[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81546.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "2admA.bssp"
#ERROR : Can't open dsspfile "3bzbA.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "2d16A.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "3b3fA.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "1admA.bssp"
#ERROR : Can't open dsspfile "3c3pA.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "3cggB.bssp"
#ERROR : Can't open dsspfile "3dstA.bssp"
#ERROR : Can't open dsspfile "3e05B.bssp"
#ERROR : Can't open dsspfile "2dpmA.bssp"
#ERROR : Can't open dsspfile "1aqjB.bssp"
#ERROR : Can't open dsspfile "3cjrA.bssp"
#ERROR : Can't open dsspfile "2b3tA.bssp"
#ERROR : Can't open dsspfile "3ck7A.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "2axuE.bssp"
#ERROR : Can't open dsspfile "3ckbB.bssp"
#ERROR : Can't open dsspfile "2dl1A.bssp"
#ERROR : Can't open dsspfile "1aqiA.bssp"
#ERROR : Can't open dsspfile "2cwwB.bssp"
#ERROR : Can't open dsspfile "3dxzA.bssp"
#ERROR : Can't open dsspfile "3ck7D.bssp"
#ERROR : Can't open dsspfile "1aqjA.bssp"
#ERROR : Can't open dsspfile "3cjqD.bssp"
#ERROR : Can't open dsspfile "3b89A.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "2ekmA.bssp"
#ERROR : Can't open dsspfile "3cjtC.bssp"
#ERROR : Can't open dsspfile "2axvA.bssp"
#ERROR : Can't open dsspfile "2d16B.bssp"
#ERROR : Can't open dsspfile "3cvlA.bssp"
#ERROR : Can't open dsspfile "2axuB.bssp"
#ERROR : Can't open dsspfile "3c0kA.bssp"
#ERROR : Can't open dsspfile "2dulA.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"
#ERROR : Can't open dsspfile "3c3oA.bssp"
#ERROR : Can't open dsspfile "3c6kD.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "2bedA.bssp"
#ERROR : Can't open dsspfile "3bgvC.bssp"
#ERROR : Can't open dsspfile "2bt8A.bssp"
#ERROR : Can't open dsspfile "3ceqB.bssp"
#ERROR : Can't open dsspfile "3dxyA.bssp"
#ERROR : Can't open dsspfile "3cjtA.bssp"
#ERROR : Can't open dsspfile "2axvB.bssp"
#ERROR : Can't open dsspfile "3bzbB.bssp"
#ERROR : Can't open dsspfile "2e2eA.bssp"
#ERROR : Can't open dsspfile "3cvnA.bssp"
#ERROR : Can't open dsspfile "3c6kC.bssp"
#ERROR : Can't open dsspfile "3cvqA.bssp"
#ERROR : Can't open dsspfile "1dceA.bssp"
#ERROR : Can't open dsspfile "3c6mC.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "2br5A.bssp"
#ERROR : Can't open dsspfile "3dxxA.bssp"
#ERROR : Can't open dsspfile "3ckkA.bssp"
#ERROR : Can't open dsspfile "3dsxA.bssp"
#ERROR : Can't open dsspfile "2axuA.bssp"
#ERROR : Can't open dsspfile "3e4bA.bssp"
#ERROR : Can't open dsspfile "3bwbB.bssp"
#ERROR : Can't open dsspfile "3c6mD.bssp"
#ERROR : Can't open dsspfile "3c6kA.bssp"
#ERROR : Can't open dsspfile "2axzB.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "2axuG.bssp"
#ERROR : Can't open dsspfile "2c63A.bssp"
#ERROR : Can't open dsspfile "2br5C.bssp"

## Summary of PDB Search
:916
    1e-07  12%  2cg3A  [x.x.x] SDSA1
    1e-07  15%  2cfuA  [x.x.x] SDSA1
    5e-07  17%  2admA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    7e-07  11%  3bzbA  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-06  12%  3c3pB  [x.x.x] METHYLTRANSFERASE
    2e-06  10%  2d16A  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    4e-06  17%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    4e-06  10%  3b3fA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    5e-06  18%  2cg2A  [x.x.x] SDSA1
    6e-06  16%  1admA  [x.x.x] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    7e-06  12%  3c3pA  [x.x.x] METHYLTRANSFERASE
    8e-06  15%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    1e-05  13%  3c3pC  [x.x.x] METHYLTRANSFERASE
    1e-05  16%  3cggB  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    2e-05  16%  3dstA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    2e-05  12%  3e05B  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-05  11%  2dpmA  [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
    2e-05  18%  1aqjB  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    2e-05  17%  3cjrA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    3e-05  19%  2b3tA  [x.x.x] PROTEIN METHYLTRANSFERASE HEMK
    3e-05   9%  3ck7A  [x.x.x] SUSD
    3e-05  14%  2cfzA  [x.x.x] SDSA1
    3e-05  10%  1eg2A  [c.66.1] MODIFICATION METHYLASE RSRI
    3e-05   6%  2axuE  [x.x.x] PRGX
    4e-05   8%  3ckbB  [x.x.x] SUSD
    5e-05   6%  2dl1A  [x.x.x] SPARTIN
