[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81794.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b7kA.bssp"
#ERROR : Can't open dsspfile "3bjkA.bssp"
#ERROR : Can't open dsspfile "3bjkC.bssp"
#ERROR : Can't open dsspfile "3bjkD.bssp"
#ERROR : Can't open dsspfile "3b7kB.bssp"
#ERROR : Can't open dsspfile "3bjkF.bssp"
#ERROR : Can't open dsspfile "3bjkB.bssp"
#ERROR : Can't open dsspfile "3d6lA.bssp"
#ERROR : Can't open dsspfile "3b7kC.bssp"
#ERROR : Can't open dsspfile "2aliA.bssp"
#ERROR : Can't open dsspfile "3cjyA.bssp"
#ERROR : Can't open dsspfile "2eisA.bssp"
#ERROR : Can't open dsspfile "2aelA.bssp"
#ERROR : Can't open dsspfile "3e1eC.bssp"
#ERROR : Can't open dsspfile "3e1eA.bssp"
#ERROR : Can't open dsspfile "3e1eD.bssp"
#ERROR : Can't open dsspfile "2cyeA.bssp"
#ERROR : Can't open dsspfile "3d6xC.bssp"
#ERROR : Can't open dsspfile "3e1eB.bssp"
#ERROR : Can't open dsspfile "2aelB.bssp"
#ERROR : Can't open dsspfile "2egiA.bssp"
#ERROR : Can't open dsspfile "3dkzB.bssp"
#ERROR : Can't open dsspfile "2b6eD.bssp"
#ERROR : Can't open dsspfile "2cy9A.bssp"
#ERROR : Can't open dsspfile "2cyeD.bssp"
#ERROR : Can't open dsspfile "2egiH.bssp"
#ERROR : Can't open dsspfile "2egiG.bssp"
#ERROR : Can't open dsspfile "2egiD.bssp"
#ERROR : Can't open dsspfile "2egjA.bssp"
#ERROR : Can't open dsspfile "1bvqA.bssp"
#ERROR : Can't open dsspfile "2egiE.bssp"
#ERROR : Can't open dsspfile "2cwzB.bssp"
#ERROR : Can't open dsspfile "3d6xE.bssp"
#ERROR : Can't open dsspfile "2egiI.bssp"
#ERROR : Can't open dsspfile "3d6xF.bssp"
#ERROR : Can't open dsspfile "3ck1A.bssp"
#ERROR : Can't open dsspfile "2egiF.bssp"
#ERROR : Can't open dsspfile "2cwzA.bssp"
#ERROR : Can't open dsspfile "2av9A.bssp"
#ERROR : Can't open dsspfile "2b6eA.bssp"
#ERROR : Can't open dsspfile "2av9E.bssp"
#ERROR : Can't open dsspfile "3bnvD.bssp"
#ERROR : Can't open dsspfile "3dkzA.bssp"
#ERROR : Can't open dsspfile "3bnvA.bssp"
#ERROR : Can't open dsspfile "2av9D.bssp"
#ERROR : Can't open dsspfile "3bnvB.bssp"
#ERROR : Can't open dsspfile "3d6xB.bssp"
#ERROR : Can't open dsspfile "2av9J.bssp"
#ERROR : Can't open dsspfile "3bnvF.bssp"
#ERROR : Can't open dsspfile "3e29B.bssp"
#ERROR : Can't open dsspfile "2cyeC.bssp"
#ERROR : Can't open dsspfile "2dslA.bssp"
#ERROR : Can't open dsspfile "3bnvH.bssp"
#ERROR : Can't open dsspfile "3b7jB.bssp"
#ERROR : Can't open dsspfile "1c8uA.bssp"
#ERROR : Can't open dsspfile "3bnvG.bssp"
#ERROR : Can't open dsspfile "3d6xD.bssp"
#ERROR : Can't open dsspfile "3d6xA.bssp"
#ERROR : Can't open dsspfile "2b6eB.bssp"
#ERROR : Can't open dsspfile "2av9H.bssp"
#ERROR : Can't open dsspfile "3d04B.bssp"
#ERROR : Can't open dsspfile "3e29D.bssp"
#ERROR : Can't open dsspfile "3dp3D.bssp"
#ERROR : Can't open dsspfile "2cy9B.bssp"
#ERROR : Can't open dsspfile "2av9B.bssp"
#ERROR : Can't open dsspfile "2av9G.bssp"
#ERROR : Can't open dsspfile "3b7jC.bssp"
#ERROR : Can't open dsspfile "3e8pA.bssp"
#ERROR : Can't open dsspfile "2bi0A.bssp"
#ERROR : Can't open dsspfile "3dozD.bssp"
#ERROR : Can't open dsspfile "3d04F.bssp"
#ERROR : Can't open dsspfile "3e29A.bssp"
#ERROR : Can't open dsspfile "3bbjA.bssp"
#ERROR : Can't open dsspfile "3bbjB.bssp"
#ERROR : Can't open dsspfile "2c2iA.bssp"

## Summary of PDB Search
:125
