[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81541.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eh6A.bssp"
#ERROR : Can't open dsspfile "1eh7A.bssp"
#ERROR : Can't open dsspfile "1bbt2.bssp"
#ERROR : Can't open dsspfile "1eh8A.bssp"

## Summary of PDB Search
:147
    2e-24  29%  1eh6A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    9e-23  28%  1eh7A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    1e-13  15%  1bbt2  [b.121.4] FOOT-AND-MOUTH DISEASE VIRUS (SUBUNIT VP2)
    7e-13  28%  1eh8A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
:147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xWVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLPLDYTGLSPAR
1eh6A           -TLDSPLGKLELSGCEQGLHEIGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIELHHPVFQQE-SFTR
1eh7A           -TLDSPLGKLELSGCEQGLHEIKLLGVPAPAAGGPEPLMQCTAWLNAYFHQPEAIELHHPVFQQE-SFTR
1bbt2           ------------------------------------------GSLTDSYAYMRNGW-DVEVTAVGNQFNG
1eh8A           -TLDSPLGKLELSGCEQGLHEIGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIELHHPVFQQE-SFTR


                         .         .         *         .         .         .         .:140
query           LRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWL
1eh6A           QVLWKLLKVVKFGEVISYQQLAALAGNAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
1eh7A           QVLWKLLKVVKFGEVISYQQLAALAGNAARAVGGAMRGNPV-PILIPHRVVCSSGAVGNYSGGLAVKEWL
1bbt2           GCLL--VAMVPELCSIQKRELYQLTL-FPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVV-
1eh8A           QVLWKLLKVVKFGEVISYQQLAALAGNPARAVGGAMRGNPV-PILIPHRVVCSSGAVGNYSGGLAVKEWL


                         +         .         .         .         .         *         .:210
query           LRFEGAx
1eh6A           LAHEGH-
1eh7A           LAHEGH-
1bbt2           -------
1eh8A           LAHEGH-