[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81529.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "3dlaD.bssp"
#ERROR : Can't open dsspfile "3dlaB.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "2c5sA.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "3dlaC.bssp"
#ERROR : Can't open dsspfile "3dlaA.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "2deuA.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "2derA.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "3b9xA.bssp"
#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "2abwA.bssp"
#ERROR : Can't open dsspfile "2e18A.bssp"
#ERROR : Can't open dsspfile "2abwB.bssp"
#ERROR : Can't open dsspfile "3efeD.bssp"
#ERROR : Can't open dsspfile "3efeB.bssp"
#ERROR : Can't open dsspfile "2an1C.bssp"
#ERROR : Can't open dsspfile "1b97A.bssp"
#ERROR : Can't open dsspfile "3b9xC.bssp"
#ERROR : Can't open dsspfile "3bgyB.bssp"
#ERROR : Can't open dsspfile "3b9xD.bssp"
#ERROR : Can't open dsspfile "3dkyE.bssp"
#ERROR : Can't open dsspfile "2derB.bssp"
#ERROR : Can't open dsspfile "3cl6A.bssp"
#ERROR : Can't open dsspfile "3efeA.bssp"
#ERROR : Can't open dsspfile "2d13B.bssp"
#ERROR : Can't open dsspfile "2e89D.bssp"
#ERROR : Can't open dsspfile "3bl5E.bssp"
#ERROR : Can't open dsspfile "1cf9A.bssp"
#ERROR : Can't open dsspfile "3cy6A.bssp"
#ERROR : Can't open dsspfile "3efeC.bssp"
#ERROR : Can't open dsspfile "3dpiA.bssp"
#ERROR : Can't open dsspfile "3cz9A.bssp"
#ERROR : Can't open dsspfile "3bl5A.bssp"
#ERROR : Can't open dsspfile "2detA.bssp"
#ERROR : Can't open dsspfile "3b36A.bssp"
#ERROR : Can't open dsspfile "3b38A.bssp"
#ERROR : Can't open dsspfile "3czaA.bssp"
#ERROR : Can't open dsspfile "3dfyA.bssp"
#ERROR : Can't open dsspfile "1bsuA.bssp"
#ERROR : Can't open dsspfile "2dyiA.bssp"
#ERROR : Can't open dsspfile "3efeF.bssp"
#ERROR : Can't open dsspfile "1bgbB.bssp"
#ERROR : Can't open dsspfile "3bweD.bssp"
#ERROR : Can't open dsspfile "1aa7B.bssp"
#ERROR : Can't open dsspfile "1az0A.bssp"
#ERROR : Can't open dsspfile "2d13C.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1c4fA.bssp"
#ERROR : Can't open dsspfile "3b3aA.bssp"
#ERROR : Can't open dsspfile "3bweE.bssp"
#ERROR : Can't open dsspfile "2e21B.bssp"
#ERROR : Can't open dsspfile "1bsuB.bssp"
#ERROR : Can't open dsspfile "2e21A.bssp"
#ERROR : Can't open dsspfile "2d13A.bssp"
#ERROR : Can't open dsspfile "2an1D.bssp"
#ERROR : Can't open dsspfile "3efbC.bssp"
#ERROR : Can't open dsspfile "1ee1B.bssp"
#ERROR : Can't open dsspfile "3dpiB.bssp"
#ERROR : Can't open dsspfile "2an1B.bssp"
#ERROR : Can't open dsspfile "2ab0A.bssp"
#ERROR : Can't open dsspfile "2d13D.bssp"
#ERROR : Can't open dsspfile "2dufA.bssp"

## Summary of PDB Search
:503
    4e-45  29%  2a9vB  [x.x.x] GMP SYNTHASE
    6e-43  29%  2a9vD  [x.x.x] GMP SYNTHASE
    1e-42  29%  2a9vC  [x.x.x] GMP SYNTHASE
    2e-41  29%  2a9vA  [x.x.x] GMP SYNTHASE
    3e-41  11%  3dlaD  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-40  11%  3dlaB  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    1e-39  46%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    5e-38  46%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    2e-37  47%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    4e-37  13%  2c5sA  [x.x.x] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII
    3e-36  37%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    5e-36  11%  3dlaC  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-35  12%  3dlaA  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    5e-29  21%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    5e-28  16%  2deuA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    6e-28  21%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    2e-27  21%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
    4e-27  17%  2derA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    6e-27  21%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    1e-25  13%  3b9xA  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    8e-24  15%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    1e-23  13%  2abwA  [x.x.x] PDX2 PROTEIN
    3e-23  20%  2e18A  [x.x.x] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    3e-23  13%  2abwB  [x.x.x] PDX2 PROTEIN
    8e-23  11%  3efeD  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    1e-21  12%  3efeB  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    3e-20   8%  2an1C  [x.x.x] PUTATIVE KINASE
    5e-20   7%  1b97A  [c.52.1] RESTRICTION ENDONUCLEASE ECORV
    6e-20  14%  3b9xC  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    1e-19  10%  3bgyB  [x.x.x] POLYNUCLEOTIDE 5'-TRIPHOSPHATASE
    5e-19  12%  3b9xD  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    1e-18   7%  3dkyE  [x.x.x] REPLICATION PROTEIN REPB
    2e-18  19%  2derB  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    3e-18  12%  3cl6A  [x.x.x] PUUE ALLANTOINASE
    4e-18  11%  3efeA  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    4e-18  13%  2d13B  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    5e-17  16%  2e89D  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    7e-17  15%  3bl5E  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    8e-17  14%  1cf9A  [e.5.1 - c.23.16] PROTEIN (CATALASE HPII)
    1e-16  11%  3cy6A  [x.x.x] PROTEIN DJ-1
    2e-16  13%  3efeC  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    2e-16  13%  3dpiA  [x.x.x] NAD+ SYNTHETASE
    2e-16   9%  3cz9A  [x.x.x] PROTEIN DJ-1
