[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81826.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "3cgcA.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "3cgbA.bssp"
#ERROR : Can't open dsspfile "2cduA.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "1dxlA.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2bs2A.bssp"
#ERROR : Can't open dsspfile "2a87A.bssp"
#ERROR : Can't open dsspfile "3cirA.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "2a87B.bssp"
#ERROR : Can't open dsspfile "1ebdA.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "3d1cA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "2b76M.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "2a8xA.bssp"
#ERROR : Can't open dsspfile "2b76A.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "3eanF.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "2e5vA.bssp"
#ERROR : Can't open dsspfile "3dh9A.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "3dghA.bssp"
#ERROR : Can't open dsspfile "3cesB.bssp"
#ERROR : Can't open dsspfile "1cl0A.bssp"
#ERROR : Can't open dsspfile "3ef6A.bssp"
#ERROR : Can't open dsspfile "1e6eC.bssp"
#ERROR : Can't open dsspfile "2ciqA.bssp"
#ERROR : Can't open dsspfile "2bi7A.bssp"
#ERROR : Can't open dsspfile "3cpiH.bssp"
#ERROR : Can't open dsspfile "1bzlA.bssp"
#ERROR : Can't open dsspfile "3cesD.bssp"
#ERROR : Can't open dsspfile "3cetA.bssp"
#ERROR : Can't open dsspfile "2a0iA.bssp"
#ERROR : Can't open dsspfile "1aogA.bssp"
#ERROR : Can't open dsspfile "1aogB.bssp"
#ERROR : Can't open dsspfile "3cpjG.bssp"
#ERROR : Can't open dsspfile "1d5tA.bssp"
#ERROR : Can't open dsspfile "3cesA.bssp"
#ERROR : Can't open dsspfile "2bmaA.bssp"
#ERROR : Can't open dsspfile "1e6eA.bssp"
#ERROR : Can't open dsspfile "3cetB.bssp"
#ERROR : Can't open dsspfile "3cpiG.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "3bg7A.bssp"
#ERROR : Can't open dsspfile "1coyA.bssp"
#ERROR : Can't open dsspfile "2drvA.bssp"
#ERROR : Can't open dsspfile "2cyjA.bssp"
#ERROR : Can't open dsspfile "2c72A.bssp"
#ERROR : Can't open dsspfile "2c76B.bssp"
#ERROR : Can't open dsspfile "3dbrD.bssp"
#ERROR : Can't open dsspfile "2c75B.bssp"
#ERROR : Can't open dsspfile "3coxA.bssp"
#ERROR : Can't open dsspfile "2brxA.bssp"
#ERROR : Can't open dsspfile "3bg6A.bssp"
#ERROR : Can't open dsspfile "2c72B.bssp"
#ERROR : Can't open dsspfile "3d4oA.bssp"
#ERROR : Can't open dsspfile "3cp2A.bssp"
#ERROR : Can't open dsspfile "1chuA.bssp"
#ERROR : Can't open dsspfile "2c73A.bssp"
#ERROR : Can't open dsspfile "3d8xA.bssp"
#ERROR : Can't open dsspfile "3dbhF.bssp"
#ERROR : Can't open dsspfile "3cmmC.bssp"
#ERROR : Can't open dsspfile "2bmuB.bssp"
#ERROR : Can't open dsspfile "2bmuA.bssp"
#ERROR : Can't open dsspfile "2bk4A.bssp"
#ERROR : Can't open dsspfile "3cp8A.bssp"
#ERROR : Can't open dsspfile "3cphH.bssp"
#ERROR : Can't open dsspfile "3datA.bssp"
#ERROR : Can't open dsspfile "3dbhB.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "3cesC.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "3b3rA.bssp"
#ERROR : Can't open dsspfile "2culA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "3dbhE.bssp"
#ERROR : Can't open dsspfile "3d4oC.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "1d4cB.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "3c0bD.bssp"
#ERROR : Can't open dsspfile "3c24B.bssp"
#ERROR : Can't open dsspfile "1e5lA.bssp"
#ERROR : Can't open dsspfile "2aefA.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "3c24A.bssp"
#ERROR : Can't open dsspfile "1d4cC.bssp"
#ERROR : Can't open dsspfile "1d4dA.bssp"
#ERROR : Can't open dsspfile "3bi4A.bssp"
#ERROR : Can't open dsspfile "2aemA.bssp"
#ERROR : Can't open dsspfile "3cnsA.bssp"
#ERROR : Can't open dsspfile "2amfD.bssp"

## Summary of PDB Search
:443
    6e-48  28%  2cduB  [x.x.x] NADPH OXIDASE
    3e-44  38%  3cgcA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    1e-43  22%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    9e-43  33%  3cgbA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    5e-42  27%  2cduA  [x.x.x] NADPH OXIDASE
    5e-41  27%  2bc0A  [x.x.x] NADH OXIDASE
    6e-39  12%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    2e-38  21%  1dxlA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    1e-37  26%  2bc1A  [x.x.x] NADH OXIDASE
    3e-37  12%  2bs2A  [c.3.1 - d.168.1 - a.7.3 (1e7pA)] QUINOL-FUMARATE REDUCTASE
    4e-37  18%  2a87A  [x.x.x] THIOREDOXIN REDUCTASE
    2e-36  11%  3cirA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    2e-36  22%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-36  18%  2a87B  [x.x.x] THIOREDOXIN REDUCTASE
    8e-36  20%  1ebdA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    2e-35  22%  1bhyA  [x.x.x] P64K
    2e-34  17%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-34  13%  3d1cA  [x.x.x] FLAVIN-CONTAINING PUTATIVE MONOOXYGENASE
    1e-33  14%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1[MASQUE : MEMB(X) 44 / COIL(x)
    1e-33  21%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    5e-33  13%  2b76M  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    2e-32  18%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    8e-32  27%  2a8xA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    2e-31  12%  2b76A  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    6e-31  15%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    3e-29  11%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    1e-28  17%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-28  19%  3eanF  [x.x.x] THIOREDOXIN REDUCTASE 1
    5e-28  19%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-27  11%  2e5vA  [x.x.x] L-ASPARTATE OXIDASE
    1e-27  18%  3dh9A  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-27  18%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    6e-27  18%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    2e-26  20%  3dghA  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    9e-26  11%  3cesB  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    1e-25  15%  1cl0A  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    1e-24  26%  3ef6A  [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN--