    5e-05  16%  1aqiA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    5e-05  14%  2cwwB  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    6e-05  13%  3dxzA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    7e-05   7%  3ck7D  [x.x.x] SUSD
    7e-05  20%  1aqjA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    7e-05  17%  3cjqD  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    7e-05  13%  3b89A  [x.x.x] 16S RRNA METHYLASE
    8e-05  10%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    9e-05   6%  2ekmA  [x.x.x] HYPOTHETICAL PROTEIN ST1511
    9e-05  17%  3cjtC  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    9e-05   4%  2axvA  [x.x.x] PRGX
    1e-04   8%  2d16B  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    1e-04  15%  3cvlA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    1e-04   6%  2axuB  [x.x.x] PRGX
    1e-04  12%  3c0kA  [x.x.x] UPF0064 PROTEIN YCCW
    1e-04  18%  2dulA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    2e-04  11%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-04   8%  2aw6B  [x.x.x] PRGX
    2e-04   7%  3c3oA  [x.x.x] PROGRAMMED CELL DEATH 6-INTERACTING PROTEIN
    2e-04  17%  3c6kD  [x.x.x] SPERMINE SYNTHASE
    3e-04  15%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-04  13%  2bedA  [x.x.x] PROTEIN
    3e-04  12%  3bgvC  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    3e-04   8%  2bt8A  [x.x.x] SIGMA C
    3e-04  15%  3ceqB  [x.x.x] KINESIN LIGHT CHAIN 2
    3e-04  13%  3dxyA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    3e-04  22%  3cjtA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    4e-04   8%  2axvB  [x.x.x] PRGX
    4e-04  12%  3bzbB  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-04  10%  2e2eA  [x.x.x] FORMATE-DEPENDENT NITRITE REDUCTASE COMPLEX NRFG
    4e-04  20%  3cvnA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR
    4e-04  17%  3c6kC  [x.x.x] SPERMINE SYNTHASE
    4e-04  11%  3cvqA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    5e-04  11%  1dceA  [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB
    5e-04  12%  3c6mC  [x.x.x] SPERMINE SYNTHASE
    5e-04  14%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    6e-04  15%  2br5A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-04  13%  3dxxA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    6e-04  19%  3ckkA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    6e-04  14%  3dsxA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    7e-04   7%  2axuA  [x.x.x] PRGX
    7e-04  14%  3e4bA  [x.x.x] ALGK
    7e-04  15%  3bwbB  [x.x.x] SPERMIDINE SYNTHASE
    8e-04  12%  3c6mD  [x.x.x] SPERMINE SYNTHASE
    8e-04  13%  3c6kA  [x.x.x] SPERMINE SYNTHASE
    8e-04   4%  2axzB  [x.x.x] PRGX
    8e-04  12%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    8e-04  14%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    8e-04   7%  2axuG  [x.x.x] PRGX
    9e-04  10%  2c63A  [x.x.x] 14-3-3 PROTEIN ETA
    0.001  15%  2br5C  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
:916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPDELRLFLKERFGVQGPLSPGRFEAELAKRLGSPARRAPLLKAWRAYLAQGGREAVRSFYREVLKVPKG
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           -----------------------------------------------------GAYLDGLLPEADPVVAA
2d16A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3b3fA           -----------------------------------------------------ESSAVQYFQFYGYLSQN
2cg2A           ----------------------------------------------------------------------
1admA           ---------------------------------------------------------------LLSLPSN
3c3pA           -----------------------------------------------------GAYLDGLLPEADPVVAA
3c6mB           ------------------------------------------------------------FGNILILSGD
3c3pC           -----------------------------------------------------GAYLDGLLPEADPVVAA
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           -QHWLREAISQLQASE----SPRRDAEILLEHVTGRGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPI
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           -----------------------------------------------------GSRLFSRFDDGIKLDRE
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           -----------------------------------------------------------EEHGKLLVDIQ
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           -----------------------------------------------------------QFGNILILSGD
3c6kB           -----------------------------------------------------------QFGNILILSGD
