[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81585.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1akyA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3akyA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3blvH.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"

## Summary of PDB Search
:198
    3e-14  17%  1e2mA  [c.37.1] THYMIDINE KINASE
    6e-13  16%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    3e-12  15%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    1e-11  16%  2c95B  [x.x.x] ADENYLATE KINASE 1
    2e-11  16%  1akyA  [x.x.x] ADENYLATE KINASE
    2e-11  19%  2cdnA  [x.x.x] ADENYLATE KINASE
    1e-10  18%  1e2kA  [c.37.1] THYMIDINE KINASE
    1e-10  16%  1e2iA  [c.37.1] THYMIDINE KINASE
    9e-10  17%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    8e-09  18%  1e2hA  [c.37.1] THYMIDINE KINASE
    1e-08  17%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    1e-08  16%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    1e-08  32%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    2e-08  19%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    3e-08  17%  1e2lA  [c.37.1] THYMIDINE KINASE
    4e-08  16%  3akyA  [x.x.x] ADENYLATE KINASE
    5e-08  18%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-07  20%  1e2nA  [c.37.1] THYMIDINE KINASE
    2e-07  16%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    3e-07  15%  3adkA  [x.x.x] ADENYLATE KINASE
    3e-07  19%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    4e-06  26%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-06  18%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-06  18%  1e2lB  [c.37.1] THYMIDINE KINASE
    5e-06  16%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    9e-06  14%  1e2kB  [c.37.1] THYMIDINE KINASE
    1e-05  17%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-05  16%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-05  16%  1e2mB  [c.37.1] THYMIDINE KINASE
    4e-05  16%  3blvH  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    5e-05  30%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    8e-05  16%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    1e-04  27%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-04  22%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    4e-04  16%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    6e-04  12%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    6e-04  18%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    7e-04  19%  1e2iB  [c.37.1] THYMIDINE KINASE
    7e-04  34%  2cckA  [x.x.x] THYMIDYLATE KINASE
:198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
1e2mA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRTSAQITMGMPYAVTD
2a2zB           --IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYESFTFQTYACLSRIRAQ
2a2zA           --IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKTFQTYACLSRIRAQL
2c95B           KKTNIIFVVGGPGSGKGTQCEKIVQKYGYTGDLLRSEVSSGSARGKKL------SEIMEKGQLVPLETVL
1akyA           --SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEA--KKIMDQGGLVSDDIMV
2cdnA           --HMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGT--KLGVEAKRYLDAGDLVPSDLTN
1e2kA           -TLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANISAGDAAVVMTSAQITMGMPY
1e2iA           -TLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAVVMTSAQITMGMPY
2a2zD           --IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYRWSFTFQTYACLSRIRA
1e2hA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRAVVMTSAQITMGMPY
2bwjC           RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTELLREELASESE-RSKL--IRDIMERGDLVPSGIVL
2a30B           --IKKISIEGNIAAGKSTFVNILKWEVVPEVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQL
2ccgB           --SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGIRKIVLEGNDMDIRTEAMLFAASRR
1e2fA           -RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYQKKSDVEDHSVHLLFSA
1e2lA           --LLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIFTTQHRLDAVVMTSAQITMGMPY
3akyA           --SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKI--MDQGGLVSDDIMV
1e2jA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHAAVVMTSANITMGMPY
1e2nA           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYMTYWRVLGASETIANIYTTQHRLDQITMGMPYAVTD
2ax4B           -RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLD--------------GDNVRHGLNRNLGFSPGD
