[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81487.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d6jA.bssp"
#ERROR : Can't open dsspfile "3ddhA.bssp"
#ERROR : Can't open dsspfile "3ed5A.bssp"
#ERROR : Can't open dsspfile "3ddhB.bssp"
#ERROR : Can't open dsspfile "2cftA.bssp"
#ERROR : Can't open dsspfile "1aq6A.bssp"
#ERROR : Can't open dsspfile "2ah5A.bssp"
#ERROR : Can't open dsspfile "2cfsA.bssp"
#ERROR : Can't open dsspfile "3dv9A.bssp"
#ERROR : Can't open dsspfile "1cqzB.bssp"
#ERROR : Can't open dsspfile "3cnhB.bssp"
#ERROR : Can't open dsspfile "2b0cA.bssp"
#ERROR : Can't open dsspfile "2c4nA.bssp"
#ERROR : Can't open dsspfile "3bwvA.bssp"
#ERROR : Can't open dsspfile "3e58A.bssp"
#ERROR : Can't open dsspfile "3e58B.bssp"
#ERROR : Can't open dsspfile "2bdeA.bssp"
#ERROR : Can't open dsspfile "3cnhA.bssp"
#ERROR : Can't open dsspfile "2cfrA.bssp"
#ERROR : Can't open dsspfile "2cn1A.bssp"
#ERROR : Can't open dsspfile "2autA.bssp"
#ERROR : Can't open dsspfile "3e81A.bssp"
#ERROR : Can't open dsspfile "2autD.bssp"
#ERROR : Can't open dsspfile "2autB.bssp"
#ERROR : Can't open dsspfile "3ba6A.bssp"
#ERROR : Can't open dsspfile "2b82A.bssp"
#ERROR : Can't open dsspfile "2ebfX.bssp"

## Summary of PDB Search
:219
    3e-20  19%  3d6jA  [x.x.x] PUTATIVE HALOACID DEHALOGENASE-LIKE HYDROLASE
    3e-19  22%  3ddhA  [x.x.x] PUTATIVE HALOACID DEHALOGENASE-LIKE FAMILY
    2e-18  21%  3ed5A  [x.x.x] YFNB
    3e-18  20%  3ddhB  [x.x.x] PUTATIVE HALOACID DEHALOGENASE-LIKE FAMILY
    5e-17  17%  2cftA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    2e-16  20%  1aq6A  [c.108.1] L-2-HALOACID DEHALOGENASE
    6e-16  18%  2ah5A  [x.x.x] COG0546: PREDICTED PHOSPHATASES
    3e-15  17%  2cfsA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    5e-15  17%  3dv9A  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    6e-15  20%  1cqzB  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    3e-14  16%  3cnhB  [x.x.x] HYDROLASE FAMILY PROTEIN
    6e-14  22%  2b0cA  [x.x.x] PUTATIVE PHOSPHATASE
    9e-14  12%  2c4nA  [x.x.x] PROTEIN NAGD
    1e-13  15%  3bwvA  [x.x.x] PUTATIVE 5'(3')-DEOXYRIBONUCLEOTIDASE
    3e-13  18%  3e58A  [x.x.x] PUTATIVE BETA-PHOSPHOGLUCOMUTASE
    5e-13  19%  3e58B  [x.x.x] PUTATIVE BETA-PHOSPHOGLUCOMUTASE
    8e-13  13%  2bdeA  [x.x.x] CYTOSOLIC IMP-GMP SPECIFIC 5'-NUCLEOTIDASE
    1e-11  17%  3cnhA  [x.x.x] HYDROLASE FAMILY PROTEIN
    5e-10  14%  2cfrA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    5e-10  16%  2cn1A  [x.x.x] CYTOSOLIC 5'-NUCLEOTIDASE III
    1e-09   8%  2autA  [x.x.x] APHA
    1e-09  15%  3e81A  [x.x.x] ACYLNEURAMINATE CYTIDYLYLTRANSFERASE
    4e-08   8%  2autD  [x.x.x] APHA
    1e-06   9%  2autB  [x.x.x] APHA
    1e-06  16%  3ba6A  [x.x.x] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM[MASQUE :
    4e-05  11%  2b82A  [c.108.1 (1rm7A)] CLASS B ACID PHOSPHATASE
    2e-04  10%  2ebfX  [x.x.x] DERMONECROTIC TOXIN
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLETALGLWREFHR
3d6jA           -YTVYLFDFDYTLADSSR-----------------GIVTCFRSVLERHGYTGITDDIKRTIGKTLEESFS
3ddhA           LIKVIAFDADDTLWSNEPFFQEVEKQYTDLLKPYGT----SKEISAALFQTENNLQILGYGAKAFTISVE
3ed5A           -YRTLLFDVDDTILDAAEALALRLLFEDQNIPLTNDKAQYKTINQGLWR----AFEEGKTRDEVVNTRFS
3ddhB           LIKVIAFDADDTLWSNEPFFQEVEKQYTD----LLKPYGTSKEISAALFQTENNLQILGYGAKAFTISVE
2cftA           ----------------------------------------------------------------------
1aq6A           MIKAVVFDAYGTLFDVQSVAATERAYPGRGEYITQVWRQKQLEYSWLRALMGRYADFWGVTREALAY---
2ah5A           SITAIFFDLDGTLVDSSI-----------------GIHNAFTYTFKELGVPSPDAKTIRGFGPPLESSFA
2cfsA           ----------------------------------------------------------------------
3dv9A           -LKAVLFDDG-VLFDSPN-----------------HAESWHKIKRFGFGLSREEAYHEGRTGASTINIVS