    4e-20  22%  3b7kA  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    2e-15  30%  3bjkA  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    2e-15  30%  3bjkC  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    3e-15  29%  3bjkD  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    6e-15  26%  3b7kB  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    5e-14  30%  3bjkF  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    4e-13  30%  3bjkB  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    5e-13  32%  3d6lA  [x.x.x] PUTATIVE HYDROLASE
    2e-12  23%  3b7kC  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    4e-12  14%  2aliA  [x.x.x] HYPOTHETICAL PROTEIN PA2801
    5e-12  16%  3cjyA  [x.x.x] PUTATIVE THIOESTERASE
    8e-12  34%  2eisA  [x.x.x] HYPOTHETICAL PROTEIN TTHB207
    2e-11  12%  2aelA  [x.x.x] TRICHODIENE SYNTHASE
    5e-11  20%  3e1eC  [x.x.x] THIOESTERASE FAMILY PROTEIN
    9e-11  22%  3e1eA  [x.x.x] THIOESTERASE FAMILY PROTEIN
    2e-10  20%  3e1eD  [x.x.x] THIOESTERASE FAMILY PROTEIN
    2e-10  26%  2cyeA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
    3e-10  14%  3d6xC  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    3e-10  21%  3e1eB  [x.x.x] THIOESTERASE FAMILY PROTEIN
    3e-10  12%  2aelB  [x.x.x] TRICHODIENE SYNTHASE
    4e-10  19%  2egiA  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    5e-10  19%  3dkzB  [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN
    6e-10  15%  2b6eD  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    9e-10  20%  2cy9A  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    2e-09  26%  2cyeD  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
    2e-09  16%  2egiH  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    2e-09  18%  2egiG  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    3e-09  15%  2egiD  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    3e-09  19%  2egjA  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    3e-09  13%  1bvqA  [d.38.1] PROTEIN (4-HYDROXYBENZOYL COA THIOESTERASE)
    6e-09  19%  2egiE  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    6e-09  12%  2cwzB  [x.x.x] THIOESTERASE FAMILY PROTEIN
    8e-09  15%  3d6xE  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    1e-08  12%  2egiI  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    1e-08  15%  3d6xF  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    1e-08  27%  3ck1A  [x.x.x] PUTATIVE THIOESTERASE
    1e-08  19%  2egiF  [x.x.x] HYPOTHETICAL PROTEIN AQ_1494
    3e-08  13%  2cwzA  [x.x.x] THIOESTERASE FAMILY PROTEIN
    4e-08  16%  2av9A  [x.x.x] THIOESTERASE
    4e-08  17%  2b6eA  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    5e-08  16%  2av9E  [x.x.x] THIOESTERASE
    5e-08  15%  3bnvD  [x.x.x] CJ0977
    6e-08  18%  3dkzA  [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN
    7e-08  14%  3bnvA  [x.x.x] CJ0977
    7e-08  16%  2av9D  [x.x.x] THIOESTERASE
    7e-08  14%  3bnvB  [x.x.x] CJ0977
    7e-08  17%  3d6xB  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    9e-08  16%  2av9J  [x.x.x] THIOESTERASE
    9e-08  14%  3bnvF  [x.x.x] CJ0977
    9e-08  20%  3e29B  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    1e-07  26%  2cyeC  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
    1e-07  21%  2dslA  [x.x.x] PHENYLACETIC ACID DEGRADATION PROTEIN PAAI
    1e-07  14%  3bnvH  [x.x.x] CJ0977
    1e-07  15%  3b7jB  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    2e-07  14%  1c8uA  [d.38.1 - d.38.1] ACYL-COA THIOESTERASE II