    2e-24  13%  1e6eC  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    9e-24   8%  2ciqA  [x.x.x] HEXOSE-6-PHOSPHATE MUTAROTASE
    2e-23   7%  2bi7A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    8e-23   8%  3cpiH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    3e-22  18%  1bzlA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    4e-22  12%  3cesD  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    9e-22   8%  3cetA  [x.x.x] CONSERVED ARCHAEAL PROTEIN
    2e-21  12%  2a0iA  [x.x.x] TRAI PROTEIN
    2e-21  18%  1aogA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-21  18%  1aogB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-21   9%  3cpjG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    5e-21  11%  1d5tA  [c.3.1 - d.16.1] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR
    9e-21  12%  3cesA  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    7e-20   7%  2bmaA  [x.x.x] GLUTAMATE DEHYDROGENASE (NADP+)
    9e-20  15%  1e6eA  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    2e-19  10%  3cetB  [x.x.x] CONSERVED ARCHAEAL PROTEIN
    1e-18   8%  3cpiG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    2e-18  15%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    3e-18   8%  3bg7A  [x.x.x] PYRANOSE OXIDASE
    4e-18   9%  1coyA  [x.x.x] CHOLESTEROL OXIDASE
    2e-17  10%  2drvA  [x.x.x] UPF0130 PROTEIN PH1069
    9e-17  14%  2cyjA  [x.x.x] HYPOTHETICAL PROTEIN PH1505
    2e-16   7%  2c72A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-16   7%  2c76B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    7e-16  11%  3dbrD  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    5e-15   6%  2c75B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-15  10%  3coxA  [x.x.x] CHOLESTEROL OXIDASE
    2e-14  11%  2brxA  [x.x.x] URIDYLATE KINASE
    3e-14   9%  3bg6A  [x.x.x] PYRANOSE OXIDASE
    4e-14  10%  2c72B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-14   8%  3d4oA  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    1e-12  12%  3cp2A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-12  12%  1chuA  [c.3.1 - d.168.1 - a.7.3] PROTEIN (L-ASPARTATE OXIDASE)
    2e-12   7%  2c73A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    4e-12  19%  3d8xA  [x.x.x] THIOREDOXIN REDUCTASE 1
    4e-11  11%  3dbhF  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    7e-11  11%  3cmmC  [x.x.x] UBIQUITIN-ACTIVATING ENZYME E1 1
    2e-10  15%  2bmuB  [x.x.x] URIDYLATE KINASE
    8e-10  15%  2bmuA  [x.x.x] URIDYLATE KINASE
    2e-09   8%  2bk4A  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    5e-09  11%  3cp8A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    7e-09  11%  3cphH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    7e-09  12%  3datA  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-08   7%  3dbhB  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    3e-07  17%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    5e-07  22%  3cesC  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-06  19%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    2e-06  15%  3b3rA  [x.x.x] CHOLESTEROL OXIDASE
    3e-06  24%  2culA  [x.x.x] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED
    7e-06  16%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    1e-05  11%  3dbhE  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    1e-05   9%  3d4oC  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    2e-05  21%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    5e-05  23%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    6e-05   9%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    6e-05  20%  1d4cB  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    8e-05  19%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    9e-05  12%  3c0bD  [x.x.x] CONSERVED ARCHAEAL PROTEIN Q6M145
    1e-04  12%  3c24B  [x.x.x] PUTATIVE OXIDOREDUCTASE
    2e-04  13%  1e5lA  [c.2.1 - d.81.1] SACCHAROPINE REDUCTASE
    2e-04  17%  2aefA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    2e-04   6%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    3e-04  24%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    3e-04  22%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    4e-04  23%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    4e-04  12%  3c24A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    5e-04  26%  1d4cC  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    5e-04  15%  1d4dA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    6e-04  34%  3bi4A  [x.x.x] POLYAMINE OXIDASE FMS1
    6e-04  14%  2aemA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    8e-04  37%  3cnsA  [x.x.x] FMS1
    8e-04   6%  2amfD  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
:443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRK
2cduB           ----------------------------------------------------------------------
3cgcA           ----------------------------------------------------------------------
1d7yA           -------------------------------------------------------------------KRA
3cgbA           ---------------------------ANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRD
2cduA           ----------------------------------------------------------------------
2bc0A           ----------------------TNYGDANEIVVFDQNSNISFLGGMALWIGEQIAGPEGLFYSDKEELES
1djnA           -----------------------------------------------------------EWSYHRDYRET
1dxlA           ----------------------IPSKALLHSSHMYHEAKHSFANHGVKVSNVEIDLAAMMLTRGIEGLFK
2bc1A           ----------------------------------------------------------------------
2bs2A           ------------------------------------------------------------VANECLKLGV
2a87A           --------------------------QLAPLVFEGTGALMTTTDVENYPGFRNGITGPELMDEMREQALR
3cirA           ------------------------CPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFH
1dncA           ---------------------------------------------------------SRLNAIYQNNLTK
2a87B           --------------------------QLAPLVFEGTGALMTTTDVENYPGFRNGITGPELMDEMREQALR