2br5A           ----------------------FQDLNLFRGLGDPAYHPPVLTDRRDWPLDRWAEAPRDLGYSDFSPYQW
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           -----------------------------------------------------------QFGNILILSGD
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ------------------------------------KEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEW
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           ----------------------FQDLNLFRGLGEPAYHPPVLTDRRDWPLDRWAEAPRDLGYSDFSPYQW


                         .         .         *         .         .         .         .:140
query           EALVYGMHLPHLEFYAKELPPRVEGRVLEVGAFTGALVGFLQRKRPDLEWHALDGVEEAVALGKKRVPEV
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFEAHGTGYRFVGVEIDPKALDLPPWAEGIW
3bzbA           ----TSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGADQVVATDYPDPEILNSLESNIRE-
3c3pB           EQIARERNIPIVRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISISSRVVIDPDRDNVEHARRLHDNG
2d16A           -----------IGQGNFSIFTVDDLARALLTAVPGIKFGIAMNEAKPQLTRYTGNDPELEALAAKNAVKV
2c0mA           ----------------------------------------------------------------------
3b3fA           MMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGAREASTMAQHAEVLVKSNNLTDRIV
2cg2A           ----------------------------------------------------------------------
1admA           SAPVE-TPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTGYRFVGKALDLPPWAEGILADFL
3c3pA           EQIARERNIPIVRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISISSRVVIDPDRDNVEHARRLHDNG
3c6mB           VNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKYMRGD
3c3pC           EQIARERNIPIGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISISSRVVIDPDRDNVEHARRLHDNG
3cggB           ----------IYGEARLIDAAPRGAKILDAGCGQGRIGGYLSKQGHDVLGTDLDPILIDYAKQDFPEARW
3dstA           ----------------------------------------------------------------------
3e05B           ----LITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKF
2dpmA           ----RSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFN--VPYGRYKNPKIVDEELISAISV
1aqjB           ------------DFMVSLAEAPRGGRVLEPACAHGPLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGI-
3cjrA           -------------------------KVLDLGTGSGVLAIAAEKLGG--KALGVDIDPMVLPQAEANAKRN
2b3tA           AHLTGVREFWSLPLFVSPRLPEQPCRILDLGTGTGAIALALASERPDCEIIAVDRMPDAVSLAQRNAIKN
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           -----TQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVA--IQEGRNSICTDAAPVFKEYYQKQLTFY
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGGYRFVGVEIDPKALDLPPWAEGLW
2cwwB           ----KTGAYLDQRENRLYMERFRGERALDVFSYAGGFALHLALGFREVVAVDSSAEALRRAEENARLNGL
3dxzA           ----MGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEE
3ck7D           ----------------------------------------------------------------------
1aqjA           ------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFEAHGTGYRFVGVEIDPKALDLPPWA----
3cjqD           -------------------------KVLDLGTGSGVLAIAAEKLGG--KALGVDIDPMVLPQAEANAKRN
3b89A           ------RLAELDTLYDFIFSAETPRRVLDIACGLNPLALYERGIASVWGCDIHQGLGDVITPFAREKDWD
3egiB           GWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTG---RVIAIDIDPVKIALARNNADKI
2ekmA           -----------IIGQSHFIKTVEDLYETLASSSPHLKFGIFCEASGKRLIRWDGNDEELIKLAQQTAIKN
3cjtC           ---------------------RPGDKVLDLGTGSGVLAIAAEKLGG--KALGVDIDPMVLPQAEANAKRN
2axvA           ----------------------------------------------------------------------
2d16B           -----------IGQGNFSIFTVDDLARALLTAVPGIKFGIAMNEAKPQLTRYTGNDPELEALAAKNAVKI
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           HGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALGGCSQVVSVDTSALDIARQNVELNKLDL
2dulA           ------------DIVVVLLNILNPKIVLDALSATGIRGIRFALETPAEEVWLNDISEDAYELMKRNDGEL
3eeyI           ---LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDAFLASLVGENGRVFGFDIQDKAIANTTKKLTDV
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           -------------------------DVLILGGGDGGILCEIVKLKPK-MVTMVEIDQMVIDGCKKYMRKD
3eeyA           ---LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDAFLASLVGENGRVFGFDIQDKAIANTTKKLTD-
2bedA           ----------------------------------------------------------------------
3bgvC           -----RNFNNWMKSVLIGEFLEKVRQKRDITVLDGDLLKW--KKGRINKLVCTDIADVSVKQCQQRYEDM
2bt8A           ----LSFSPPLSADGVVSLDMDPYFCSQRVSLTSYSAEAQLMARGTNGSSDTIDMTVNAHCHGRRTDYMM
3ceqB           ----------------------------------------------------------------------