    3e-16  12%  3bl5A  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    9e-16  20%  2detA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    1e-15  11%  3b36A  [x.x.x] PROTEIN DJ-1
    1e-15  11%  3b38A  [x.x.x] PROTEIN DJ-1
    1e-15  11%  3czaA  [x.x.x] PROTEIN DJ-1
    2e-15   8%  3dfyA  [x.x.x] MUCONATE CYCLOISOMERASE
    3e-15  12%  1bsuA  [c.52.1] ENDONUCLEASE ECORV (3.1.21.4)
    6e-15  13%  2dyiA  [x.x.x] PROBABLE 16S RRNA-PROCESSING PROTEIN RIMM
    2e-14  13%  3efeF  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    4e-14   5%  1bgbB  [c.52.1] ECORV ENDONUCLEASE
    5e-14  13%  3bweD  [x.x.x] PROTEIN DJ-1
    8e-14   5%  1aa7B  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    1e-13  12%  1az0A  [c.52.1] PROTEIN (TYPE II RESTRICTION ENZYME ECORV)
    3e-13  17%  2d13C  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    4e-13   5%  1aa7A  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    8e-13  11%  1c4fA  [d.22.1] GREEN FLUORESCENT PROTEIN
    1e-12  11%  3b3aA  [x.x.x] PROTEIN DJ-1
    1e-12  12%  3bweE  [x.x.x] PROTEIN DJ-1
    2e-12  16%  2e21B  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    3e-12   9%  1bsuB  [c.52.1] ENDONUCLEASE ECORV (3.1.21.4)
    3e-12  18%  2e21A  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    4e-12  15%  2d13A  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    2e-11  10%  2an1D  [x.x.x] PUTATIVE KINASE
    7e-11   9%  3efbC  [x.x.x] PROBABLE SOR-OPERON REGULATOR
    5e-10  11%  1ee1B  [c.26.2] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    4e-09  15%  3dpiB  [x.x.x] NAD+ SYNTHETASE
    7e-09   9%  2an1B  [x.x.x] PUTATIVE KINASE
    1e-05  19%  2ab0A  [x.x.x] YAJL
    5e-05  24%  2d13D  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    5e-04  11%  2dufA  [x.x.x] GREEN FLUORESCENT PROTEIN
:503

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2a9vB           -IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSEL--DGLDGLVLSGGNIDEELDKLGSVGKYIDDH
2a9vD           -IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSEL--DGLDGLVLSGGNIDEELDKLGSVGKYIDDH
2a9vC           -IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSEL--DGLDGLVLSGGNIDEELDKLGSVGKYIDDH
2a9vA           -IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSEL--DGLDGLVLSGGNIDEELDKLGSVGKYIDDH
3dlaD           ----------------------------------------------------------------------
3dlaB           ----------------------------------------------------------------------
2dplA           ----------------------------------------------------------------------
3a4iA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
2c5sA           ----------------------------------------------------------------------
2d7jA           MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEF
3dlaC           ----------------------------------------------------------------------
3dlaA           ----------------------------------------------------------------------
1c30B           PFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPACDYAITAIQKFLET
2deuA           ----------------------------------------------------------------------
1bxrB           PFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPACDYAITAIQKFLET
1a9xB           PFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLE
2derA           ----------------------------------------------------------------------
1cs0B           PFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLE
3b9xA           ----------------------------------------------------------------------
3d54D           -ACVVVYGSNCDRDAYHALEINGFEPSYVGLDDKLDD-----YELIILPGGFSYGDYLRPGAVAARAAER
2abwA           -IGVLSLQGDFEPHINHFIKLQIPSLIQVRNVHDLGL-----CDGLVIPGGESTTVRRCCAYENDFIHVL
2e18A           ----------------------------------------------------------------------
2abwB           -IGVLSLQGDFEPHINHFIKLQIPSLNIIQVRNVHDL---GLCDGLVIPGGESTTVRRCCAYENDTIHVL
3efeD           YFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERQALKI
3efeB           YFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERQALKI
2an1C           -IGIVGHTTHEMLYRWLCDQGYE--VIVEQQIAHELQVPTGLAEIGQQADLAVVVGDGNMLGAARTLARY
1b97A           ----------------------------------------------------------------------
3b9xC           ----------------------------------------------------------------------
3bgyB           -NNYLDISLIFPDKNVYRVSLFNQE--QIGEFITKFSKASNDISRYIVSLDPS----------DDIEIVY
3b9xD           ----------------------------------------------------------------------
3dkyE           LKLETLGVPMAISPLHDKDHYHVLAKNPVTADSVRKKIKLLLGVQVVLNVENMYLYLTHESKDAIAKKKH
2derB           ----------------------------------------------------------------------
3cl6A           -----------------------------------EHMLEAIRILTELTGERPLGWYTGRTGPNTRRLVM
3efeA           YFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERQALKI
2d13B           ----------------------------------------------------------------------
2e89D           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
1cf9A           ----------------------------LPIAATFAGAPSLTVDAVIVPCGNIADIADNGDANYYEAYKH
3cy6A           ------------------------DVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
3efeC           ---------------------------RIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERQALKI
3dpiA           ----------------------------------------------------------------------
3cz9A           -MRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAESAAVKEILKEQENR
3bl5A           ----------------------------------------------------------------------
2detA           ----------------------------------------------------------------------
3b36A           ---------------------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