1ebdA           -------------------------KALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLT
1bhyA           ----------------------------------------------------------------------
3eanC           -----------------------PKKLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMTESVQNHIGSL
3d1cA           ----------------------STRTITPSFTSNGFGPDNAISDTSPFTFNEEHISGETYAEYLQVVANH
2cfyA           ----------------------IPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSL
3dk9A           --------------------------FMHDHADYG-FPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTK
2b76M           --------------------------------------------------------------------QF
3ctyB           ---------------------------FSVAILDKAVAGGLTAEAPENYLGFKSIVGSELAKLFADHAAN
2a8xA           ----------------------------------------------------------------------
2b76A           -------------------------------------------------------------------LQF
1djqA           -----------------------------------------------------------EWSYHRDYRET
3bh1C           ----------------------------------------------------------------------
3eanA           ----------------------IPKKLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMTESVQNHIGSL
3eanF           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
2e5vA           ------------------------------------------------------------FNFLLKLARE
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3ctyA           ---------------------------FSVAILDKAVAGGLTAEAPLENYLGFKSIVGSELAKLFADHAA
3dghA           ----------------------------------------------------------------------
3cesB           ---------------------------------------------------------VLYRQAVRTALEN
1cl0A           ----------------------RANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAT
3ef6A           ----------------------------------------------------------------------
1e6eC           -------------------------------------------------------------------SCD
2ciqA           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cesD           -----------------------------------------------------------------TALEN
3cetA           ----------------------------------------------------------------------
2a0iA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
3cesA           ------------------------------------------------------------RQAVRTALEN
2bmaA           ---------------------------------------------------------NEILKFCQAFMNE
1e6eA           ----------------------------------------------------------------------
3cetB           -------------------------------------------------------------ANTKITELH
3cpiG           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
1coyA           ----------------------------------------------------------------------
2drvA           -----------------------------------------------------------LYRFTENFERA
2cyjA           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
2c76B           ----------------------------------------------------------------------
3dbrD           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
3d4oA           ----------------------TFDAKISLVGFDQLDFIGVTKRIDEVDWNTVDAILLPISGTNEAGKVD
3cp2A           ------------------------------------------------------------RQAVRTALEN
1chuA           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
3dbhF           ----------------------------------------------------------------------
3cmmC           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
2bk4A           ----------------------------------------------------------------------
3cp8A           --------------------------------------------------------------YMRRIVEH
3cphH           ----------------------------------------------------------------------
3datA           -------------------------------------------------ENRVIGKDNNLPWRLPSELQY
3dbhB           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
3dbhE           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
1d4cB           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
3c24B           ----------------------------------------------------------------------
1e5lA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
2amfD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
2cduB           -----------------------KDLITNEEKTEAYDKLIMTTGSKPTVPPIPGIDSSRVYLCKNYNDAK
3cgcA           -----------------------------------YDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAE
1d7yA           PEVEWLLGVTAQSFDPQAHTVA-----LSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTLRTLEDAR
3cgbA           KYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVPEWEGRDLQGVHLLKTIPDAE
2cduA           ----------------------VKDLITNEEKTEAYDKLIMTTGSKPTVPPIPGIDSSRVYLCKNYNDAK
2bc0A           LGAKVYMESPVQSIDYDAKTVTALVDGKNHVET--YDKLIFATGSQPILPPIKGAEIKEGSLLYQNSADV
1djnA           QITKLLKKNKESQLALGQKPMT-----ADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGALTPEQVM
1dxlA           KNKVTYVKGYGKFVSPSEISVDTIEGENTVV---KGKHIIIATGSDVKSLPGVTIDEKKIVSSTGALALS
2bc1A           -----------------------TGSQPILPPIKGAEIKEGSLEFEATLENLQFVKLYQNSADVIAKLEN
2bs2A           SIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVTGTAIALETGIAQ
2a87A           FGADLRMEDVESSLHGPLKSVV-----TADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCD
3cirA           MLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTN
1dncA           SHIEIIR-GHAAFTSDPKPTIEV----SGKKY--TAPHILIATGGMPSTPHESQIPG--ASLGITSDG--
2a87B           FGADLRMEDVESVSLHG-PLKSVVT---ADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCAT--
1ebdA           GGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGE
1bhyA           ----------------------------------------------------------------------
3eanC           WGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKAERFLIATGERPRYLGIPGDK-EYCISSDDLFSLP
3d1cA           YELNIFENTVVTNISYTIATTTETYHA---------DYIFVATGDYNFPKKPFKYGIHYSEIEDFDNFNK
2cfyA           NWGYRVALREKKVVYENAYGQFIGPHRIGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSL--
3dk9A           SHIEIIRGHAAFTSD---PKPTIEVSGK----KYTAPHILIATGGMPSTPHESQIPGSLGITSDGFFQLE