3dxyA           ----MGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEE
3cjtA           -------------------------KVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANKRNGVR
2axvB           ----------------------------------------------------------------------
3bzbB           -----SGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGADQVVATDYPDPEIHRASPKVVPYR
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           -------------------------DVLILGGGDGGILCEI-VKLKPKMVTMVEIDQMVIDGCKKYMRK-
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           VNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGIL-CEIVKLKPKMVTMVEIDQMVIDGCKKYMRKT
3c6kB           VNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKYMRKV
2br5A           RGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENI
3dxxA           ----MGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEE
3ckkA           ---------PEEMDWSELYPEFAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRAA
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           -------------------------RVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVEQSKQHFPQI-
3c6mD           VNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKYMRKL
3c6kA           --LAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGIL-CEIVKLKPKMVTMVEIDQMVIDGCKKYMRKV
2axzB           ----------------------------------------------------------------------
2cl5A           ---AMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMRLLQPGARLLTMEMNPDYAAITQQMLNFA
3dulA           ----HDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVTLEASEKHADIARSNIERA
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           RGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGWFRDLTKIMGIDCQVIGIDRDLSRCQIPASDMENI


                         +         .         .         .         .         *         .:210
query           AWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPEAFWKRFAFFERLPLFARLLRPGGLLVYGHG
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           EPGEAFDLILGNPPYGIVGVFKAVK---DLYKKAFSTWKGKYNLYGAFLEKAV---RLLKPGGVLVFVVP
3bzbA           ----HTAASPKVVPYRWGDSPDSLQRCTGLQRFQVVLLADLLSFHQAHDALLRSVKLLALPANDPTLVNA
3c3pB           LIDRVELQVGDPLGIA-------AGQRDIDILFDCDVFNGADVLE---------RNRCLAKNALLI----
2d16A           ILMKNAYPINVLNTIKNHPAVAMIYGASENPFQVIVAETELGRAVIGVVDGKAANDEQKKERRELVEKIG
2c0mA           ----------------------------------------------------------------------
3b3fA           VIPGKVEEVSLPEQVDIIISEPMG----------------YMLFNERMLESYLHAKKYLKPSGNMFPTIG
2cg2A           ----------------------------------------------------------------------
1admA           LWEPGEAFDLILGNPPYGIVGEAPHVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVP
3c3pA           LIDRVELQVGDPLGI-------AAGQRDIDILFDCDVFNGAD---------VLERNRCLAKNALLIA-VN
3c6mB           VLDNLKGDCYQVLIEDCILKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLDLSMKVLKQDGKYFTGNC
3c3pC           LID----------------RVELQVGDPLGIAAGQRDIDILFDCDVFNGADVLERNRCLAKNALLIAVNA
3cggB           VVGDLSVDQISETDFDLIVSAGNV-------GFLAEDGREPALAN---------IHRALGADGRAVIGFG
3dstA           ----------------------------------------------------------------------
3e05B           VARNVTLVEAFAPEGLDDLPDPD-----------RVFIGGSGGMLEEIIDAV---DRRLKSEGVIVL-NA
2dpmA           YINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYI--PLFTSYTHEGFSFADQVRLKRLSDTGAYVMLSNS
1aqjB           -LADFLLWEPGEAFDLILGNPPYGIVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVP
3cjrA           GVRPRFLEGSLEAALPF----------------GPFDLLVANLYAELHAALAPRYREALVPGGRALLTGI
2b3tA           IHILQSDWFSALAGQQFAMIVSNPPYIDEQRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHG
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           EIVEGAANFGAALQ--------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           EPGEAFDLILGNPPYGIVKAVKDLYKKAFSTWKGKYNLYGAFLEK---------AVRLLKPGGVLVFVVP
2cwwB           GNVRVLEANAFDLLRRLEKEGERFDLVVLDPPAFAKGKKDVERAYRAYKEVNLRAIKLLKEGGILATSHH
3dxzA           GLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHM---
3ck7D           ----------------------------------------------------------------------
1aqjA           EGILADFLLWEPGEAFDLILGNPPYGIVAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVF---
3cjqD           GVRPRFLEGSLEAALPFGPFDLLV----------------ANLYAELHAALAPRYREALVPGGRALLTGI
3b89A           FTFALQDVLCA------------PPAEAGDLALIFKLLPLLEREQAGSAALL---QSLNTPRAVSFPTRS
3egiB           EFICGDFLLLASFSPPWAETFDIRTSPDGFEIFRLSKKITNNIVYFLPRNAIDQVASLAGPGGQVEIEQN