    2e-07  14%  3bnvG  [x.x.x] CJ0977
    2e-07  14%  3d6xD  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    2e-07  15%  3d6xA  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    3e-07  16%  2b6eB  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    3e-07  16%  2av9H  [x.x.x] THIOESTERASE
    3e-07  15%  3d04B  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    4e-07  19%  3e29D  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    4e-07  15%  3dp3D  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    6e-07  18%  2cy9B  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    9e-07  16%  2av9B  [x.x.x] THIOESTERASE
    1e-06  16%  2av9G  [x.x.x] THIOESTERASE
    1e-06  15%  3b7jC  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    1e-06  16%  3e8pA  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-06  13%  2bi0A  [x.x.x] HYPOTHETICAL PROTEIN RV0216
    3e-06  20%  3dozD  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    4e-06  17%  3d04F  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    9e-06  19%  3e29A  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    3e-05  20%  3bbjA  [x.x.x] PUTATIVE THIOESTERASE II
    4e-05  19%  3bbjB  [x.x.x] PUTATIVE THIOESTERASE II
    1e-04  11%  2c2iA  [x.x.x] RV0130
:125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
3b7kA           TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAI
3bjkA           -VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkC           -VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkD           -VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3b7kB           TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAI
3bjkF           -VLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkB           --------AMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3d6lA           -EPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFKEPVFIGDIISCYSK
3b7kC           TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAI
2aliA           ----TAHIPVRWGDDSYGHVNNTLYFQYLEEARVAWFETLGIAEGPVVLQSLHTYLKPVVHPATVVVELY
3cjyA           -YAITVGPDLAVGPPGHAYLFGGASALALDVAAE--------TVGRPVVQGSLQFVSFTPLGSVLDLTVE
2eisA           ------YPVFPGETNHYGTLFGGTVLAWDQAAFVAAT-RHARKKVVTVHADAVDFKRPVPLGAIVELVAR
2aelA           -------PQFLRRMNGLGHCVGASLWPKEQFNERS-------LFLEITSAIAQMENWMVWVNDLMSFYKE
3e1eC           -RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEKVNFLNPAE-GERFAFRAE
3e1eA           -RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEKVNFLNPAE-GERFAFRAE
3e1eD           -RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEKVNFLNPAE-GERFAFRAE
2cyeA           ----------------------------ELARIRYFQRIDWLEEGHFVVAREVDYLRPILLGDEVFVGVR
3d6xC           -KNISISDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESPKSKVVYFTGIDGAKFRNPVRPGDRLDYESV
3e1eB           -RVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAAFSLMEEEAAVLTVEKVNFLNPAE-GERFAFRAE
2aelB           -------PQFLRRMNGLGHCVGASLWPKEQFNERS-------LFLEITSAIAQMENWMVWVNDLMSFYKE
2egiA           -------------------------------KGFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLN
3dkzB           -TARTRLPARADLVNSRGDIHGGTLSVLDFTLGAAIRGDTPEVGVATI---DNTSFSPGRGD--LVIETR
2b6eD           -EDWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDNANHLRPVRSGKVT-ARAT
2cy9A           --------VEEQHTNKLGTLHGGLTATLVDSISTALCT-------PGVSVDNITYSPAKI-GEEIVITAH