2b76M           PQIQRFDEHFVLDILVDDGHVRAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSH
3ctyB           YAKIREGVE-VRSIKKTQGGFDIET--NDDTYH--AKYVIITTGTTHKHLGVKGESEYFGKGTSYCSTCD
2a8xA           ----------------------------------------------------------------------
2b76A           PQIQRFDEHFVLDILVDDGHVRAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIGMGMALSHGVPL
1djqA           QITKLLKKNKESQLALGQKPMTADD---VLQYG--ADKVIIATGARWNTDGTNCLTHDPIPGADTPEQVM
3bh1C           ----FDREKYIEMQSQHIRERREAL---GGKLYLEMGGKLFDDMHASRVLPGFTPDNKIAMLDRIKDEVE
3eanA           NWGYRVALREKKVVYENAYGKFIGPHKIGKEKVYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
3eanF           ----------------------MATNNKGKEKVYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
3eanD           -------------------------------KVYSAERFLIATGERPRYLGIP-GDKEYCISSDDLFSLP
2e5vA           EGIPIIEDRLVEIRVKDGKVTGFVTEKRGLVED--VDKLVLATGGYSYLYEYSSTQSTNIGDGMAIAF--
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3ctyA           NYAKIREGVEVRSIKKT--QGGFDIETNDDTYH--AKYVIITTGTTHKHLGVKGESEYFGKGTSYCSTCD
3dghA           ----------------------------------------------------------------------
3cesB           QPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFR--AKAVVLTVGTFLDGKIHIGSIPLSRLPLRVGRLKT
1cl0A           KFETEIIFDHINKVDLQ----NRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCD
3ef6A           -----------------------RTISLDDGTTLSADAIVIATGSRARTMALPGSQLPGVVTLRTYGDVQ
1e6eC           TAVILGQGNVALDVARIL-----LTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELR
2ciqA           -------------IKETDKEVVLTH---PADET--TSVHILKYGATVYSWKLKSEEQLWLSTAAKLDG--
2bi7A           -----------------------------------EARALIAEKGDSTIADPQTFEEEALRFIGKELYEA
3cpiH           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cesD           QPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFR--AKAVVLTVGTFLDGKSIPLSRRLRELPLRVGRLKT
3cetA           ----------ILGIDIGNTKITELHENGEF-----KVHHLVSHVALVTTAETKKEGVDNIL--------N
2a0iA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
3cpjG           -----------------------SPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVYYKF
1d5tA           -----------------------------------RKFLVFVANFDENDPKTFEGVDPQNTSMRDVYR--
3cesA           QPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFR--AKAVVLTVGTFLDGKIHIGSIP---LSRRLRELPL
2bmaA           LYRHIGPCTDVPAGDIGVGGREIGYLYGQYKKI-VNSFNGTLTGKNVKWGGSNLRVEATGYLVYFVLEVL
1e6eA           ----------------------------------------------------------------------
3cetB           ENGEFKVHHLYFPWKNNDKLAEVLKTYSNDVS----HVALVTTAELADSY--------ETKKEGVDNILN
3cpiG           ----------------------------------------------------------------------
1cjcA           ----------------------------------------------------------------------
3bg7A           -------------------------------------------------EWDRLYTKAESYFQTGTDQ--
1coyA           -------------------------------YFPRANTGLGVNNIDQAWFESTEWYKFARTGRKTAQRSG
2drvA           KKEALSLEIALRKGEVDEDIIPLL---KKINSIENYFTTSSCSGRISVEPHVNAKWLGKWHREVSLYEVL
2cyjA           -----------MKIEEVRFGLVKID---GKEF--DHDIVIYPSGRIERRMKEISKKKHGTSHKLDPEELE
2c72A           ------------------NNFWRTMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATL
2c76B           ----FPPVWNPITYLDHNNFWRTMDD-MGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATL
3dbrD           ----------------------------------------------------------GPFTHPDFEPST
2c75B           -------------------------------IPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATL
3coxA           ------------------------------------PRANTGLGVNNIDQAWFESTEWYKFA-RTGRKTA
2brxA           -----------------------------------HMRIVFDIGGSVLVPENPDID-----FIKEIAYQL
3bg6A           ----------------------------------------------------------------------
2c72B           -----------------------TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATL
3d4oA           TIFSNESIVLTEEIEKTPNHCVVYSG-----ISNTYLNQCKKTNRTLVKLERDDIAIYNSIPTAEGTIAI
3cp2A           QPNLMIFQQAVEDLIVENDRVVGAVTQMGLKF--RAKAVVLTVGTFIPL------------SRRLRELPL
1chuA           ----------------------------------------------------------------------
2c73A           -----------------------TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATL
3d8xA           -----IITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCD
3dbhF           -------------------------------------------DWEGRWNHVKKFLESGPFTHPDFEPST
3cmmC           ------------------------------------------------------------------KEAM
2bmuB           --------------------------------------IVFDIGGSVLVPENPDIDFIKEIA-------Y
2bmuA           --------------------------------------IVFDIGGSVLVPENPDIDFIKEIA-------Y
2bk4A           -----------------------------REIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATL
3cp8A           EPNIDLLQDTVIGVSANSGKFSSVTVRSGRAI--QAKAAILACGTFLNGLIHIGMDHFPGGRSTAEPPVE
3cphH           ----------------------------------------------------------------------
3datA           V--KKTTMGHPLIMGR--KNYEAIGRPL------PGRRNIIVTRNEG--YHVEGCE--------VAHSVE
3dbhB           -------------------------------------------DWEGRWNHVKKFLERGPFTHPDFEPST
2czgA           --------------------------------------------------------------MIKLRDEL
3cesC           ----------------------------------------------------------------------
2czgB           ---------------------------------------------------------------IKLRD-E
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2dwcB           -----------------------------------------------------------VVMIKLRDELG
3dbhE           --------------------------------------------------------------------GD
3d4oC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
1d4cB           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
3c0bD           -------------------------------------LGIDIGGANTKITELHENGEFKVHHLYFPDKLA
3c24B           ----------------------------------------------------------------------
1e5lA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
2amfD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
2cduB           KLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVYKYFDKEFTDILAKDYEAHGVNLVLG
3cgcA           RILKTLETNKDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTN
1d7yA           RIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAPATLADFVARYHAAQGVDLRFE
3cgbA           RILKTLETNKVEDIIGGGAIG-LEAETFVELGKKVRIERNDHIGT--IYDGDAEYIYKEADKHHIEILTN
2cduA           KLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDHERVLYKYFDKEFTDILAKDYEAHGVNLVLG
2bc0A           IAKLENKDIKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAGYDRDLTDLMAKNMEEHGIQLAFG
1djnA           DGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGD
1dxlA           EI------PKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLK
2bc1A           KDIK------RVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLGYYDRDLTDLMAKNMEEHGIQLAFG
2bs2A           LGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKG
2a87A           GFFF---RDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVA
3cirA           GGIVTGDGMGMALSHGVPLRDMEFVQYHPAGLPGSGILMTEGCRGEGGIRDKVSQAFWHEWRKGNTISTP
1dncA           -FFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
2a87B           -CDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVA
1ebdA           V-------PKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTN
1bhyA           ---------GKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVN
3eanC           YC------PGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQ
3d1cA           GQYV---------VIGGNESGFDAAYQLAKNGSDIALYTSPSVRLSPYTRQRLGNVIKQGARIENVHYTV
2cfyA           ------PYCPGKTLVVGASYXXXXXXXXXXXXXXXXXXXXXXXLLRGFDQDMANKIGEHMEEHGIKFIRQ
3dk9A           ELPG------RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
2b76M           GVPLRDMQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNWHEWRKGNTISTP
3ctyB           GYLFK---GKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCENAYVQEIKKRNIPYIMNAQVTEI
2a8xA           -------------IAGAGAIG-EFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTA
2b76A           RDMEFV-QYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQ
1djqA           DGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGD
3bh1C           ILVCINLERHKIRAISYEEDVLRLVDVFRDRGFLVEHVV-----LTQNDNRLALAFIERLQRLGIKVSRH
3eanA           CP-------GKTLVVGASYVALECAGFLAGIGLD-VTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQ
3eanF           C-------PGKTLVVGASYVALECAGFLAGIGLDVTVMVRSI-LLRGFDQDMANKIGEHMEEHGIKFIRQ
3eanD           YCPG------KTLVVGASYVALECAGFLAGIGLDVTVMVRSILL-RGFDQDMANKIGEHMEEHGIKFIRQ
2e5vA           -KAGTILADMEFVQFHPTVTSLDGEVFLLTETLRGEGAQIINENGERFLFNYDKRGELAPRDILSRAIYI
3dh9A           --------------------------------------------LRGFDQQMAELVAASMEERGIPFLRK
3dghB           ----------------------------------------------GFDQQMAELVAASMEERGIPFLRK
3ctyA           GYLFK---GKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCENAYVQEIKRNIPYIMNAQVTEIV
3dghA           ---------------GAGYIGLECAGFLKGLGYEPTVMV-RSIVLRGFDQQMAELVAASMEERGIPFLRK
3cesB           GTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYITHTNEKTHDVIRSNLSIEDKVMRFA
1cl0A           GFFY---RNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRT
3ef6A           VLRDSWTSATRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVRVGRRIGAWLRGLLTELGVQVELG
1e6eC           EMIQ---LPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEWGLRFFRSPQQVLPSPDGRRAAG
2ciqA           --SKPVRGGIPLVFPVFGKNSTDEHLSKLPQHGLARNLGQTKENPPTVQFGLKPEIANPELTKLWPMDYL
2bi7A           FF------KGYTIKQWGMQPSELPASILKRLPVRFNYDDFNHKFQGMPKCGYTQMIKSILNHENIKVDLQ
3cpiH           ------------KEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPGFARLSAIYGGTYMLD
1bzlA           ----------------------------------------------------------------------
3cesD           GTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYITHTNEKTHDVIRSNLSIEDKVMRNQ
3cetA           AAESAFGSNISVFDSNGNFISLESAKTNNKVS------ASNWCGTAKW-------VSKNIEENCILVDGS
2a0iA           -----------------------------------------------------SIAQVRSAGSAGNFYTD
1aogA           -------------------------------------------ILRGFDHTLREELTKQLTANGIQILTK
1aogB           ----------------------------------------------------------------------
3cpjG           GLGN------STKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLARLSAIYGGTYMLD
1d5tA           --KFDLGQDVI--DFTGHALALYRTDDYLDQPCLETINRIKLYSESLARGELPQGFARLSAIYGGTYMLN
3cesA           RVGRLKTG--TPPRIDARTIDFSVLAQQHGDNPMPVFSQQVPCYITHTNEKTHDVIRSNLDRSPSIEDKV
2bmaA           KSLNIPVEKQTAVVSGSGNVALYCVQKLLHLNVKVLTLSDSNGYVYEPNGFTHENLEFLIDLKEEKKGRI
1e6eA           -----------------------------------------------WGLRFFRSPQQVLPSPDGRRAAG
3cetB           AAESAFGSNISVFDSNGNFISLESAKTNNKVSASN-------------WCGTAKWVSKNIEENCILVDGS
3cpiG           ---------------IGHAMALWTNDDYLQQPARPSFERILLYCQSYGLGELPQGFARLSAIYGGTYMLD
1cjcA           -----------------------------------------------WGLRFFRSPQQVLPSPDGRRAAG
3bg7A           --FKESIRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVEWSSANTVFDLQNRPNTDAPEERFNLFPA
1coyA           FTTA--FVPNVYDFEYMKKEAAGQVTKSGLGGEVIYGNN------AGKKSLDKTYLAQAAATGKLTITTL
2drvA           EASGQLWFLVRSPILHVGAKTLEDAVKLVNLAVSCGFKYSNIIRSTERDVLLGENGEIFVGEEYLNKIVE
2cyjA           KYLVEDFD--VLLVGTGIYGMLSLLPESKKLVEDKEVIEKPTKELKLLEELWGKKRILAII---------
2c72A           FVNL------CVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKL
2c76B           FVNL------CVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKL
3dbrD           ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAE
2c75B           FVNL------CVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKL
3coxA           QRSGFTTAFVPNVYDFEYMKKEAAGQVTKSGLGGEVIY----GNNAGKKSLDKTYLAQAAATGKLTITTL
2brxA           TKVSEDH--EVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVV-VEDF
3bg6A           --------IRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVESANTVFDLQNRPNTDAPEERFNLFPA
2c72B           ------FVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKVGGSGQVSERIMDLLGDRVKLE
3d4oA           QHTDFTIHGANVAVLGLGRVGSVARKFAALGAKVKVGARESDLLARIAEGEPFHISKAAQELRDVDVTIP
3cp2A           RVGRLKTG--TPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYITHTNDRNQHQIFLEPE
1chuA           -------------LYHPQARNFLLTEALRGEGAYLKRPDGTRFM-PDFDERGELAPRDIVARAIDHEMKR
2c73A           FVNL------CVTAETHEVSALWFLWYVKQCGGTTRIISTTNGQERKFVGGSGQVSERIMDLLGDRVKLE