2ekmA           GFPINVLNRIKNVEEVVRIFAATANPLQVLAETDQGRGVIGVVDGYTPLGI--ETEADIKERKELLRKFG
3cjtC           GVRPRFLEGSLEAALPFGPFDLLV----------------ANLYAELHAALAPRYREALVPGGRALLTGI
2axvA           ----------------------------------------------------------------------
2d16B           NVLNTIKNHPAVAMIYGASENPFQVIVAETELGRAVIGVVDGKAAN-----KIETDEQKKERRELVEKIG
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           SKAEFVRDDVFKLLRTYRDRGEKFDVIVDPPKFVENKSQLGACRGYKDINLA---IQLLNEGGILLT---
2dulA           RESKGRAILKGEKTIVINHDDANRL---------------------------------------------
3eeyI           TLIKDGHQNMDKYIDCP------VKAVMFNLGYLPSGDHSISTRPETTIQALSKAMELLVTGGIIIYYGG
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           VLDNLKGDCYQVLIEDCIPVLKRYAKELTAVPISTSPSTWEFLRLI-----LDLSMKVLKQDGKYFQGNC
3eeyA           ---LNLIDRVTLIKDGHQNMDKYIDCPMFNLGYLPSGDHSISTRPETTIQALSKAMELLVTGGIITYG--
2bedA           ----------------------------------------------------------------------
3bgvC           KNRRDYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMCERLSPGGYFI----
2bt8A           SSTGLLTFDLSDITSDLARLVPSAGFQAASFPVDVSFTRDSATHAYQAYGVYSSVFTITFPTGGDGT---
3ceqB           ----------------------------------------------------------------------
3dxyA           GLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVF-----
3cjtA           PRFLEGSLEAALPFGPFDLLVANLYAELHAALAPR-------------------YREALVPGGRALLTGI
2axvB           ----------------------------------------------------------------------
3bzbB           WGDSPDSLQRCTGLQRFQVVLLADLLSFHQRSVKLLALPATAVALVTFTHHRPHLAERDLAFFRLVNADG
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           -LDNLKGDCYQVLIEDCIPVLKRYAKELTAVPISTSPSTWEFLRLI-----LDLSMKVLKQDGKYFQGNC
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           CGDIPVLKRYAKEGREFDYVINDLT----AVPISTSPSTWEFLRLI-----LDLSMKVLKQDGKYFTGNC
3c6kB           LDNLKGDCQVLIEDCIPVLKRYAKEGREFDYVINDLTAPSTWEFLRLILDLS---MKVLKQDGKYFTGNC
2br5A           TLHQGDCSDLTTFE--------HLREMAHPLIFIDNAHANTFNIMKW------AVDHLLEEGDYFIIMIP
3dxxA           GLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVF-----
3ckkA           APAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFF-------LFPDIISPTLLAEYAYVLRVGGLVYT---
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           -SRSLADPRATVRVGDGLAFVRQTPDNTYD----VVIIDTTDPAGLFGEAFYKDVLRILKPDGICC----
3c6mD           DNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSTWEFLRLLDLSMKVLKQDGKYFTQGN
3c6kA           LDNLKGDCQVLIEDCIPVLKRYAKEGREFDYVINDLTAVSTSSTWEFLRLILDLSMKVLKQDGKYFTQGN
2axzB           ----------------------------------------------------------------------
2cl5A           GLQDKVTILNGASQDLIPQLKKKYDVDTLDMV-----FLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNV
3dulA           NLN-DRVEVRTGLALDSLQQIENEKYEPFD-------FIFIDADKQNNPAYFEWALKLSRPGTVIIGDNV
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           TLHQGDCSDLTTFE--------HLREMAHPLIFIDNAHANTFNIMKW------AVDHLLEEGDYFIIMIP


                         .         .         .         +         .         .         .:280
query           PFLGKSPEGVEEGLRRLGFDRVERVGEGEYFLVLARKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ATWL--VLEDFALLREFLAREGKTS---------------------------------------------
3bzbA           DGALIAEPWLSPLVHRWRLR--------------------------------------------------
3c3pB           -AVNALRREFNHHLSRRRDFFTTIVPVGNG-VLLGYR---------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3b3fA           DVHLAPFTDEQLYMEQFTKANFWYQPSFHGV---------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ATWLVLEDFALLREFLAREGKTSVYYLGEVF---------------------------------------
3c3pA           ALRRGALREFNHHLSRRRDFFTTIVPVGNGVLLGYR----------------------------------
3c6mB           VNLTEALSLYEEQLGRLYCP--------------------------------------------------
3c3pC           LRRGLRE--FNHHLSRRRDFFTTIVPVGNGVLLGYR----------------------------------
3cggB           AGRGWVFGDFLEVAERVGLELENAFESWDL----------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           VTLDTLTKAVEFLEDHGYMVEVACVNVAKT----------------------------------------
2dpmA           S-----SALVEELYKDFNIHYVEG----------------------------------------------
1aqjB           ATWLVLE---------------------------------------------------------------
3cjrA           LKDRA--PLVREAMAGAGFRPLEEAAEGEWVLLAYGR---------------------------------
2b3tA           WQ---QGEAVRQAFILAGYHDVE-----------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ATWLVLEDFALLREFLAREGKTSVYYLGEVF---------------------------------------