2cyeD           ----------------------------ELARIRYFQRIDWLEEGHFVVAREVDYLRPILLGDEVFVGVR
2egiH           --------VQFYETDAQGIVHHSNYFRYFE----EARGEFLRSKEVVLLNAYCEYKKPLFYDDVFEVHLN
2egiG           --------------------------------GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLN
2egiD           --------VQFYETDAQGIVHHSNYFRYFEEARGEFSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLN
2egjA           --------------------------------GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLN
1bvqA           --------------------------------------VERGIVGTPIVSCNASFVCTASYDDVLTIETC
2egiE           --------------------------------GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLN
2cwzB           -VFETVVTPETVRFEELGPVHPVYATYWVKHGRKIILPFLEEGEEGIGSYVEARHLASALPGRVR-VVAR
3d6xE           ------SDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESEKSKVVYFTGIDGAKFRNPVRPGDRLDYESV
2egiI           --------VQFYETDAQGIVHHSNYFRYFEEARGEFLRSKL---EVVLLNAYCEYKKPLFYDDVFEVHLN
3d6xF           ------SDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESEKSKVVYFTGIDGAKFRNPVRPGDRLDYESV
3ck1A           ----------------------------AQALDWPFDAHGAGQAGVPTADLHCRFVAPSRLGETLTRELR
2egiF           --------------------------------GFPYSKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLN
2cwzA           --------PETVRFEELGPVHPVYATYWHELAGRKIILPFLEEGEEGIGSYEARHLASALPGRVR-VVAR
2av9A           YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
2b6eA           -EDWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDNANHLRPVRSGKVT-ARAT
2av9E           -LHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
3bnvD           -YAKSILITTSEVADDQGLIFDAFIFAAAN----YVAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAH
3dkzA           -TARTRLPARADLVNSRGDIHGGTLSVLDFTLGAAIRGDTPEVGVATI---DNTSFSPGRGDLVIE--TR
3bnvA           -YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAH
2av9D           YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
3bnvB           -YAKSILITTSEVADDQGLIFDAFIFAAANYVAQASINKE----FSVIIGSKCFFYAPLKLGDVLELEAH
3d6xB           --------HVFGHFPGHPIYPGVLILEGAQTGGVLAFESEPKKVVYFTGIDGAKFRNPVRPGDRLDYESV
2av9J           YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
3bnvF           -YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAH
3e29B           IVLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTD---HVDYHRVATPGDLR-AEGQ
2cyeC           -----------------------------------RISPDWLEEGHFVVAREVDYLRPILLGDEVFVGVR
2dslA           -EAVVAGEVRADHLDLHGTAHGGFLYALADSAFALASNTRGPAVALSC---RMDYFRPLGAGARVEARAV
3bnvH           -YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAH
3b7jB           -------------------------------LWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLE
1c8uA           ----QVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLATIDHSMWFHRPFNLNEWLLYSVE
3bnvG           -YAKSILITTSEVADDQGLIFDAFIFAAANY----VAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAH
3d6xD           YKNISISDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESDKSKVVYFTGIDGAKFRNPVRPGDRLDYESV
3d6xA           ------ISDHVFGHFPGHPIYPGVLILEGAQTGGVLAFESKSKVVYFTGIDGAKFRNPVRPGDRLDYESV
2b6eB           -EDWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAGSLCLEGKTVVGLDINANHLRPVRSGKVT-ARAT
2av9H           YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
3d04B           ----------------------------FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLE
3e29D           IVLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTD---HVDYHRVATPGDLR-AEGQ