3d8xA           GAVPI-FRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALE
3dbhF           ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAE
3cmmC           LKMQTS----NVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPQFFLTEKDIGQKRGDVTRAKLAELNAY
2bmuB           QLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANALLIAALREKAYPV--VVEDF
2bmuA           QLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANALLIAALREKAYPVVVEDFWE
2bk4A           FVNL------CVTAETHEVSALWFLWYVKQCGGTTRIFSTTNGGQERKFVGGSGQVSERIMDLLGDRVKL
3cp8A           GLTE------SLASLGFSFGRLKTGTPPRIDSRSVDYTIVTEQPGDKTTEKTHDILRTGFDRSPLFTGCP
3cphH           ----------------------------------------------------------------------
3datA           EVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYIKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYT
3dbhB           ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAE
2czgA           GTATT-DSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAH-------------------
3cesC           -LVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQDRVL------YRQAVRTALENQPNLMIFQ
2czgB           LGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAH-------------------
3b3rA           ---------GTVFVPNVYDFGYMQREAAGEVPKSALATEVIYGNNHGKQSLDKTYLAAALGTGKVTIQTL
2culA           -----------VLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDPFPRVWAFHARAKYLLEGLRPLHLFQA
2dwcB           TATTDSA--QKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQ----------------------
3dbhE           HGQEAL-ESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNNNFFLQRSSIGKNRAEAAMEFLQELNSD
3d4oC           ----------HVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDDGFIVTKRIDEVDWNTVDAILL----
2aefB           ---------RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLR----------------------
3cukA           ----------RVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQP-------
2amfA           --------AMKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLA-----------------
1d4cB           ---------------------------------------------------VAQVLWDNAVKRGTDIRLN
2dwcA           ---------QKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAH-------------------
3c0bD           EVLKTYSNDVSHVALVTEGVDNILNAAESAFGSNISVFDSNGNF--------------------------
3c24B           ---------KTVAILGAGGKGARITRKIHDSAHHLAAIEIAPEGRDRLQGGIPLTDGDGWIDEADVVVLA
1e5lA           ----------SVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESVQHSTPISLDVNDDAALDAEVAKHDL
2aefA           ---------RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVL----------------------R
2amfE           ---------MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDL-------
1b37A           ----------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGR----------------------
2aejB           ---------RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKK-------------------------
2dpoA           ----------DVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMK-------------
3c24A           ---------KTVAILGAGGKGARITRKIHDSAHHLAAIEIAPEGRDRLQGGIPLTDGDGWIDEADVVVLA
1d4cC           ---------------------------------------------------VAQVLWDNAVKRGTDIRLN
1d4dA           ---------TDVVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGNMNAAETKPQAKLGIEDKKQIMID
3bi4A           ------PAKKKVIIIGAGIAGLKASTLHQNGIQDCLVLEARDRV--------------------------
2aemA           ---------RHVVICGWSESTLECLRELRGSEVFVLA----------EDENVRKKVLRSGANFVHGDPTR
3cnsA           ------PAKKKVIIIGAGIAGLKAASTLQNGIQDCLVLEARDRV--------------------------
2amfD           ---------MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMS-----------


                         .         .         .         +         .         .         .:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
2cduB           SKVAAFEEVDDEIITKTLDGKEKSDIAILCIGFRPNTELLKG-KVAMLDNGAIITDEYMHSSNRDIFAAG
3cgcA           ENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAG
1d7yA           RSVTGSVDGVV---LLDDGTRIAADMVVVGIGVLANDALARAAGLAC--DDGIFVDAYGRTTCPDVYALG
3cgbA           ENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRT-NHKGAIEVNAYQTNVQDVYAAG
2cduA           SKVAAFEEVDDIITKTLDGKEIKSDIAILCIGFRPNTELLKG-KVAMLDNGAIITDEYMHSSNRDIFAAG
2bc0A           ETVKEVAGNGKVEKIITDKNEYDVDMVILAVGFRPNTTLGNG-KIDLFRNGAFLVNKRQETSIPGVYAIG
1djnA           HFCSRIEPGRMEIYNIWGSKRTYRGPGVSPRDANTSHRWIEFLVLVTGRHLKARESEWAENDIKGIYLIG
1dxlA           TKVVGVDTSGDGVKLGGEQTIIEADVVLVSAGRTPFTSGLDKIGVETDKLGRILVNERFSTNVSGVYAIG
2bc1A           ETVKEVAGNGKVEKIITDKNEYDVDMVILAVGFRPNTTLGN-GKIDLFRNGAFLVNKRQETSIPGVYAIG
2bs2A           VQSPYGQHLWILGRKHIETNRDVQEICEYFAGIDPAEKWAPVLPMQHYSMGGIRTDYRGEAKLKGLFSAG
2a87A           VDGDTTVTGLRVRDTNTGAETLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAG
3cirA           RGYLDLRHLGEK--KLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVG
1dncA           SQVKEVKKTLSGLEVSMVTAIPDVDCLLWAIGRVPNTKDLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
2a87B           VDGDTTVTGLRVRDTNTGAETLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAG
1ebdA           ALAKGAEEVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEGIKMTNRGLIEVDQQCRTSVPNIFAIG
1bhyA           TKTVAVEPKETFEGANAPKEPQRYDAVLVAAGRAPNGKLISAEKAGVTDRGFIEVDKQMRTNVPHIYAIG
3eanC           FVPTKIEQIEAGTPGRLETIEDEFNTVLLAVGRDSCTRTIGLETVINEKTGKIPVTDEEQTNVPYIYAIG
3d1cA           KDIDFNNGQYHIS-FDSGQSVHTPHEPILATGFDATKNPIVQQLFVTTNQDIKLTTHDESTRYPNIFIGA
2cfyA           FVPIKVEQIEVAQSTNSEEIEGEYNTVMLAIGRDACTRKIGLETVGVEKTGKIPVTDEEQTNVPYIYAIG
3dk9A           SQVKEVKKTLSGLELPVMTMIPDVDCLLWAIGRVPNTKDLSKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
2b76M           RGDVVYLDLRHLGEKKLHERLFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVG
3ctyB           VGDGKKVTGVKYKDRTTGEELIETDGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAG
2a8xA           TKVESIADGGSQVTVTVVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAGVDDYRTNVGHIYAIG
2b76A           AFWHEWRKGNTISTPRGERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVG
1djqA           HFCSRIEPGRMEIYNIWGDGWIEFDSLVLVTGRHSECTLWNE--------LKARESEWAENDIKGIYLIG
3bh1C           RVIPGYPTDMDRIVSDEGFGNEYAETTRDLVVVTAPGPGS-------GKLATCLSQVYHEHKRGVAAGYA