2cwwB           MTEPLFYAMVAEAAQDAHRLVVEKRGQPFDHPVLL-----------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           LKDRAPL--VREAMAGAGFRPLEEAAEGEWVLLAYGR---------------------------------
3b89A           EANYAAW---FEGGLPAEFEIEDKKTIGTELIYLIKK---------------------------------
3egiB           FLNNKLKTITA-----------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           LKDRA--PLVREAMAGAGFRPLEEAAEGEWVLLAYGR---------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           D---------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           VNLTEALSLYEEQLGRLYCP--------------------------------------------------
3eeyA           -----GDTGFEEKEKVLEF---------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           LKDRAPL--VREAMAGAGFRPLEEAAEGEWVLLAYGR---------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ALI--AEPWLSPLQQVHRWRLRWR----------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           VNLTEALSLYEEQLGRLYCP--------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           VNLTEALSLYEEQLGRLYCPVEFSKEIVCV----------------------------------------
3c6kB           VNLTEALSLYEEQLGRLYCP--------------------------------------------------
2br5A           YWYRYAPQLFSEYLGAFRDV--------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           CVNLTEALSLYEEQLGRLYCPVEF----------------------------------------------
3c6kA           CVNLTEALSLYEEQLGRLYCPVEF----------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           IVPGTPD--FLAYVRGSSSFECTHYS--------------------------------------------
3dulA           VRIRRFYELIAAE-PRVSATALQTVGSKGY----------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           YWYRYAPQLFSEYLGAFRDVL-------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAYHHLAQVKRALRRP
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           -------------------------------------------------------AWQYLGTTQAENEQ-
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           -------------------------------------------------------RAEYQRQRDPLHQF-
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LKEVLGDHKRAHALRAYPAPYLFRLAQEALEGGEEVLARELLSRARDAGLEAVAEEDLTGLIHLLERLEG
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           ELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWDSLFLEVKELFLAAVRLDPTSIDPD
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ------------------------------------------------------------LASCYLKQGK
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           AEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENALYAALATVLYYQASQHM
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ------------------------RLKVKTSEEQAEAKRLEREQKLKL-----YQSATQAVFQKRQAGEL
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ------------------REQLLQRARLAEQAERYDDMASAMKAVTELNEPL-SNEDRNLLSVAYKNVVG
2br5C           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PWAAFSVLYQALSRTPQPPLELLALAYRLSRAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAH
2cg3A           ------------------------------------NARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVE
2cfuA           ------------------------------------------------DGNPATLDPLSPEDSAGRYVEY
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           VQCGLGVLFNLSGEYDK------AVDC-FTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQ
3b3fA           ----------------------------------------------------------------------
2cg2A           --------------------------AGRYVEYMGGAERLLEQAR---ASYARGEYRWVVEVVNRLVFAE
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           -----------------------KRLE-REQKLKLYQSATQAVFQ---KRQAGELDESVLELTSQILGAN
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           --------YAMLGVTDE----GESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTS----------ISWS
2cfzA           ------------------------------GSVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEY
1eg2A           ----------------------------------------------------------------------
2axuE           --------------------------------------------------------------IKNISING
3ckbB           ----------------------------TRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADV
2dl1A           ------------------------------------------------------SGSSGEPAEIKIIREA
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           -------------------------------------------GVFVKGYAMLGVTDEG-------ESGF