3b38A           ---------------------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
3czaA           ---------------------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
3dfyA           ----------------------------------------------------------------------
1bsuA           ----------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
3efeF           ---------------------------RIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERQALKI
1bgbB           ----------------------------------------------------------------------
3bweD           ---------------------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
1aa7B           -DVFAGKNTDLEVLMEWLKTRPILGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRIT
1az0A           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
1aa7A           -DVFAGKNTDLEVLMEWLKTRPILGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRIT
1c4fA           ----------------------------------------------------------------------
3b3aA           ------------------------DVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
3bweE           ---------------------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
2e21B           ----------------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
2e21A           ----------------------------------------------------------------------
2d13A           ----------------------------------------------------------------------
2an1D           ---------------------------VEKVPTGTLAEIGQQADLAVVVGGD-----GNMLGAARTLARY
3efbC           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2an1B           -----------------------------------LAEIGQQADLAVVVGGDGNML-----GAARTLARY
2ab0A           ----------------------------LLADAPLVEVADGEYDVIVLPGGIK---GAECFRDSTLLHRS
2d13D           ----------------------------------------------------------------------
2dufA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
2a9vB           NYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
2a9vD           NYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
2a9vC           NYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
2a9vA           NYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
3dlaD           ------------------GEGESTTDLAWDGQTMIWENGALLAESERFPKGVRRSVADVDTELLRSERLR
3dlaB           -------------------GEGESTTDLAWDGQTMIENGALLAESERFPKGVRRSVADVDTELLRSERLR
2dplA           ----------------------------------------------------------------------
3a4iA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
2c5sA           --EYILVRYGESKFVSTLKDNVKFKLKATHDRMYIQLNEDHEAVSERLKDVFGIHKFNLAMKVPSELEDI
2d7jA           NVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIDEDEIFKGLPKRLKVWESHMDEVKELPPKFKIL
3dlaC           -------------------GEGESTTDLAWDGQTMIENGALLAESERFPKGVRRSVADVDTELLRSERLR
3dlaA           -------------------GEGESTTDLAWDGQTMIWENGALAESERFPKGVRRSVADVDTELLRSERLR
1c30B           DIPVFGISLGHQLLALASGAKTVKMKFGHHGGN---HPVKDVEKNVVMITAQNHGFAVDEATLPANLRVT
2deuA           ----------------------------------------------------------------------
1bxrB           DIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDV---EKNVVMITAQNHGFAVDEATLPANLRVT
1a9xB           TDIPVFGILGHQLLALASGAKTVKMKFGHHGGNHPVKD-----VEKNVVMITAQNHGFAVDEAPANLRVT
2derA           ----------------------------------------------------------------------
1cs0B           TDIPVFGILGHQLLALASGAKTVKMKFGHHGGNHPVKD-----VEKNVVMITAQNHGFAVDEAPANLRVT
3b9xA           ----------------------------------------------------------------------
3d54D           GKLIMGINGFQILIEMGLLKGALLQNSSGKFICKWVDLDTPFTNAFGEKIRIPIAHGFGRYVKIDDVNVV
2abwA           KKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDIIISDSSAFKKDLTACIRAPYIREILSDEVKVL
2e18A           ----------------------------------------------------------------------
2abwB           KKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITIDSSAFKKDLTAACIRAPYIREILSDEVKVL
3efeD           GTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKFYELGPAVSDANLVTASGIAPLEFAMEVL
3efeB           GTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKFYELGPAVSDANLVTASGIAPLEFAMEVL
2an1C           DINVIGINRGNLGFLTDLDPDNALQQSEKRFLLEAQVCQQRISTAINEVVLHPGKHMIEFEVYIDETFAF
1b97A           ----------------------------------------------------------------------
3b9xC           ----------------------------------------------------------------------
3bgyB           KNRGSGKLIGIDNWAITIKSTEEIPLVAG--------SKISKPKITGSERIMYRYKTRYSFTINKNSRID
3b9xD           ----------------------------------------------------------------------
3dkyE           VYDKADIKLINNDIDRYVTLDVEEKTELFNVVVSLIRAYTQNIFDL---YDFIDENGETYGLTINLVNEV
2derB           ----------------------------------------------------------------------
3cl6A           EE-----GGFLYDCDTYDDDLPYWEPNNPTGKPHLVIPYTDTNDMRFTQVQGFNKGDDFFEYLKDAFDVL
3efeA           GTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKEKFYELAVSDANLVTASGIAPLEFAMEVL
2d13B           ----------------------------------------------------------------------
2e89D           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
1cf9A           LKPIALAGDARKFKATIKIADQGEEGIVEADSADGSFMD-ELLTLMAA--HRVWSRIPKIDKIP------
3cy6A           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI
3efeC           GTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVNLVTASGIAPLEFAMEVL
3dpiA           ----------------------------------------------------------------------
3cz9A           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI
3bl5A           ----------------------------------------------------------------------