3eanA           FVPTKIEQIEAGTPNSEETIEDEFNTVLLAVGRDSCTRTLETVGVKINETGKIPVTDEEQTNVPYIYAIG
3eanF           FVPTKIEQIEAGTPGRLETIEDEFNTVLLAVGRDSCTRTIGLETVGNEKTGKIPVTDEEQTNVPYIYAIG
3eanD           FVPTKIEQIEAGTPGRLETIEDEFNTVLLAVGRDSCTRTLETVGVKINEKTKIPVTDEEQTNVPYIYAIG
2e5vA           EMLKGHKVFIDLSKIEDFERKFVVAKYLARHGHNYKVKIPIF-PAAHFVDGGIRVNIRGESNIVNLYAIG
3dh9A           TVPLSVEKQDYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTQKDKIPVDSQEATNVANIYAVG
3dghB           TVPLSVLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTQKDKIPVDSQEATNVANIYAVG
3ctyA           GDGKKVTGVKYKDRTTGEEKLIETDGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAG
3dghA           TVPLSVEKQDYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTQKDKIPVDSQEATNVANIYAVG
3cesB           DRNQHQIFLEPEGLTNGISTSLPFDVQMQIVRSMQGMEVRPGYAIEYDFFDPRDLKPTLEKFIQGLFFAG
1cl0A           LEEGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYQSGIHGNATQTSIPGVFAAG
3ef6A           TGVVGFSGEGQLEQVMASDGRSVADSALICVGAEPADQLAR--QAGLACDRGVIVDHCGATLAKGVFAVG
1e6eC           IRLAVTRLEGATRAVPTGDVDLPCGLVLSSIGYKSRPIDPSVPF--DPKLGVVPNMEGRVVDVPGLYCSG
2ciqA           LILTVELGSDIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLA-GMKLYDQLLKESYVDKHPVVTFN
2bi7A           REFIVEERT-------------HYDHVFYSGPLDAFYGYQRLGYRTLDFKKFTYQGCAVMNYCSVDVPYT
3cpiH           TPIDEVLYKKDTGKFETKLGTFKAPLVIADPTYFPEKCKSTGQR--VIRAICILNHPVPNTSNADSLQII
1bzlA           -------ADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMIKGGVQVDEYSRTNVSNIYAIG
3cesD           HQILEPEGLTSNENGISTSLPFDVQMQIVRSMQGMENIVRPGYAIEYDFFDPRDLKPTLEKFIQGLFFAG
3cetA           TTTDIIPIVEGKVVAEKTDLRLNHELLYVGTLRTPISHLGNTISFKGV--DTNVSSEYFAITADISVVLE
2a0iA           VLGSGERWAGRGAEQLGLQGVDKDVFTRLLEGRLPDGADLSRMQDGSRHRPGYDLTFSAPKSVSMMAMLG
1aogA           ENPAKVELNADGSKTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVIKNGGVQVDEYSRTNVSNIYAIG
1aogB           ---------------FESGKKMDFDLVMMAIGRSPRTKDLQLQNAGMIKNGGVQVDEYSRTNVSNIYAIG
3cpjG           TPIDEVLYTGKFEGVKTKLGTFKAPLVIADPTYFPEKCKSTGQR--VIRAICILNHPVPNTSNADSLQII
1d5tA           KPVDDIIMEGKVVGVKSEGEVARCKQLICDPSYVPDRVRKQVIRIICILSHPIKNTN-DANSCQIIIPQN
3cesA           MRFADRNQHQYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGAIEYDFFDPRDLKPTLEKFIQGLFFAG
2bmaA           KEYLNHSSTAKYFPN-EKPWGVPCTLAFPCATQNDVDLDQAKLLQKNGILVGEGANMPSTVDAINLFKSN
1e6eA           IRLAVTRLEGATRAVPTGDVDLPCGLVLSSIGYKSRPIDPSVPF--DPKLGVVPNMEGRVVDVPGLYCSG
3cetB           TTTDIIPIVEGKVVAEKTDLRLNHELLYVGTLRTPISHL--GNTISFKGVDTNVSSEYFAITADISVVLE
3cpiG           TPIDEVLYKKDTGKFEGVKTTFKAPLVIADPTYFPEKCKST--GQRVIRAICILNHPVPNTSNADSLQII
1cjcA           IRLAVTRLGEATRAVPTGDVDLPCGLVLSSIGYKSRPIDPSVPF--DPKLGVVPNMEGRVVDVPGLYCSG
3bg7A           VACERVVRNALNSEIESLHFEIKADVYVLTAGAVHNTQLLVNSGGRPNPANPPELLPSLGSYITLVFCQT
1coyA           HRVTKVAPATGEQGNVVATKVVTADRVFFAAGSVGTSKLLVSMKAQGHLPLSSQVGEGWGNNGNIMVGRA
2drvA           IANDQRRFKEKLKRLES-----------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2c72A           ERPVIYDQTRENVLVETLNHMYEAKYVISAIPPTLGMKIHFNPPMMRNQMITRVPLGSVIKC--------
2c76B           ERPVIYQTRENVLVETLNHEMYEAKYVISAIPPTLGMKINPPLPMMRNQMITRVPLGSVIKCIVYYKEPF
3dbrD           FLNDRVPNCNVVPHFNNDTFYRQFHIIVCGLDSIIARRWINGMLISLL--NYEDGVLDPSSIVPLIDGGT
2c75B           ERPVIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKINPPLPMMRNQMITRVPLGSVIKCIVYYKEPF
3coxA           HRVTKVAPQIDEQGNVVATKVVTADRVFFAAGSVGTSKLVSMKAQGHLPNLSSQVGEGWGNNGNIMVGRA
2brxA           WEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKAD--------------------------------
3bg6A           VACERVVRNALNSEIESLRFEIKADVYVLTAGAVHNTQLLVNSGFGQLGRNPPELLPSLGSYISLVFCQT
2c72B           RPVIYIDQTRENVLVETLNHMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVYYKE
3d4oA           ALVVTANVLAEPSHTFVIDLASKPGGTDFRYAE-KRGIKALLVPGLPGIVAPKTAGRILADVLVKLLA--
3cp2A           GLT------SNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAFDPRDLKPTLESKFIQGLFFAG
1chuA           LGADCMFLDISHKPADFIRQHFMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIG
2c73A           RPVTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFN-PPLPMMRNQMITRVPLGSVIKCIVYYKEPFW
3d8xA           AKGDGKLLLRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAG
3dbhF           FLNDRVPNCNVVPHFNNDTFYRQFHIIVCGLDSIIARRWINGMLISLL--NYEDGVLDPSSIVPLIDGGT
3cmmC           VPVNVL-----DSLDDVTQLSQFQVVVATDTVSLEDKVKIHSSGIRFISSETRGLFGNTFVDLGDEFTVL
2bmuB           WEAWKAVQLKKIPVGGTHPG-HTTDAVAALLAEFLKAD--------------------------------
2bmuA           AWK---AVQLKKIPVGGTHPGHTTDAVAALLAEFLKAD--------------------------------
2bk4A           ERPVIYIDQTRENVLTLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVYYKE
3cp8A           SIEDISRFPDKSSHHIFLEPNGFSTSLPEDIQIAGLRSIAKMIRPGYAIEPWQIRSTMETRPVENLFFAG
3cphH           --------------------------VIADPTYFPEKCKS--TGQRVIRAICILNHPVPNTSNADSLQII
3datA           YYYHVYE---------------------------------------------------------------
3dbhB           FLNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLL--NYEDGVLDPSSIVPLIDGGT
2czgA           ----------------------------------------------------------------------
3cesC           QAVEDLVENDRVVGAVTQMGKFRAKAVVLTVG---------TFLDGKIHIGSIPLSRRLR----------
2czgB           ----------------------------------------------------------------------
3b3rA           HQVKTIRDGGYALTVEQKDTEISCRYLFLGAGSLGSTELLVRARDTGTLPNNSEVGAGWGPNGNIMTARA
2culA           TATGLLLEGNRVVGVRTWEGPARGEKVVLAVGSFLGA---------------------------------
2dwcB           ----------------------------------------------------------------------
3dbhE           VSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADV---------------------------
3d4oC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
1d4cB           SRVVRILASGKVTGVYTGYYVIKADAVVIAAGGFAKNNERVSKYPKLKGFKATNHPGATGDGLDVALQAG
2dwcA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
3c24B           LPDNIIEAEDIVPRVRPGTIVLILDAAAPYAGVPERADITYFPPLFNDETDPAARTDYHGGIAKQAIVCA
1e5lA           VISLIPYTFHATVIKSAIR--QKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGLDPGIDHLYAIKTIE
2aefA           SGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAG
2amfE           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3c24A           LPDNIIEKVAEDIVPRVRPGTIVLI---------------------------------------------
