[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81497.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d54A.bssp"
#ERROR : Can't open dsspfile "2btuA.bssp"
#ERROR : Can't open dsspfile "2btuB.bssp"
#ERROR : Can't open dsspfile "3c9tB.bssp"
#ERROR : Can't open dsspfile "3c9uB.bssp"
#ERROR : Can't open dsspfile "3c9uA.bssp"
#ERROR : Can't open dsspfile "3c9tA.bssp"
#ERROR : Can't open dsspfile "1cliA.bssp"
#ERROR : Can't open dsspfile "3c9rA.bssp"
#ERROR : Can't open dsspfile "1cliB.bssp"
#ERROR : Can't open dsspfile "3c9rB.bssp"
#ERROR : Can't open dsspfile "3c56A.bssp"
#ERROR : Can't open dsspfile "3ebeB.bssp"
#ERROR : Can't open dsspfile "2btuA.bssp"
#ERROR : Can't open dsspfile "2btuB.bssp"
#ERROR : Can't open dsspfile "3c9tB.bssp"
#ERROR : Can't open dsspfile "3c9uB.bssp"
#ERROR : Can't open dsspfile "3c9uA.bssp"
#ERROR : Can't open dsspfile "3c9tA.bssp"
#ERROR : Can't open dsspfile "1cliA.bssp"
#ERROR : Can't open dsspfile "3c9rA.bssp"
#ERROR : Can't open dsspfile "1cliB.bssp"
#ERROR : Can't open dsspfile "3c9rB.bssp"

## Summary of PDB Search
:725
    3e-91  40%  3d54A  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    3e-48  17%  2btuA  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
    3e-46  20%  2btuB  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
    2e-41  17%  3c9tB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    2e-40  17%  3c9uB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    2e-37  17%  3c9uA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    8e-37  16%  3c9tA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    5e-36  16%  1cliA  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    1e-33  17%  3c9rA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    3e-32  17%  1cliB  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    7e-28  19%  3c9rB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE
    6e-13  15%  3c56A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    6e-13   9%  3ebeB  [x.x.x] PROTEIN MCM10 HOMOLOG
    1e-13  18%  2btuA  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE(query 424->697)
    6e-11  17%  2btuB  [x.x.x] PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE(query 458->689)
    7e-12  16%  3c9tB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 402->644)
    2e-12  16%  3c9uB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 405->644)
    3e-10  18%  3c9uA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 408->690)
    7e-12  16%  3c9tA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 405->644)
    1e-07  13%  1cliA  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE(query 458->698)
    4e-08  20%  3c9rA  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 406->551)
    6e-06  20%  1cliB  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE(query 407->548)
    2e-11  21%  3c9rB  [x.x.x] THIAMINE MONOPHOSPHATE KINASE(query 430->697)
:725

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
3d54A           -------------YLNILKEKLGREPTFVELQAFSVMWSEHCGYSHTKKYI---------RRLPKTGNAG
2btuA           -----------------------------------------------KKHVQTTMRKEVLGGFGGMFDLS
2btuB           ----------------------------------------------------VQTTMRKEVLGGLGGFGG
3c9tB           ------------------------------------------------------------ESKVIGDDTA
3c9uB           ------------------------------------------------------------ESKVIGDDTA
3c9uA           -----------------------------------------------FGLIDLIKKTL--ESKVIGDDTA
3c9tA           ------------------------------------------------------------ESKVIGDDTA
1cliA           -----------------------------------------------------------ALPQKYREPVL
3c9rA           ------------------------------------------------------------ESKVIGDDTA
1cliB           ---------------------------------------------------------------KYREPVL
3c9rB           --------------------------------------------------------------KVIGDDTA
3c56A           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
3d54A           VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMS--------RIIDG
2btuA           KFALEEPVLVSVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPS----KIEN
2btuB           MFDLEEPVLVSGGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSK----IEN
3c9tB           PVEYCSKKLLLVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVS---YVER
3c9uB           PVEYCSKKLLLVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVS---YVER
3c9uA           PVEYCSKKLLLVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVS---YVER
3c9tA           PVEYCSKKLLLVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVS---YVER
1cliA           VSGTD-----GVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDT----ASA
3c9rA           PVEYCSKKLLLVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVS---YVER
1cliB           VSGTD-----GVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDT----ASA
3c9rB           PVEYCSKKLLLVLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLPEDLEVS---YVER
3c56A           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
3d54A           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMVDSKASRPGQVIVIFGGATGRDGTK
2btuA           IVKGISEGCRQAGCALIGGETAEMPGMYSEYDLAGFTVGIVDKKKIVTGEKIEAGHVLI-GLASSGIHSN
2btuB           IVKGISEGCRQAGCALIGGETAEMPGYTEEYDLAGFTVGIVKKKIVTGEKIEAGHVLIG----LASSGIH
3c9tB           FYIGVKRACEFYKCEVVGGNISKSEKI----GISVFLVGET-ERFVGRDGARLGDSVFV----SGTLGDS
3c9uB           FYIGVKRACEFYKCEVVGGNISKSEKI----GISVFLVGET-ERFVGRDGARLGDSVFV----SGTLGDS
3c9uA           FYIGVKRACEFYKCEVVGGNISKSEKI----GISVFLVG-ETERFVGRDGARLGDSVFV----SGTLGDS
3c9tA           FYIGVKRACEFYKCEVVGGNISKSEKI------GISVFLVGETERVGRDGARLGDSVFV----SGTLGDS
1cliA           VISGIAEGCLQSGCSLVGGETAEMPYHGEDYDVAGFCVGVVEKSEIDGSKVSDGDVLIA----LGSSGPH
3c9rA           FYIGVKRACEFYKCEVVGGNISKSEKI----GISVFLVG-ETERFVGRDGARLGDSVFV----SGTLGDS
1cliB           VISGIAEGCLQSGCSLVGGETAEMPGHGEDYDVAGFCVGVVKSEIIDGSKVSDGDVLIALG--SSGPHSN
3c9rB           FYIGVKRACEFYKCEVVGGNISKSEKI----GISVFLVG-ETERFVGRDGARLGDSVFV----SGTLGDS
3c56A           ----------------VKGNEILLKAHKEGYGVGAFNFVNFEMNAIFEAGNEENSPLFIQASEGAIKYMG
3ebeB           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GAAFASRELKEEKAEDRPAVQVGDPFLGKLLMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGV
3d54A           -----------------LSIQVGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
2btuA           GYSLVRKVLLEDGELIYGRLELGEELLKKIYVKPILELLKNHEVYGMAHITGGGFIENIPRML-PEGIGA
2btuB           SNGYSL--VRKVLLEDGP---LGEEKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRML-PEGIGA
3c9tB           RAGLELLLMEKEEYEPFELALIQRHLRPTARIDY---VKHIQKYANASMDISDGLVADANHLAQRSGVKI
3c9uB           RAGLELLLMEKEEYEPFELALIQRHLRPTARIDY---VKHIQKYANASMDISDGLVADANHLAQRSGVKI
3c9uA           RAGLELLLMEKEEYEPFELALIQRHLRPTARID---YVKHIQKYANASMDISDGLVADANHLAQRSGVKI
3c9tA           RAGLELLLMEKEEYEPFELALIQRHLRPTARID---YVKHIQKYANASMDISDGLVADANHLAQRSGVKI
1cliA           SNGYSLKILEVSGCDPQTTELDGKPLADHLYVKSVLELIEKVDVHAIAHLTGGGFWENIPRVL-PDNTQA
3c9rA           RAGLELLLMEKEEYEPFELALIQRHLRPTARID---YVKHIQKYANASMDISDGLVADANHLAQRSGVKI
1cliB           GYSLVRKILEVSGCDPQTTELDGKPLADHLYVKSVLELIEKVDVHAIAHLTGGGFWENIPRVL-PDNTQA
3c9rB           RAGLELLLMEKEEYEPFELALIQRHLRPTARIDYVKHI--QKYANASMDI-SDGLVADANHLAQRSGVKI
3c56A           IDMAVGMVK--IMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHALTSKVVKMAHNAGVSV
3ebeB           ----------------------------------------------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELHLDLVPTREEGMTPEELLLSESQERMVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGE
3d54A           IVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRND
2btuA           EIELGSWKIQPIFSLLQEVGKLEEKEGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTF-----
2btuB           EIELGSWKIQPIFSLLQEVGKLEEKEMMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQG----------
3c9tB           EILSEKLPCEKYGKNPIEYALFGGEDYLLFHPKERWNPFLD-----------------------------
3c9uB           EILSEKLPCEKYGKNPIEYALFGGEDYLLFHPKERWNPFLD-----------------------------
3c9uA           EILSEKLPCEKYGKNPIEYALFGGEDYLLFHPKERWNPFLD---------MTEIGRVEEGE--GVFVDGK
3c9tA           EILSEKLPCEKYGKNPIEYALFGGEDYLLFTHPKERWNP--------FLDMTEIGRVEEGE--GVFVDGK
1cliA           VIDESSWQWPEVFNWLQTAGNVEHHEGMIIALPAPEVDKALALLNANGENAWKIGIIKASDSEQRV----