2detA           ----------------------------------------------------------------------
3b36A           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI
3b38A           KGLIAVICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI
3czaA           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI
3dfyA           --------YGEASPSFRVNGERVEALLAIENAVMITGIDVRNYARIFEITDRLFGFPSLKAAVQFTLDAL
1bsuA           ----------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
3efeF           GTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKEKFYELGPAVSDANLVTASAPLEFAMEVL
1bgbB           ----------------------------------------------------------------------
3bweD           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNGGH-------YTYSENRVEKDGLILTSRGPGT---
1aa7B           FHGAKEISLSYSAGALASCMGLIYNTEVAFGLVCATCE--------------------------------
1az0A           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
1aa7A           FHGAKEISLSYSAGALASCMGLIYNRMGAFGLVCATCE--------------------------------
1c4fA           ---------GEELFTGVVPILVELDGDVNGHK-----FSVSEGEGDATYGKLTLKFICTTGKLPVPWPTL
3b3aA           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENEVEKDGLILTSRGPGTSFKFALAI
3bweE           KGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNGGHYTENRVEKDGLILTSRGPGTSFEFA-------
2e21B           ----------------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
2e21A           ----------------------------------------------------------------------
2d13A           ----------------------------------------------------------------------
2an1D           DINVIGINRGNLGFLTDLDPDNQQLSDVLEGRYISEKREAQVCQQDRQKRISTAINEVVPGKVAHMIEFE
3efbC           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2an1B           DINVIGINRGNLGFLTDLDPDNALQLEGRYISEKRFLLEAQVCQQDRQKRISTAINEVVLHPGKVAHMIE
2ab0A           GRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKR-----VVWDARVKLLTSQGPGTLKI
2d13D           ----------------------------------------------------------------------
2dufA           ---------GEELFTGVVPILVELDGDVNGHKFSVSGEG----EGDATYGKLTLKFICTTGKLPVPWPTL


                         +         .         .         .         .         *         .:210
query           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTPEHXXXXXXXXXXXXAGKD
2a9vB           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKEN----------------
2a9vD           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKEN----------------
2a9vC           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKEN----------------
2a9vA           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKE-----------------
3dlaD           MGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPADPQRLQQDCYEAYNIQVSGLEQRLRAP
3dlaB           MGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPADPQRLQQDCYNIQVSGLEQRLRALDYP
2dplA           -------------------------------------------------------------------GDS
3a4iA           -------------------------------------------------------------------GDS
2dplB           -------------------------------------------------------------------GDS
2c5sA           KKGALAAFLQVK-GDVKTFKITVHRSYKHFPMRTMELLPEIGGHILENTEDITVDVHNPDVNVRVEIRSG
2d7jA           ARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCG-------------------------
3dlaC           MGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPADPQRLQQDCYNIQVSGLEQRLRALDYP
3dlaA           MGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPQRLQQDCYEAYNIQVSGLEQRLRALDYP
1c30B           HKSLFDTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIELIEQYR----------------------
2deuA           ----------------------------------------------------------------------
1bxrB           HKLFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIELIEQYR----------------------
1a9xB           HKSLFGTLQGIHRTDKPAFSFQGNPEASPGPDAAPLFDHFIELIEQYR----------------------
2derA           ----------------------------------------------------------------------
1cs0B           HKSLFGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIELIEQYR----------------------
3b9xA           --------------------------------------------------------------------KR
3d54D           LRYVKDVIAGVLNESGNVFGLMPHPELIGGEDGKKVFQSILNYL--------------------------
2abwA           ATFSHESNIIAAVEQNNCLGTVFHPELLP---HTAFQQYFYEKVNYKYSL--------------------
2e18A           ------------------------------------------------------------------KGNN
2abwB           ATFSHESNIIAAVEQNNCLGTVFHPELLP---HTAFQQYFYEKVNYKYSLEHHH----------------
3efeD           KKIDVFTLDALHSWYNKTHKPEYFFQLMNSI---------------------------------------
3efeB           KKIDVFTLDALHSLNKTHKPEYFFQLMNSINK--------------------------------------
2an1C           SQRSDGLIISSTAYSLSAGGPILTPSLDAITFPHTLSARPLVINSSST----------------------
1b97A           -------------------------------------------------------------------NQK
3b9xC           --------------------------------------------------------------------KR
3bgyB           IT--DVKSSPIIWKLMTVPSYELELELINKIDINTLESELLNVFMIIQD---------------------
3b9xD           --------------------------------------------------------------------KR
3dkyE           IAGKTG----------------------------------------------------------------
2derB           --------------------------------------------------------------------AK
3cl6A           YAEGAEAP--------KMLSIGLHCRLIGRPARLAALQRFIYAKSHEQVWFT------------------
3efeA           KKIDVFTLDALHSWYNKTHKPEYFFQLMNSI---------------------------------------
2d13B           -------------------------------------------------------------------GLA
2e89D           -------------------------------------------------------------------GER