3dp3D           ----------------------------FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLE
2cy9B           ------EKVEEQHTNKLGTLHGGLTATLVDSISTALCT------EPGVSV-DNITYSPAKIGEEIVITAH
2av9B           YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
2av9G           -LHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEG-LR
3b7jC           ----------------------------FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLE
3e8pA           ----AINKPELIGNIHQQILHGGVTATVLDVVGGLTAFALQQRLQTLGTIDRVDYLRPGRGQIFT-GTGS
2bi0A           -------------------------------VAIGQSTLATQRVKANLFYRGLRFHRFPAVGDTLYTRTE
3dozD           -------------------------------LWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLE
3d04F           ----------------------------FTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLE
3e29A           -VLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTD---HVDYHRVATPGDL-RAEGQ
3bbjA           ----------LDPGYLIGTANGGYLTVLQRSALAESD------HLHAVSS-SYHFHRPASSGPA-EIETR
3bbjB           --------VELDPGYLIGTANGGYLTVLQRSALAESD------HLHAVSS-SYHFHRPASSGPAE-IETR
2c2iA           -------------------------------RLQHQYTVKGVKLAINYGLNKVRFPAPVPVGSRVRATSS


                         .         .         *         .         .         .         .:140
query           VVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVEAHxxxx
3b7kA           VNNTFQTCVEVGVRVEAFQEWAEGRGRHINSAFLIYNAADDKENLI---------
3bjkA           CLKVGRSSIKIKVEVWVKKVASEPIRYCVTDAVFTFVAVDNNGRSRTI-------
3bjkC           CLKVGRSSIKIKVEVWVKKVASIGERYCVTDAVFTFVAVDNNGRSRTI-------
3bjkD           CLKVGRSSIKIKVEVWVASEPIGERYCVTD-AVFTFVAVDNNGRSRTI-------
3b7kB           VNNCVEVGVRVEAFDCQEW-AEGRGRHINS-AFLIYNA-----------------
3bjkF           CLKVGRSSIKIKVEVWVASEPIGERYCVTD-AVFTFVAVDNNGRTIPR-------
3bjkB           CLKVGRSSIKIKVEVWVASEPIGERYCVTD-AVFTFVAVDNNGRSRTI-------
3d6lA           VVNVGNTSISVEVEVTAQRVDSQGCCINVTSALVTYVSVTRDGKKNPI-------
3b7kC           VNNTFQTCVEVGVRVEAF-----DCQEWAE-GRGRHINSA---------------
2aliA           AGRLGTSSLVLEHRLHTL---EDPQGTYGE-GHCKLVWVRAENRSTPV-------
3cjyA           VLQSGRTLAQARVAGTVD------GRLVFH-SGISLGREGFSARQWAL-------
2eisA           LKEVGRTSRVEVEWVE-PVKEGEEAYLAAR-GGFVLVAVDERGRPSPV-------
2aelA           FDDERDQISLVKNYVVSDEISLHEALEKLTQDTLQMVAVFSDKDPQVM-------
3e1eC           VVKPGRTLTVATATAYAF-------------------------------------
3e1eA           VVKPGRTLTVATATAYAF--RDGEERAIAT-------------------------
3e1eD           VVKPGRTLTVATATAYAF-------------------------------------
2cyeA           TVGLGRSSLREHLVTANGE--------SAAKGLGVLVWL-EGGRPAPL-------
3d6xC           VKNRGNWIFKGQAFVDGNLVAEAELKAI---------------------------
3e1eB           VVKPGRTLTVATATAYAFR------------------------------------
2aelB           FDDERDQISLVKNYVVSDEISLHEALEKLTQDTLQMVAVFSDKDPQVM-------
2egiA           LEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMVKIVSIPKEV-------
3dkzB           CLRRGASIAFCEGEIRDS-----AGELVAK-ATATFKII----------------
2b6eD           PINLGRNIQVWQIDIRT-----EENKLCCV-SRLTLSVINLL-------------
2cy9A           ILKQGKTLAFASVDLTNKTTGK-----LIAQGRHTK-------------------
2cyeD           TVGLGRSSLREHLVTANGE--------SAAKGLGVLVWL-EGGRPAPL-------
2egiH           LEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMV----------------
2egiG           LTFTFSYIVFKEDIA-------------VAKANTKHCMVKIVSIPVL--------
2egiD           LEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMVK-NGKIVSIPKE----