3c9rA           EILSEKLPLSNELKMYCEKYGKNPIE-YALFGGEDYQFTHPKERWNPFLDMTEIGRVEEGE--GVFVDGK
1cliB           VIDESSWQWPEVFNWLQTAGNVEHHEGMIIALPAPEVDKALALLNANGENAWKIGIIKASDSEQRV----
3c9rB           EILSEKLPLSNEGKNPIEYALFEDYQLLFTHPKERWNPFLD-----------------------------
3c56A           EAELGRLMGIAVLVNPKEAQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEKRLTNIPLVLHGAS
3ebeB           ----QYHVEKFSGLRIRKPRVSSSERKMRKLIRLAQLQNKIATEKLEEEDWVTFGVIVKKITTFSIWRLN
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVAEVPTEALAEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT
3d54A           LVMEVPVQLLANAPEEDI------------------VEYTPGKIPEFKRVEFEEVNAREVFEQYDHMVGT
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           KVEPKG----------------------------------------------------------------
3c9tA           KVEPKG----------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           KV--------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------
3c56A           AIPDNVRKSYDAGGDLKGSKGVPFEFINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFS--------
3ebeB           DLKDLDKY--------ISLFLFGDVHKEHWKTDQG-----------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ---------------------------------------------------MRLKEL-GEFGLIDLIKKT
3c9uB           ------------------------------------------------------LKELGEFGLIDLIKKT
3c9uA           ---------------------------------------------------------LGEFGLIDLIKKT
3c9tA           ------------------------------------------------------LKELGEFGLIDLIKKT
1cliA           ----------------------------------------------------------------------
3c9rA           -------------------------------------------------------KELGEFGLIDLIKKT
1cliB           --------------------------------------------------------KGVVKKTRRPEVGA
3c9rB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKPLAYTDGLNLG
3d54A           DTVVPPG-FGAAVMRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
2btuA           ---GFGGMFDLSKFALEEPVLGVGTKLMLAFMADK--HDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACG
2btuB           -------------------------------------HDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACG
3c9tB           LESKVIG-DDTAPVEYCSKKLLLTTLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLP
3c9uB           LESKVIG-DDTAPVEYCSKKLLLTTLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLP
3c9uA           LESKVIG-DDTAPVEYCSKKLLLTTLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLP
3c9tA           LESKVIG-DDTAPVEYCSKKLLLTTLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLP
1cliA           -------------------------------------HDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATG
3c9rA           LESKVIG-DDTAPVEYCSKKLLLTTLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLP
1cliB           LCALPQKYREPVLVSGTD---GVGTKLRLAMDLKR--HDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATG
3c9rB           ---------DTAPVEYCSKKLLLTTLNEGVHFLRSYIPEAVGWKAISVNVSDVIANGGLPKWALISLNLP


                         *         .         .         .         .         +         .:560
query           SPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAMVGVVGVLEVDKRAEMGFRRP
3d54A           DPDVDPV--GLSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVA-------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
2btuA           KAEPS----KIENIVKGISEGCRQAGCALIGGETA-EMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEA
2btuB           KAEPS----KIENIVKGISEGCRQAGCALIGGETAEMPGMYTEEYDLA--GFTVGIVDKKKIVTGEKIEA
3c9tB           EDLEVS---YVERFYIGVKRACEFYKCEVVGGNISKS---------EKIGISVFLVGETERFVGRDGARL
3c9uB           EDLEVS---YVERFYIGVKRACEFYKCEVVGGNISKS---------EKIGISVFLVGETERFVGRDGARL
3c9uA           EDLEVS---YVERFYIGVKRACEFYKCEVVGGNI---------SKSEKIGISVFLVGETERFVGRDGARL
3c9tA           EDLEVS---YVERFYIGVKRACEFYKCEVVGGNISKS---------EKIGISVFLVGETERFVGRDGARL
1cliA           KLDVD----TASAVISGIAEGCLQSGCSLVGGET-AEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVSD
3c9rA           EDLEVS---YVERFYIGVKRACEFYKCEVVGGNIS---------KSEKIGISVFLVGETER---------
1cliB           KLDVD----TASAVISGIAEGCLQSGCSLVGGET-AEMPGMYHGEDYDVAGFCVGVVE------------
3c9rB           EDLEVS---YVERFYIGVKRACEFYKCEVVGGNISKSEKIG---------ISVFLVGETERFVGRDGARL