3bl5E           --------------------------------------------------------------------KE
1cf9A           ----------------------------------------------------------------------
3cy6A           VEALNGKEVAAQ----------------------------------------------------------
3efeC           KKIDVFTLDAHSWYNLNKTHKPEYFFQLMN----------------------------------------
3dpiA           ----------------------------MSRPDQAARRRAIAELHVSPTFDARDEAERRIGFVADYLGLR
3cz9A           VEALNGKEVAAQVKAPLVL---------------------------------------------------
3bl5A           --------------------------------------------------------------------KE
2detA           --------------------------------------------------------------------AK
3b36A           VEALNGKEVAAQ----------------------------------------------------------
3b38A           VEALNGKEVAAQ----------------------------------------------------------
3czaA           VEALNGKEVAAQ----------------------------------------------------------
3dfyA           SQELGTQVCYLLGGKRDEIETDKTVGIDTVENRVKEAKKIFERVIKIKVGENLKEDIEAVEEIAKVTRGA
1bsuA           -------------------------------------------------------------------YDE
2dyiA           ----------------------------------------------------------------------
3efeF           KKIDVFTLDAHSWYNLNKTHKPEYFF--------------------------------------------
1bgbB           ----------------------------------------------------------------------
3bweD           ------SFEFALAIVEALNGKEVAAQVKAPL---------------------------------------
1aa7B           ----------------------------------------------------------------------
1az0A           -------------------------------------------------------------------YDE
2d13C           -------------------------------------------------------------------GLA
1aa7A           ----------------------------------------------------------------------
1c4fA           VTTFVQMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVN------------------------------
3b3aA           VEALNGKEVAAQV--KAPLVLK------------------------------------------------
3bweE           -----------LAIVEALNGKEVAAQVKA-----------------------------------------
2e21B           -------------------------------------------------------------------GER
1bsuB           ----------------------------------------------------------------------
2e21A           -------------------------------------------------------------------GER
2d13A           -------------------------------------------------------------------GLA
2an1D           VYIDETFAFSQRSDGLSAGGPILTPSLDAITFPHTLSARPLVINS-------------------------
3efbC           ----------------------------------QLKQKFVVVVSGNDEDEETQLAGLHGAQLLDRLLEP
1ee1B           ------------------------------------MQEKIRELHVKPSIDPKQEIEDRVNFLKQYVGAK
3dpiB           ----------------------------------AARRRAIAELHVSPTFDARDEAERRIGFVADYLGLR
2an1B           FEVYIDEISTPTGSTAYSDAITLVPMFPHTLSARPLV---------------------------------
2ab0A           IDLLVGREKAHEVASQLVMAAGIY----------------------------------------------
2d13D           ----------------------------------------------------------------------
2dufA           VTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKF--------------------


                         .         .         .         +         .         .         .:280
query           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2a9vB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3dlaD           KVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGFNNAIKLARALGVTFSEIDIGDTARLMLHT
3dlaB           KVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGKNNAIKLARALGVTFSEIDIGRLMLHTIGH
2dplA           KAIIALSGGVDSSTAAVLAHKAIGDLHAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
3a4iA           KAIIALSGGVDSSTAAVLAHKAIGDRLAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
2dplB           KAIIALSGGVDSSTAAVLAHKAGDRLHAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
2c5sA           YVMVLLSGGIDSPVAAYLTMKRGVSVEAVHFHSPFTSERAKQKVIDLAQELTKYCKRVTLHLVPFTEVQK
2d7jA           ----------------------------------------------------------------------
3dlaC           KVVIGVSGGLDSTHALIVATHAMDREGPRSDILAFALPGFKNNAIKLARALGVTFSEIDIGDTARLMLHT
3dlaA           KVVIGVSGGLDSTHALIVATHAMDREGRPRSDIFALPGHTKNNAIKLARALGVTFSEIDIGDTARLMLHT
1c30B           ----------------------------------------------------------------------
2deuA           KVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADGIELHTVNFAAEYWD---N
1bxrB           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
2derA           KVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNYCTAAADLADAQAVCDKLGIELHTVNFAAEY---WDN
1cs0B           ----------------------------------------------------------------------
3b9xA           KIILDCDPGHDDAIAIMMAAKHAIDLLGITIVANQTLDKTLINGLNVCQKLEINVPVYAGMPQGDTGLDG
3d54D           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2e18A           GVVIGISGGVDSATVAYLATKAKEKVLGLIMPYFENKDVEDAKLVAEKL--GIGYKVINIKPSFVENLEL
2abwB           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
1b97A           YDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKH----------GYIVEEPKQLNHYPDFTL
3b9xC           KIILDCDPGHDDAIAIMMAAKHAIDLLGITIVANQTLDKTLINGLNVCQKLEINVPVYAGMPQPITGLDG
3bgyB           ----------------------------------------------------------------------
3b9xD           KIILDCDPGHDDAIAIMMAAKHAIDLLGITIVANQTLDKTLINGLNVCQKLEINVPVYAGMPQPIMRLDG
3dkyE           ----------------------------------------------------------------------
2derB           KVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNYCTAAADLADAQAVCDKLGIELHTVNFAAEY---WDN
3cl6A           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
