
1e2kB           -------------------------------------------------
1e2mB           -------------------------------------------------
3bb1D           -------------------------------------------------
3cnnA           -------------------------------------------------
1dp0A           KTYRIDGSGQMAITVDVE-------------------------------
3cbqA           -------------------------------------------------
2ax4A           -------------------------------------------------
3cddB           -------------------------------------------------
2ax4B           -------------------------------------------------
1e2iB           -------------------------------------------------
3bs4A           -------------------------------------------------
1e2lB           -------------------------------------------------
2bwjD           -------------------------------------------------
2a78A           -------------------------------------------------
1ckeA           -------------------------------------------------
3cphA           -------------------------------------------------