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXXXASEVLYLLTGKEFGHPPRLDLGREKAVQEAIRDLIQRGLTRTAHDVXXXXXXXXX
3d54A           -------------KPKPSKVFAV----------GWNDFELEREKELWRAIRKLSEEGAFILSSSQLLTRT
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
2btuA           GHVLIGLASSGIHSNGSLVRKVLLEDGELIYGRLELPPTKIYVKPILELLKNHEVYGMAHITGGGFIENI
2btuB           GHVLIGLASSGIHSNGYSLVRLLEDGPLGEE---LLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENI
3c9tB           GDSVFVSGTLGDSRAGLELL-LMEKEEYEPFELALIQRHLRPTARIDYVKHIQKYANASMDISDGLVADA
3c9uB           GDSVFVSGTLGDSRAGLELL-LMEKEEYEPFELALIQRHLRPTARIDYVKHIQKYANASMDISDGLVADA
3c9uA           GDSVFVSGTLGDSRAGLELL-LMEKEEYEPFELALIQRHLRPTARIDYVKHIQKYANASMDISDGLVADA
3c9tA           GDSVFVSGTLGDSRAGLELL-LMEKEEYEPFELALIQRHLRPTARIDYVKHIQKYANASMDISDGLVADA
1cliA           GDVLIALGSSGPHSNGRKILEVSGCDPQTTELDGKPLADHLLAKSVLELIEKVDVHAIAHLTGGGFWENI
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           GDSVFVSGTLGDSRAGLEL--LLMEKEEYEPFELALIQRHLRPTARIDYVKQKYANASMDI-SDGLVADA


                         .         +         .         .         .         .         *:700
query           XXMTFPYGVGATVEVREEGLEALFGEAPSRVLFTVEKTRLQEATLLLEERGLPYRVLGETGGKSLTVLxx
3d54A           HVETFEYGLKIEVKLPAHQMVLVFSERTPVVDVPVK----------------------------------
2btuA           ----------------------------------------------------------------------
2btuB           ----------------------------------------------------------------------
3c9tB           ----------------------------------------------------------------------
3c9uB           ----------------------------------------------------------------------
3c9uA           ----------------------------------------------------------------------
3c9tA           ----------------------------------------------------------------------
1cliA           ----------------------------------------------------------------------
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           ----------------------------------------------------------------------
3c56A           ----------------------------------------------------------------------
3ebeB           ----------------------------------------------------------------------
2btuA           PRML-PEGIGAEIEIQPIFSLFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRVQGAGVTF---
2btuB           PRML-PEGIGAEIEIQPIFSLFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGR-----------
3c9tB           NHLAQRSGVKIEIL--------------------------------------------------------
3c9uB           NHLAQRSGVKIEIL--------------------------------------------------------
3c9uA           NHLAQRSGVKIEIYCEKYGKNALFGGEDYQLLFTHPKERWNPF--------LDMTEIGRV----------
3c9tA           NHLAQRSGVKIEIL--------------------------------------------------------
1cliA           PRV-LPDNTQASWQWPEVFNWYRTFNCGVGMIIALPAPEVDKALALLNANGENAWKIGIKASDSEQRV--
3c9rA           ----------------------------------------------------------------------
1cliB           ----------------------------------------------------------------------
3c9rB           NHLAQRSGVKIEILSKNPIEYALFGGEDYQLLFTHPKERW--------NPFLDMTEIGREEGEGVFV---


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxx
3d54A           -------------------------
2btuA           -------------------------
2btuB           -------------------------
3c9tB           -------------------------
3c9uB           -------------------------
3c9uA           -------------------------
3c9tA           -------------------------
1cliA           -------------------------
3c9rA           -------------------------
1cliB           -------------------------
3c9rB           -------------------------
3c56A           -------------------------
3ebeB           -------------------------
2btuA           -------------------------
2btuB           -------------------------
3c9tB           -------------------------
3c9uB           -------------------------
3c9uA           -------------------------
3c9tA           -------------------------
1cliA           -------------------------
3c9rA           -------------------------
1cliB           -------------------------
3c9rB           -------------------------