2d13B           DVAVLYSGGKDSNYALYWALKSGLRVRYLVSMV----SENVELTSLQARALGIPIIKGFTEVEDLK--NV
2e89D           RVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKENR
3bl5E           KAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNHLLDM--SLLNQLAP
1cf9A           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3dpiA           ACVLGISGGIDSSTAGRLAQLAVERLRASGYDARLPYGAEADARRALAFVRADETLTVDVKPAADAMLAA
3cz9A           ----------------------------------------------------------------------
3bl5A           KAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNHLLDMSLLN--QLAP
2detA           KVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNYCTAAADLADAQAVCDKLGIELHTVNFAAEY---WDN
3b36A           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3dfyA           KYIVDANMGYTQKEAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAADEFDVMRLVKEEA
1bsuA           NQKYDVCGIISAEGKIYPLGSDKVLSTIFELFSRPIINKIAEKHG------YIVEEPKQQNHYPDFTLYK
2dyiA           --------------------------------------------------------LYRVGEELVVHLAG
3efeF           ----------------------------------------------------------------------
1bgbB           ----SLRSDLINALDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYEPKQQNHYPDFTL
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
1az0A           NQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFS------------------------RPIINKIAEKHG
2d13C           DVAVLYSGGKDSNYALYWALKSGLRVRYLVSMV------SEELTSLQARALGIPIIKGFTKKEVEDLKNV
1aa7A           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2e21B           RVLIAFSGGVDSVVLTDVLLKLKNYFSLKEHMLRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKENR
1bsuB           ------------SLRSDLINALYDEDVGIISAEGKIYPLGSDTKVLSTIF-ELFSRPIINKIAEKHGYIV
2e21A           RVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKENR
2d13A           DVAVLYSGGKDSNYALYWALKSGLRVRYLVSMV---SENNVELTSLQARALGIPIIKGFTEKEKEVEDLK
2an1D           ----------------------------------------------------------------------
3efbC           GDIVGFSWGRAVSALVENLPQASRQLICVPIIGGPSGKLESRYHVNTLTYSA--AAKLKGESHLADFPAL
1ee1B           GFVLGISGGQDSTLAGRLAQLAREEGGDAQFIAPHGEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQ
3dpiB           ACVLGISGGIDSSTAGRLAQLAVERLRASGYDALPYGAQEADARRALAFVRADETLTVDVKPAADAMLAA
2an1B           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
2d13D           DVAVLYSGGKDSNYALYWALKSGLRVRYLVSMV-------------------------------------
2dufA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXX
2a9vB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3dlaD           IGHPYSVGEKVYDVTFENVQ--AGLRTDYLFRIANQRGGIVLGTGDLSELALGWSTYGVGD-----QMSH
3dlaB           VTFENVQAGLRTDYLF----RIANQRG---GIVLGTGDLSELA-------------LGWSTYGVGDQMSH
2dplA           VTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTIAPLNLK-----LIEPLRDLY-------------
3a4iA           VTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTIAPNLKLIEPLRDLYK------------------
2dplB           VTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTILKLIEPLRDLY----------------------
2c5sA           TINKEIPSSVMRRMMMRITERIAEERN-ALAITTGESLGQVAS----------QTLDSMHTINEVTNYPV
2d7jA           ----------------------------------------------------------------------
3dlaC           IGHPYSVGEKVYDVTF----------ENVQAGLRTDYLFRIANQRGGIVLGTDLSELALGTYGVGDQMSH
3dlaA           IGHDVTFENVQAGLRTDYLFRIANQRG---GIVLGTGDLSELAL----GWSTYGVGDQMSH---------
1c30B           ----------------------------------------------------------------------
2deuA           VFELFLAEYKAGRTFKAFLEFAAEDLG-ADYIATGHYVRRADVDGKGLDSNKDQSYF-LYTLSHEQIAQS
1bxrB           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
2derA           VFELFLAEYKAGRTPNAFLEFAAEDLG-ADYIATGHYVRRADVDGKGLDSNKDQSYFL-YTLSHEQIAQS
1cs0B           ----------------------------------------------------------------------
3b9xA           PVFEPLTRQAESTHAVKYIIDTLMADGDITLVPVGPLSNIAVAMRQPAILPKIREIVLMGGAYGTGNFTP
3d54D           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2e18A           NLDRKGLGNIMSRTRMIMLYAHANSLG---RIVLGTSNRSEFLTG-------YFTKWGDGASDYAPIINL
2abwB           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
1b97A           YKPSEPNKKIAIDIKTTYT---NKENEKIKFTLGGYTSFIRNNTKNIYPFDQYIAHWIIGYVYTRVATRK
3b9xC           PVFEPLTRQAESTHAVKYIIDTLMASGDITLVPVGPLSNIAVAMRMPAILPKIREIVLMGGAYGTGNFTP
3bgyB           ----------------------------------------------------------------------
3b9xD           PVFEPLTRQAESTHAVKYIIDTLMASDDITLVPVGRMQPAILPKAYGTGNFTPSAEFNIFADPEAARVVF
3dkyE           ----------------------------------------------------------------------
2derB           VFELFLAEYKAGRKFKAFLEFAAEDLG-ADYIATGHYVRRADVDGKGLDSNKDQSYFL-YTLSHEQIAQS
3cl6A           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
2d13B           LEGLKVDGIVAGALQKERIENVARELGPAWEKDPYQYMLEIIK----LGFKVVFVAVSAYGLGRELNYKN
2e89D           MSLEEAGRFLRYKFLKE-----ILESEGFDCIATAHHLNDLLETSL----LFFTRGTGLDGGFLPKEEVI
3bl5E           NALTSTFVPGRNLVFLSFASILAYQIG-ARHIITGVCETDFSGY-PDCRDEFVKSCNVTVNLAMEKPFVI
1cf9A           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3dpiA           LAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNGVVI--GTDH----AAESVMGFFTKFGDGGAD
3cz9A           ----------------------------------------------------------------------
3bl5A           NALTSTFVPGRNLVFLSFA------SILAYQIGARHIITGVCEGYPDCRDEFVKSCNVTVNLAMEKPFVI
2detA           VFELFLAEYKAGRTPNPAFLEFAAEDLGADYIATGHYVRRADVDGKGLDSNKDQSYF-LYTLSHEQIAQS
3b36A           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3dfyA           VDYVNIKLMKSGISDALAIVEIAESSG----------LKLMIGCMGESSLGINQSVHFALGTGAFEFHDL
1bsuA           PSEPNKKIAIDIKTTYTNK---------ENEKIKFTL--------GGYTSFIRNNTKNIVYPFDQYIAHW