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           -------------------------LKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINGK
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------AANLRRAVELRPDDAQLWNKLGA---TLANGNRPQEALDAYNRALDIN
2axuB           --------------------------------------------------------------IKNISING
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           --------------------------------------------TISIMNRNLKEAQYYINQFEHLKTNG
3c3oA           ----------------------------ISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEEL
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           -----------------------DGPS-PVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELN
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           YQDAETLYKEILTRAHEKEFSVNGDNKPIWMHAEEREESKDKRRD-------SAPYGEYGSWYKACKVDS
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------NISING
3bzbB           ----------------------------------------------------------------------
2e2eA           TAQTRAMIDKALALDSNEITALMLLAS---------------------DAFMQANYAQAIELWQKVMDLN
3cvnA           -------------------------------------YHENPMEEGLSMLKLANLAE-AALAFEAVCQAA
3c6kC           ----------------------------------------------------------------------
3cvqA           ------------------------TDYP--FEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKE
1dceA           DESVLELTSQILGANPDFATLWNCRR-----------EVLQHLETEKSPEESAALVKAELGFLESRVNPK
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ---------------------------ELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVD
2axuA           -------------------------------------------------------------TIKNISING
3e4bA           -----------------------AEAHFEKAVGREVAADYYLGQIYRRGYLGKVYPQKALDHLLTRNGQN
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ------------------------------------------TDKNIDSYLNAVNIIN----IFKIIGKE
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ---------------------------------------------------------------------G
2c63A           ARRSSWRVISSIEQKTMADGNEKKLEKVK-AYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYEYLKMK
2br5C           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PQALEVLFDLAEHHEAQGDWRRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKA
2cg3A           YGGAERLLEQARASYARGEYRWVVEVVNRLVFDALEQLGYQAENAGWRNSYLSAAYELPRDQGSADALAA
2cfuA           MGGAERLLEQARASYARGEYRWVVEVVNRLVFDALEQLGYQAENAGWRNSYLSAAYELRRDQGSADALAA
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           PGYIRSRYNLGISCINLGAHREAVEHFLEALNMAMSENSTLRLALSMLGQSDAYGAADARDLSTLLTMFG
3b3fA           ----------------------------------------------------------------------
2cg2A           PDNRAARELQADALEQLGYQAENAGWRNSYLS--------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           PDFATLWNCRREVLQHLETEKSPEESAALVKA--------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           PSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRAL-HYWYFLDLFGKAPFKEHFSN-
2cfzA           MGGAERLLEQARASYARGEYRWVVEVVNRLQADALEQLGYQAENAGWRNSYLSAAYELRRDQGSADALAA
1eg2A           ----------------------------------------------------------------------
2axuE           YYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFIIGKEDIHRSVEELTKISAKEKFTPPKEVTMYYEN-
3ckbB           EIPTKGLDTDEQIDAFDAEHGIRTEDMIKAAG--------------------------------------
2dl1A           YKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRT
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           YRTTFNCNELPTDECLWAWQKNQDIPQLTSISRLGYDITQYNFFLDQTEGMTDAETLRQLRALHYWYFLD
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           EDIHRSLVEELTKISAKEKFTPPKEVTMYYEN--------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           PGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMLLNVMNRPDLVELTYAQNVEPFAKE------------
2axuB           YYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYEN-
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           YYDLEINYLKQIYQFLTDKNIDSYLNAVNIIN--IFKIGKEDIHRSLVEEL-------------------
3c3oA           SKVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKS
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           AANYTVWHFRRVLLRSLQKDLQEEMNYITAIIVLVEWLKDPSQELEFIADILNQDAK-------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           PTVNTTLRSLGALYRRQGKLEAAHTLEDCASR--------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           YYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFIIGKEDIHRSVEELTKISAKEKFTPPKEVTMYYENY