2egjA           LEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMVK-NGKIVSIPKE----
1bvqA           IKEWRRKSFVQRHSVSRTT-PGGDVQLVMR-ADEIRVFAMERLRAIEV-------
2egiE           LEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMVK-NGKIVSIPKE----
2cwzB           HEKTEGNRVYARVEAYNEL------GDLIGVGRTEQVILPKAKVEALF-------
3d6xE           VKNRGNWIFKGQAFVDGNLVAEAELKAI---------------------------
2egiI           LEELSTFTFSYIVFKEDIAVAKANTKHCM--------------------------
3d6xF           VKNRGNWIFKGQAFVDGNLVAEAELKAI---------------------------
3ck1A           VVKLGQSSFTVQVRFGPD------SGLRLE-VTQRLVCVDDKIAPRPL-------
2egiF           LEELSRFTFTFSYIVF-------KEDIAVAKANTKHCMV-KNGKIVSI-------
2cwzA           HEKTEGNRVYARVEAYNEL------GDLIGVGRTEQVILPKAKVEALF-------
2av9A           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
2b6eA           PINLGRNIQVWQIDIRTE-----ENKLCCV-SRLTLSVIN---------------
2av9E           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
3bnvD           ALFDETSKKRDVKVVG------HVKEIKFE-GTIQVVSTDEHIF-----------
3dkzA           CLRRGASIAFCEGEIRDSA------GELVAKATATFKII----------------
3bnvA           ALFDETSKKRDVKVVG------HVKEIKFE-GTIQVVSTDEH-------------
2av9D           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
3bnvB           ALKKRDVKVVGHVKEIKFE------------------------------------
3d6xB           VKNRGNWIFKGQAFVDGNLVAEAELKAI---------------------------
2av9J           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
3bnvF           ALFDETSKKRDVKVVGHV------KEIKFE-GTIQVVSTDEH-------------
3e29B           VIHFGKRFATAHARVLDD------GNLVAS-GRALYLIR----------------
2cyeC           TVGLGRSSLREHLVTANGE--------SAAKGLGVLVWLE-GGRPAPL-------
2dslA           EVNLSRRTATYRVEVVSE------GKLVAL-FTGTVFRL----------------
3bnvH           ALFDETSKKRDVKVVG------HVKEIKFE-GTIQVVSTDEH-------------
3b7jB           VLKHKGMIWQVGGTAQVD-------GKVVAEAELKAMIAERE-------------
1c8uA           STSASSARGFVRGEFYTQ-----DGVLVAS-TVQEGVMRNH--------------
3bnvG           ALFDETSKKRDVKVVGHV-------KEIKFEGTIQVVSTDEHI------------
3d6xD           VKNRGNWIFKGQAFVDGNLVAEAELKAI---------------------------
3d6xA           VKNRGNWIFKGQAFVDGNLVAEAELKAI---------------------------
2b6eB           PINLGRNIQVWQIDIRT-----EENKLCCV-SRLTLSVIN---------------
2av9H           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
3d04B           VLKHKGMIWQVGGTAQVD-------GKVVAEAELKAMIA----------------
3e29D           VIHFGKRFATAHARVLDD-------------------------------------
3dp3D           VLKHKGMIWQVGGTAQVD-------GKVVAEAELKAMIA----------------
2cy9B           ILKQGKTLAFASVDL----TNKTTGKLIAQGRHTKHLG-----------------
2av9B           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
2av9G           VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
3b7jC           VLKHKGMIWQVGGTAQ-------VDGKVVAEAELKAMIA----------------
3e8pA           VIRAGNRVSVCRELHNEQ-------GTHIAFGTGTYV------------------
2bi0A           VVGLRANSPKPGRAPTGLAGLRTTIDRLVLDFYRCALPASPDWKPGAVPGD----
3dozD           VLKHKGMIWQVGGTAQV------DGKVVAE-AELKAMIA----------------
3d04F           VLKHKGMIWQVGGTAQVD-------------------------------------
3e29A           VIHFGKRFATAHARVLDD-------------------------------------
3bbjA           VLKRGRTVTTVQTTLFQE-------------------------------------
3bbjB           VLKRGRTVTTVQTTLFQE-------------------------------------
2c2iA           LVGVEDLGNGTVQATVSTTVEGSAKPACVAESIVRYV------------------