2dyiA           VTDRTLAEALVGLRVY-AEVADLPPLEEGRYYYFALIGLPVYVE--GRQVGEVVDILDAGAQDVLIIRGV
3efeF           ----------------------------------------------------------------------
1bgbB           YKPSEPNKKIAIDIK---------------TTYTNKIKFTLGGY---TSFIRNNTKNPFDQYIAHWIIGY
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
1az0A           YIVEEPKQQNHYPDFTLYKPSEPNKKI--AIDIKTTYTNKENEKIGGYTSFIRNNTKNIVYPFDQYIAHW
2d13C           LEGLKVDGIVAGRYQKERIENVARELG-LKVYTPAWEKDPYQY---------------------------
1aa7A           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2e21B           MSLEEAGRFLRYKFLKEIL-----ESEGFDCIATAHHLNDLLETSL----LFFTRGTGLDGGFLPKEEVI
1bsuB           EEPKQQNHYPDFTLYKPSEP-----NKKIAIDIKTTYTNIKFTLGG--YTSFIRNNTKNIVYIAHWIIGY
2e21A           MSLEEAGRFLRYKFLKE-----ILESEGFDCIATAHHLNDLLETSLGTGLDGLIGFLPKE-------EVI
2d13A           NVLEGLKVDLASRYQKERIENVARELGKVYTPAWEKDPYQYMLEIIKLGFKVVFVAVSAYG---------
2an1D           ----------------------------------------------------------------------
3efbC           LDNPLIRNGIQSQHFKTISAY--WDNLDIALVGIGSPARQVAGDICSRFGAVETNSEKTLS---------
1ee1B           ETGDQLTDFNKGNVKARTRMIAQAIGGQEGLLVLGTDHAAEAVT--------------------------
3dpiB           LAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNGVVI--GTDHAAESVMGADV------------
2an1B           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------
2dufA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2a9vB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3dlaD           YNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEEAKVGPFALQD-FSLFQVLRYGFRPSKIAF
3dlaB           YNVNAGVPKTLIQHLIRWVISAGEFGEKVGELQSVLDTEITSEAKVGPFALQDFSLQVLRYGFRPSKIAF
2dplA           --------KDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGLRP
3a4iA           ---------DEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGLRP
2dplB           --------KDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGLRP
2c5sA           IRPLITMDKLEIIK-IAEEIGTYDISIRPYKPKREKANRFEAKYDFTPLEAVANKETMV-----------
2d7jA           ----------------------------------------------------------------------
3dlaC           YNVNAGVPKTLIQHLIRWVISAGE---FGEKVGEVLQSVLDTEAKVGPFALQDFSFQVLRYGFRPSKIAF
3dlaA           YNVNAGVPKTLIQHLIRWVISAGEFGEKVGE----VLQSVLDTEITAKVGPFALQDFSLFQVLRYGFRPS
1c30B           ----------------------------------------------------------------------
2deuA           LFPVGELEKPQVRKIAEDLGLVTAKKKRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEG
1bxrB           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
2derA           LFPVGELEKPQVRKEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGL----------------MYH
1cs0B           ----------------------------------------------------------------------
3b9xA           SAEFNIFADPEAAR--------VVFTSGVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDLKTQF
3d54D           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2e18A           Y-------KTEVWEIAKRIGVPERIVKKKPSAGLGISYNLLDEILWRMIDLKIGKEEIAKDLGIPLSLVE
2abwB           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
1b97A           SSLKTYNINELNEIPKPYKGVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWR
3b9xC           SAEFNIFADPEAAR--------VVFTSGVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSGYLINP
3bgyB           ----------------------------------------------------------------------
3b9xD           TSGVPLVMMG--LDLTNQTVCTPDVIARMERAGGPAG-ELFSDIMNFTLKTQFENYGLAGGPVHGYLINP
3dkyE           ----------------------------------------------------------------------
2derB           LFPVGELEKPQVRKCFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMY-----------------
3cl6A           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
2d13B           LEELKKLSEKYGIHIAGEGGEFETFVLDMPFFKAKIVIDDAEKFWDGLSGKFIIKR--------------
2e89D           RRPLYYVKRSEIEE-YAKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFLKMVREF-LEE
3bl5E           HTPLMWLNKAETWKLADELGALDFVKNNTLIIADGCGECPACHLRSKGYEEYMV----------------
1cf9A           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3dpiA           VLPLAGLTKRRVRALARMLGADEPLVLKTPTADLETLRPQRPHITYEQIDDFLEGKPMDDAVATVLRFYD
3cz9A           ----------------------------------------------------------------------
3bl5A           HTPLMWLNKAETWKLADELGALDFVKNNNGIIADGCGECPACHLRSKGYEEYMV----------------
2detA           LFPVGELEKPQVRKCFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGL-------------------
3b36A           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3dfyA           DSHLMLVFRGKFI---------------------------------------------------------
1bsuA           IIGYVYTRTYNINELNEIPKPYKGVKVKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFDSFLDYWRNYE
2dyiA           GERLRDRAERLVPLQAPYVRVEEGSIHVDPIPG-------------------------------------
3efeF           ----------------------------------------------------------------------
1bgbB           VYTRVSLKTYNINIPKPYKGVKVFLQDKWVIAGAGSG-------NTTNIGSIHAHYKDF---VEGKGIFD
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
1az0A           IIGYVYTRTYNINIPKPYKGVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFDSFLDYWRNYE
2d13C           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2e21B           RRPLYYVKRSEIEE-YAKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFLKMVK------
1bsuB           VYTRVSLKTYNINIPKPYKGVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFDSELDYWRNYE
2e21A           RRPLYYVKRSEIEE-YAKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFLKMVREF-LEE
2d13A           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
3efbC           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