3bzbB           ----------------------------------------------------------------------
2e2eA           SPRINRTQLVESINMAKLLQRRSDL---------------------------------------------
3cvnA           PEREEAWRSLGLTQAENEKDGLAIIALNHARM--------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           PEREEAWRSLGLTQAENEKDGLAIIALNHARA--------------------------------------
1dceA           SYGTWHHRCWLLSRLPEPNWARELELCARFLE--------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           PMRAAYLDDLRSKFLLENSVLKM-----------------------------------------------
2axuA           YYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENY
3e4bA           SADFAIAQLFSQGKGTKPDPLNAYVFSQLAKAQAPLTPAQRAEGQRLVQQELAARGTL------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           DIHRSLVEELTKISAKEKFTPPKEVTYYENYVA-------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           YYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFIIGKEDIHRSVEELTKISAKEKFTPPKEVTMYYEN-
2c63A           GDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISQMQPTHPIRLGLALNFSEIQNAPEQACLLAKQAFDD
2br5C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           VGEGLKALGEEAPHLPEAPRDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cg3A           DTGLLFDYLGVRLDAGAA----------------------------------------------------
2cfuA           MDTGLLFDYLGVRLDAGAA---------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           LPQ-------------------------------------------------------------------
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           MDTGLLFDYRLDAGAAEGKALS------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           RLEILEKGLATSLQNDLQ----------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           LFGKAPFK--------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           CVLFNCAALA------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           VA--------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           VA--------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           AIAELDTLNEDS----------------------------------------------------------
2br5C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3b3fA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2cwwB           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3b89A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
3ceqB           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
2axvB           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3c6kC           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2axuA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
2axuG           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
2br5C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxx
2cg3A           ------
2cfuA           ------
2admA           ------
3bzbA           ------
3c3pB           ------
2d16A           ------
2c0mA           ------
3b3fA           ------
2cg2A           ------
1admA           ------
3c3pA           ------
3c6mB           ------
3c3pC           ------
3cggB           ------
3dstA           ------
3e05B           ------
2dpmA           ------
1aqjB           ------
3cjrA           ------
2b3tA           ------
3ck7A           ------
2cfzA           ------
1eg2A           ------
2axuE           ------
3ckbB           ------
2dl1A           ------
1aqiA           ------
2cwwB           ------
3dxzA           ------
3ck7D           ------
1aqjA           ------
3cjqD           ------
3b89A           ------
3egiB           ------
2ekmA           ------
3cjtC           ------
2axvA           ------
2d16B           ------
3cvlA           ------
2axuB           ------
3c0kA           ------
2dulA           ------
3eeyI           ------
2aw6B           ------
3c3oA           ------
3c6kD           ------
3eeyA           ------
2bedA           ------
3bgvC           ------
2bt8A           ------
3ceqB           ------
3dxyA           ------
3cjtA           ------
2axvB           ------
3bzbB           ------
2e2eA           ------
3cvnA           ------
3c6kC           ------
3cvqA           ------
1dceA           ------
3c6mC           ------
3c6kB           ------
2br5A           ------
3dxxA           ------
3ckkA           ------
3dsxA           ------
2axuA           ------
3e4bA           ------
3bwbB           ------
3c6mD           ------
3c6kA           ------
2axzB           ------
2cl5A           ------
3dulA           ------
2axuG           ------
2c63A           ------
2br5C           ------