[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81542.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c0uB.bssp"

## Summary of PDB Search
:349
    8e-05  15%  3c0uB  [x.x.x] UNCHARACTERIZED PROTEIN YAEQ
:349

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c0uB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c0uB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c0uB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDPPQVLEKSPSGRAWRVRLLGVEVRGPE
3c0uB           -----------------------------------------DDEPEAWLRNDHLGID----LWIELGLPD


                         .         *         .         .         .         .         +:350
query           AQRLLRLMGLPSAMAEFQGWLALGRGAGHGVGLSQWGAKGMAERGYGYREILGYYFPxxxxxxxxxxxx
3c0uB           ERRIKKACTQAAEVA----LFTYNSRAAQ-----IW-WQQNQSKCVQFANLSVWYLD------------