3dpiB           -LPLAGLTKRRVRA---LARMLGADEPAYGITYEQIDDFLEGPMDDAVAETVLRF---------------
2an1B           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------
2dufA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
2a9vB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3dlaD           LAWHAWNDAERGNWPPGFPKSERPSYS---------LAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSH
3dlaB           LAWHAWNDAERGNWPPGFPKSERPSYSLAEHWLQIFVQRFYSFSQFKRSALPNGP-KVSHGGALSPRGDW
2dplA           WQAFAVLLG--VKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
3a4iA           WQAFAVLLG--VKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
2dplB           W--QAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
2c5sA           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
3dlaC           LAWHAWNDAERGNWPPGFPKSERPSYSLAERHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGALSPRGDW
3dlaA           KIAF-----LAWHAWNDAERGNWPPGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSH
1c30B           ----------------------------------------------------------------------
2deuA           TEEPWYVVDKVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTTMRCTVKTRYRQTDIPCTVKALDD
1bxrB           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
2derA           TLGQR-----KGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDRETVKTR
1cs0B           ----------------------------------------------------------------------
3b9xA           ENYGLAGPVHDATCIGYLINPDGIKTQEMYVEVDVNSGPCYGTVCDELGVLGKPANKVGITI--------
3d54D           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2e18A           RVEELIKKSEHKRRIGPSFEDLIVG---------------------------------------------
2abwB           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
1b97A           NYTSQLRNDKY---NNISEYRNWIYR--------------------------------------------
3b9xC           DGIKTQEMYVEVDVNSGPCYGRVLGKPANTKVGITIDT--DWFWGLVEECV-------------------
3bgyB           ----------------------------------------------------------------------
3b9xD           DGIKTQEMYVEVDVNSGPCYGRVLGKPANTKVGITID--TDWFWGLVEECVRGYIK--------------
3dkyE           ----------------------------------------------------------------------
2derB           ----------------------------------------------------------------------
3cl6A           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
2e89D           EAQKLYKEVKKGNCLDVKKL---KEKPLALQRRVIRKFIGEKDYEKVELVRSLLEKGGEVNLGKGKVLKR
3bl5E           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3dpiA           A---------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
2detA           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3dfyA           ----------------------------------------------------------------------
1bsuA           R---------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
1bgbB           SEDEFLDYW-------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
1az0A           R---------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2e21B           ----------------------------------------------------------------------
1bsuB           RTSQLRNDKYNNISEY------------------------------------------------------
2e21A           EAQKLYKEVKKGNCLDVKKLKEKP----------------------------------------------
2d13A           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
3efbC           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------
2dufA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DLTSKPPATIEWE
2a9vB           -------------
2a9vD           -------------
2a9vC           -------------
2a9vA           -------------
3dlaD           GGALSPRGD----
3dlaB           RAPSDMSARIWLD
2dplA           DITNKPPATIEFE
3a4iA           DITNKPPATIEFE
2dplB           DITNKPPATIEFE
2c5sA           -------------
2d7jA           -------------
3dlaC           RAPSDMSARIW--
3dlaA           GGALSP-------
1c30B           -------------
2deuA           D------------
1bxrB           -------------
1a9xB           -------------
2derA           YRQTDIPCTVKA-
1cs0B           -------------
3b9xA           -------------
3d54D           -------------
2abwA           -------------
2e18A           -------------
2abwB           -------------
3efeD           -------------
3efeB           -------------
2an1C           -------------
1b97A           -------------
3b9xC           -------------
3bgyB           -------------
3b9xD           -------------
3dkyE           -------------
2derB           -------------
3cl6A           -------------
3efeA           -------------
2d13B           -------------
2e89D           -------------
3bl5E           -------------
1cf9A           -------------
3cy6A           -------------
3efeC           -------------
3dpiA           -------------
3cz9A           -------------
3bl5A           -------------
2detA           -------------
3b36A           -------------
3b38A           -------------
3czaA           -------------
3dfyA           -------------
1bsuA           -------------
2dyiA           -------------
3efeF           -------------
1bgbB           -------------
3bweD           -------------
1aa7B           -------------
1az0A           -------------
2d13C           -------------
1aa7A           -------------
1c4fA           -------------
3b3aA           -------------
3bweE           -------------
2e21B           -------------
1bsuB           -------------
2e21A           -------------
2d13A           -------------
2an1D           -------------
3efbC           -------------
1ee1B           -------------
3dpiB           -------------
2an1B           -------------
2ab0A           -------------
2d13D           -------------
2dufA           -------------