3adkA           -KSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSAR--GKMLSEIMEKGQLVPLETVL
2ax4A           -RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPG---------DREENI
3czpB           -HSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAP------------------------------
1e9dA           -RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFS
1e2lB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDPEPMTYWRVLGASETDQGEISAGDAAVVMTSAQITMGMPY
2bwjE           RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------GELLREELASESERSKDIMERG
1e2kB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIAGDAAVVMTSAQITMGMPY
2a30A           --IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMTFQTYACLSRIRAQLASLN
1dvrA           -ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQL--GLEAKKIMDQGGLVSDDIMV
1e2mB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIDAAVVMTSAQITMGMPYAV
3blvH           -------------------------------------------------------------------EIS
2bwjD           -KCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------GELLREELASESE---------
2bwjF           RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------GELLREELASESE-------RS
1e2jB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY------------------------------------
3do6A           LILVTAVTPTPAGEGKTTTSIGLSSLNRIGKKSIVTLREP------------------------------
2dwoA           -SPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQC
3c95A           SDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLK--------------------ILRE
1e9cA           -RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFS
1e2iB           -TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY--VPEPMTYWRVLGASETIANIYTTQHRLDQGEISA
2cckA           ----FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEAMLFAASRR


                         .         .         *         .         .         .         .:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
1e2mA           AVLAPHIGGEAGSPLTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
2a2zB           LASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWWHDWMNNQFGQSLELDGIIYLQATPETCLHR
2a2zA           ASLNGKEKPVLFFERSVYSDRYIFASNLYESTEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHR
2c95B           DMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPT-----------LLLYVDAGPETMTQRLLKR
1akyA           NMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLK-----------EQGTPLEKAIELKVDDELLVAR
2cdnA           ELVDDRLNNPDAANGFILDGYPRSVE------------QAKALHEMLERRGTDIDAVLEFRVSEEVLLER
1e2kA           AVTDAVLAPHIGGELTLIFDRHPIAALLCY-PAARYLMGSMTPQAVLAFVALIPPTVLGALPEDRHIDRL
1e2iA           AVTDAVLAPHPPPALTLIFDRHPIAALLCRYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
2a2zD           QLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWWHDWMNNQFGQSLELDGIIYLQATPETCLHR
1e2hA           AVTDAVLAPHIGGALTLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
2bwjC           ELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQ-----------LVICMDCSADTMTNRLLQM
2a30B           ASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWWHDWMNNQFGQSLELDGIIYLQATPETCLHR
2ccgB           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLN-VSAEVGRE
1e2fA           NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLV-LFLQLQLADAAKR
1e2lA           AVTDAVLAPHIGGEATLIFDRHPIAALLCYPAARYLTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
3akyA           NMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQML-----------KEQGTPLEKAIELKVDDELLVAR
1e2jA           AVTDAVLAPHIGGALTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
1e2nA           AVLAPHIGGEAPPALTLIFDRHPIAALLCYPAARYLMPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
2ax4B           REENIRRIAEVA--------KLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFIFVDAPLNICESR
3adkA           DMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPE-----------TMTKRLLKR
2ax4A           RRIAEVAKLFADAGLVCITS-------------FISPFAKDRENARKIHESAGLPFFIFVDAPLNICESR
3czpB           ----------------------------------------------------------------------
1e9dA           ANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKR
1e2lB           AVTDAVLAPHIGGELTLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
2bwjE           DLVPSGIVLELLKE--AMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQM
1e2kB           AVTDAVLAPHIGGALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAIPPTLPGTNIVLGALPEDRHIDR
2a30A           GKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWWHDWMNNQFGQSLELDGIIYLQATPETCLHY
1dvrA           NMIKDELTNNPACKNGFILVIPQAEKLDQMLKEQGTPLEKADELLVARITGRLIHYHKIFNPPKEDMKDD
1e2mB           TDAVLAPHIGGEAGSPPALTLIFDCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
3blvH           KSVKKI----FSAANVPIEWESCDVSPIFVNGLTTIPDPAV-QSITKNLVALKGPLATPIGRSLNLTLRK
2bwjD           ----------------------------------------------------------------------
2bwjF           KLIRDIMERGDLVPSGILKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNR
1e2jB           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2dwoA           ALAALRDV--------------------------------------------------------------
3c95A           NPQVREKV------VAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFN
1e9cA           ANRWEQVPLIKEKLSQGTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRG
1e2iB           GDAAVVMTHAPPPALTLIFDRHPIAALAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
2cckA           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER


                         +         .         .         .         .         *         .:210
query           VRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLLx
1e2mA           LKRQRPGERLDLAMLAAIRRVYGLLANTQCGGSWREDWGQLSGPRPHIGDTLFTLF--
2a2zB           IYLRGREQGIPLEYLEKLHYKHTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL-
2a2zA           IYLLEYLEKLHYKHESWLLHRKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL-
2c95B           -GETSGRVDDNEETIKKRLETYYKATEPKRGIVRKVNAEGSVDSVFSQVCTHLDALL-
1akyA           ITGPPKEDMKDADALKKRLAAYHAQTEPKTGIWAGVDASQPPATVWADILNKL-----
2cdnA           LGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALG----
1e2kA           AKRQRPGERLDLAMLAAIRRVYGLLAGSWREDWGQLSGTGPRPHIGDTLFTLFR----
1e2iA           LKRQRPGERLDLAMLAAIRRVYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFR----
2a2zD           IYLRGREQGIPLEYLEKLHYKHTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL-
1e2hA           LKRQRPGERLDLAMLAAIRRVYGLLANT------------------------------
2bwjC           SRSSLPVDDTTKTIAKRLEAIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF-
2a30B           IYLRGRNEEQGIEYLEKLHYKHTNFDYLQEVPILTLDVNEYESLVEKVKEF-------
2ccgB           RIIKNSLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYL-
1e2fA           GAF-GHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI-
1e2lA           AKRQRPGERLDLAMLAAIRRVYGLLANT------------------------------
3akyA           ITGRLIHPASGADALKKRLAAYHAQTEPKTGIWAGVDASQPPATVWADFLNKL-----
1e2jA           LKRQRPGERLDLAMLAAIRRVYGLLANT------------------------------
1e2nA           AKRQRPGERLDLAMLAAIRRVYGLLANTV-----------------------------
2ax4B           DVKGLYKRAREIKGFTGIDSDYEKPETPE---RVLKTNLSTVSDCVHQVVELLQ----
3adkA           -GETSGRVDDNEETIKKRLETYYKATEEKRGIVRKVNAEGSVDDVFSQVCTHLD----
2ax4A           DVKGLYKRAREIKGFTGIDSDYEKPETPE---RVLKTNLSTVSDCVHQVVELLQ----
3czpB           ----------------------------------------------------------
1e9dA           GAFGHERYE-NGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI-
1e2lB           LAK-----RLDLAMLAAIRRVYGLLANT------------------------------
2bwjE           SRSSLPVDDTTKTIAKRLEAYYRASIPETKTQLHKINAEGTPEDVFLQLCTAIDSIF-
1e2kB           LAKRERLDLAMLAYLQCGGSWREDWGQLSGTAVPQSNAGPRP----------------
2a30A           LRGRNEEQGIPLEYLEKLHYKHTNFDYLQEVPILTLDVNEY-ESLVEKVKEFLSTL--
1dvrA           VEALVQISDDNADALKKRLAAYHAQTEPKTGIWAGVDASQPPATVWADILNKL-----
1e2mB           LAK-----RLDLAMLAAIRRVYGLLANT------------------------------
3blvH           KSIEGFKTTYENVDLVLIRENTEGEYSGIEHGVVQSIKLITRDASERVIRYAFE----
2bwjD           ----------------------------------------------------------
2bwjF           LLQMSRSSLPVDDTTKTIAKRLVIAYYETKTQLHKINAEGTPEDVFLQLCTAID----
1e2jB           ----------------------------------------------------------
3do6A           ----------------------------------------------------------
2dwoA           ----------------------------------------------------------
3c95A           YRARNFPGTLDYAEQQRWLEHRRQVFTPGY--ADELQMLVQQYADDKEKVALLKAL--
1e9cA           AFGHERYE--NGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI-
1e2iB           LAKRERLD---LAMLAAIRRVYGLLANT------------------------------
2cckA           IIKNSRLDQEDLKFHEKVIEGYQEIIR----FKSVNDQPL--ENVVEDTYQTIIKYL-