1cqzB           --RVAAFDLDGVLALPSIAFRRSEEALALPRDFLLGAYQTEFPE-GPTEQLMKGKITFSQWVPLMDESYR
3cnhB           -IKALFWDIGGVLLTNGWDRE------------------QRADVAQRFGLDTDDFTERHRLAAPELELGR
2b0cA           --MLYIFDLGNVIV-DIDFNRVLGAWSDL--------TRIPLASLKKSFHMGEAFHQHERGEISDEAFAE
2c4nA           -IKNVICDIDGVLMHDNVAVPFLHGIMDKGLPLVLLTNYPSQTGQDLANRFAMATADFLRRQEGKKAYVV
3bwvA           ---------------------------------------------------------------AVVKAVN
3e58A           -VEAIIFDDG-VLFDTEK-----YYYDR--------RASFLGQKGISIDHLPPSFFIGGNTKQVWENILR
3e58B           ----------------------------------------------------------SFFIQVWENILR
2bdeA           -----------------------------------ISFSDQKKIYRIYVDLGDPNYAIDTSFSIAYGQLV
3cnhA           -IKALFWDIGGVLLTNGWDREQR--------------ADVAQRFGLDTDDFTERHRLAAPELELGRTLAE
2cfrA           ----------------------------------EQLFSSALCAARLLRQRPGPPDAPGAVFVLGGEGLR
2cn1A           -KLQIITDFDMTLSRFSYCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYT
2autA           ------------------------------------------------------GFDIDDTVLFSSPGFW
3e81A           ----------------------------------------------------------------------
2autD           ---------------------------------------------------MAVGFDIDDTVLFSSPGFW
2autB           ---------------------------------------------------------------GFWRGKK
3ba6A           ----------------------------------------------------------------------
2b82A           ----------------------------------------------------------------------
2ebfX           ----------------------------------GQKFVVFADSSLLNSTPGTGRPGLVQ----YLKIPA


                         .         .         *         .         .         .         .:140
query           RLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLAVVSNWDATLPEILEVVGLGR
3d6jA           ILTGITDADQLESFRQEYSKEADIYNANTILFPDTLPTLTHLKKQGIRIGIISTKYRFRILSFLRNHPDD
3ddhA           TALQISNGKIAADIIRQIVDLGKSLLKPIELLPGVKETLKTLKETGYKLVVATKGDLLDQEKLERSGLSP
3ed5A           ALLKEYGYEADGALLEQKYRRFLEEG--HQLIDGAFDLISNLQQ-QFDLYIVTNGVSHTQYRLRDSGLFP
3ddhB           TALQISNGKIAADIIRQIVDLGKSLLKPIELLPGVKETLKTLKETGYKLVVATKGDLDQENKLERSGLSP
2cftA           ----------------------------HFSFAKLREACAHLRDPECLLVATDRDPWHPLSDPGTGSLAA
1aq6A           -------TLGTLGLEPDESFLADMAQAYNRLTPYPDAAQCLAELAPLKRAILSNGAPDMLQLVANAGLTD
2ah5A           TCLSKDQISEAVQIYRSYYKAKGIYE--AQLFPQIIDLLEELSSSY-PLYITTTKDTSTAQDAKNLEIHH
2cfsA           ----------------------------HFSFAKLREACAHLRDPECLLVATDRDLSDGSRTPGTGSLAA
3dv9A           RRERGHDATEEEIKAIYQAKTEEFNKCPKAERPGALEVLTKIKSEGLTPVVTGSGL---LDRLNHNFPGI
1cqzB           KSSKACGANLPENFSISQIFSQAMAA--RSINRPMLQAAIALKKKGFTTCIVTNNWLDDGDAQMMCELSQ
3cnhB           TLAEYLEQVVFYQPRDFTPEDFRAVEEQSQPRPEVLALARDLGQRYRYSLN-NEGRDLNEYRIRTFGLGE
2b0cA           ALC-----HEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNNRLHTTFWPEEYPEIR
2c4nA           GEGALIHELYKAGFTITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNDTHGRGFYPACGALCA
3bwvA           ERADLNIKESLNGKK-LGLVDILKEFFRNLDVPHAQEVVKQLN-EHYDIYIATAAVPTSFH-DKYEWLLE
3e58A           DEYDKWDVSTLQEEYNTYKQNNPL-PYKELIFPDVLKVLNEVKSQGLEIGLASSSVKDIFRALEENRLQG
3e58B           DEYDKWDVST-LQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSVKADIFRALEENRLQG
2bdeA           DLKDTNPDKPSYQAIAQDVQYCVDKKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYYDNLRFLSVNP
3cnhA           YL--EQVVFYQPRDFTPEDFRAVEEQ--SQPRPEVLALARDLGQRYRYSLNNEGRDLNEY-RIRTFGLGE
2cfrA           AELRAAGLRAGDPSAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSGSRTPGTGS
2cn1A           KSHG----LLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIDVLEEVIRQAGVYH
2autA           RGKKTYSPDSDDYLKNPAEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSTKTETVSKTLADNF
3e81A           ------------------MFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKEIVRRRAEKLKVDY
2autD           RGKKTYDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSTKTETVSKTLADNF
2autB           TYSPDSDDYLKNPAFWEKMNNGW--DEFSIPKEAARQLIDMHVRRGDSIYFVTGRSTKTETVSKTLADNF
3ba6A           ------------------------------PRKEVMGSIQLCRDAGIRVIMITG-DGTAIAICRRIGIFG
2b82A           ----------------------------SIPKEVARQLIDMHVRRGDAIFFVTGSPTKTETVSKTLADNF
2ebfX           TVV-------------DSDGAWQFLPDVASSRVPIEV------------TELENWQVLTPPQGKILGLKQ


                         +         .         .         .         .         *         .:210
query           YFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGDAEADLLGAEAVGMRALLFDPLGENPKALPR
3d6jA           WFDIIIGGEDVTHHKPDPEGLLLAIDRLKACPEEVLYIGDSTVDAGTAAAAGV-----------------
3ddhA           YFDHIEVS------DKTEKEYLRLLSILQIAPSELLVGNSFKSDIQPVLSLGGYGVHIPFEVWKHETFAH
3ed5A           FFKDIFVSEDTGFQKPKEYFNYVFERIPQFSAEHTLIIGDLTADIKGGQLAGLDTCWNPDKPNVPEIIP-
3ddhB           YFDHI------EVSDKTEKEYLRLLSILQIAPSELLVGNSFKSDIQPVLSLGGYGVHIPFEETFAHEVKR
2cftA           AVETASGRQALVVGKPSPYMFECITENFSIDPARTLMVGDLETDILFGHRCGMTTVLTLTGVSRLEEAQ-
1aq6A           SFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQEALAREL
2ah5A           FFDGIYGSSPEA--PHKADVIHQALQTHQLAPEQAIIIGD-TKFDLGARETGIQKLAITWGFGEQADLLN
2cfsA           AVETASGRQALVVGKPSPYMFECITENFSIDPARTLMVGDLETDILFGHRCGMTTVLTLTGVSRLEEAQA
3dv9A           FQANLVTAFDVKYGKPNPEPY-LALKKGGFKPNEALVIENAPLGVQAGVAAGIFTIAVNTGPLHDNVL--
1cqzB           HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDD------------------------------
3cnhB           FLLAFFTSSALG--VKPNPAYRLGLTLAQVRPE-EAVVDDRLQNVQAARAVGHAVQCVDA-AQLREELAA
2b0cA           DADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAK
2c4nA           GIEKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDLRTDILAGFQAGLETILVLSGVSSLDDIDS
3bwvA           YFPFLDPQHFVFCGRKNIILA-------------DYLIDDNPKQLEIFEGKSIFTASHNVYEHRFERVSG
3e58A           FFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGDQSLDS
3e58B           FFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGDQSLDS
2bdeA           ENGTTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGLRLKKDCNWRTALVVEELGEEIASLP
3cnhA           FLLAFFTSS--ALGVKPNPAYRLGLTLAQV-RPEEAVVDDRLQNVQAARAVGHAVQCV------------
2cfrA           LAAAVESGRQALVVGKPSPYFECITENFSIDPARTLVGDRLETDILFGHRCGTTVLTL------------
2cn1A           PLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDEL
2autA           HIPAANM---NPVIFAGDKPEQNTNVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRI------------
3e81A           LFQG---------VVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVP-------------
2autD           HIPAANMNP---VIFAGDKPEQNTNVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRI------------
2autB           HIPAANM---NPVIFAGDKPEQNTNVQWLQEKNMRIFYGDSDNDITAARDCGIRGIR-------------
3ba6A           ENEEVADRAYTGFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEI-----------------
2b82A           HIPATNMNP---VIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARG---------------
2ebfX           FKLTAGFPTEQSRLPLLESVSEDLREELMQKIDAIKNDVKMNSLV-------------------------


                         .         .         .         +         .         .         .:280
query           LERVLDYLx
3d6jA           ---------
3ddhA           ---------
3ed5A           ---------
3ddhB           LDDLLSLL-
2cftA           ---------
1aq6A           VSGTIAPL-
2ah5A           ---------
2cfsA           Y--------
3dv9A           ---------
1cqzB           ---------
3cnhB           LG-------
2b0cA           V--------
2c4nA           MPFRPSW--
3bwvA           WRDVKNYF-
3e58A           LTDVLDLI-
3e58B           LTDVLDLI-
2bdeA           IEK------
3cnhA           ---------
2cfrA           ---------
2cn1A           LEKYMD---
2autA           ---------
3e81A           ---------
2autD           ---------
2autB           ---------
3ba6A           ---------
2b82A           ---------
2ebfX           ---------