1d4cC           SRVVREDASGKVTGVYTGYYVIKADAVVIAA---------------------------------------
1d4dA           DTMKGGRNINDPELVKVLANNSSDSIDWLTSMGADMTDVGRMGGASVN---------RSHRPTGGAGVGA
3bi4A           ----------------------------------------------------------------------
2aemA           VSDLEKANVRGARAVIVDLESDSETIHCILG-IRKIDESVRIIAEAERYENIEQLRMAGADQVISVISGR
3cnsA           ----------------------------------------------------------------------
2amfD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
2cduB           DSAAVHYNPTNSNAYIPLATNAVRQGRLVGLNLTEDKVKDMGTQSSSGLKLYGRTYVSTGINTALAKANN
3cgcA           DCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLH
1d7yA           DVTRQRNPLSGRFERIETWSNAQNQGIAVARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDE----
3cgbA           DCATHYHVIKEIHDHIPIGTTANKQGRLAGLNLDKRRAFKGTLGTGIIK--FNLTLARTGLNEKEAKGLH
2cduA           DSAAVHYNPTNSNAYIPLATNAVRQGRLVGLNLTEDKVKDMGTQSSSGLKLYGRTYVSTGINTALAKANN
2bc0A           DCATIYDNATRDTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLG
1djnA           DAE-----------APRLIADATFTGHRVAREIEEANP-----QIAIPY--KRETIAWGTPHMPGG-NFK
1dxlA           DVIP-------GPML---AHKAEEDGVACVEYLAGKVGHV-DYDKVPGVVYTNPEVASVGKTEEQVKETG
2bc1A           DCATIYDNATRDTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLG
2bs2A           EAACWDMHG-----FNRLGGNSVSEAVVAGMIVGEYFAEHCANTQ---VDLETKTLEKFVKGQEAYMKSL
2a87A           DLVDRTYR--------------------------------------------------------------
3cirA           ECSS----------VGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKD
1dncA           DVCGKALLT----------PVAIAAGRKLAHRLFEYEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKY
2a87B           DLVDRTYR--------------------------------------------------------------
1ebdA           DIVP----------GPALAHKASYEGKVAAEAIAGHPSAVDYVA-IPAVVFSDPECASVGYFEQQAKDEG
1bhyA           DIVG----------QPMLAHKAVHEGHVAAENCAGHKAYFDARVIPG-VAYTSPEVAWVGETELSAKASA
3eanC           DILE---------GKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKF
3d1cA           TVEN-------DNAKLCYIYKFRARFAVLAHLLTQREGLPAEVIENYQKNQYLDDYSCCEVSCT------
2cfyA           DILE---------DKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKF
3dk9A           DVCG----------KALLTPVAIAAGRKLAHRLFEYEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKY
2b76M           ECS----------SVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKD
3ctyB           DVTS---------GNFAQIASAVGDGCKAALSLYSD----------------------------------
2a8xA           DVNG----------LLQLAHVAEAQGVVAAETIAGAETLTLGDHRLPRATFCQPNVASFGLTEQQARNEG
2b76A           ECS----------SVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKD
1djqA           DAE-----------APRLIADATFTGH-----RVAREIEEANPQIAIPY--KRETIAWGTPHMPGG-NFK
3bh1C           KFETFPIWNLPLEHP-------------------------------------------------------
3eanA           DILE---------GKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKF
3eanF           DIL-------EGKLE--LTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKF
3eanD           DILEG-------KLELTPV--AIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKF
2e5vA           EVSDSGLHG-----ANRLASNSLLEGLVFGINLPRYVDSSWEGISTDDGIVHSVRISGNKTLSLKEIRRI
3dh9A           DIIYGKPE---------LTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQF
3dghB           DIIYG-------KPELT--PVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQF
3ctyA           DVTS---------GNFAQIASAVGDGCKAALSLYSD----------------------------------
3dghA           DIIYGKP---------ELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQF
3cesB           QIN-------------------------------------------------------------------
1cl0A           DVMD---------HIYRQAITSAGTGCMAALDAERYLDG-------------------------------
3ef6A           DVASWPLRAGGRRS-LETYMNAQRQAAAVAAAILGKNVSAPQ-LPVSWTEIAGHRMQMAGDIEGPGDFVS
1e6eC           WVKR---------GPTGVITTTMTDSFLTGQILLQDLKAG--------HLPSGPRPGSAFIKALLDSRGV
2ciqA           QETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNPWIEKSQGMADFEPKTGQQMICIE------
2bi7A           RITE----------HKYFSPWEQHDGSVCYKEYSRACEENDIP-YYPIRQMGEMALLEKYLSLAENETNI
3cpiH           IPQS----------QLGRKSDIYVAIVSDAHNVCSK--------GHYLAIISTIIETDKPHIELEPAFKL
1bzlA           DVTN----------RVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIPPIGTCGLIEEVASKRY
3cesD           QIN-------------------------------------------------------------------
3cetA           KVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGS
2a0iA           GDKR----------LIDAHNQAVDFAVRQVEALASTRVTVLTGNLVMALFNHDTSRDQEPQLHTHAVVAN
1aogA           DVTNRVM----------LTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIPPIGTCGLIEEVASKRY
1aogB           DVTN----------RVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIPPIGTCGLIEEVASKRY
3cpjG           IPQS----------QLGRKSDIYVAIVSDAHNVCSKGHYLAIISTIIETDKPHIEL-EPAFKLLGPIEEK
1d5tA           QVNRKSDIYVCMISYAHNVAAQGKYAIASTTVETTDPEKEVEPALGLLEPIDQKFVAISDLYEPIDDGSE
3cesA           QIN-------------------------------------------------------------------
2bmaA           NIIYCPSKAANAGGVAISGLEMSQNFQFSHWTRETVDEKLKEIM-----RNIFIACSENALKYTKN----
1e6eA           WVKR---------GPTGVITTTMTDSFLTGQILLQDLKAG--------HLPSGPRPGSAFIKALLDSRGV
3cetB           KVTTEEYTCDTPDGK-------------------------------------------------------
3cpiG           IPQS----------QLGRKSDIYVAIVSDAHNVCSKGHYLAIISTIIETDKPIELEPAFKLLGPIEEKFM
1cjcA           WVKR---------GPTGVITTTMTDSFLTGQILLQDLKAG--------HLPSGPRPGSAFIKALLDSRGV
3bg7A           VM----------STELIDSVKSDMTIRGTPGELTYSVTYTPGASTNKHPDWWNEKVKNHMMQHQEDPLPI
1coyA           NHMWDATGSKQATIP-------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2c72A           --IVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFIL-AHKARKLARLTKEERLKKL
2c76B           W----------RKKDYCGTMIIDGEEAPVAYTLDD-TKPEGNYAAIMGFILAHKARKLARLTKEERLKKL
3dbrD           EGFKGNAQVILPGMTACIECTLELYPPQVNFPMATIASMPRLPEHEYVRMLQWPKEQPFGEGVPLDGDDP
2c75B           WR----------KKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAA-IMGFILAHKARKLARLTKEERLKKL
3coxA           NHMWDATGSKQATIP-------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3bg6A           V----------MSTELIDSVKSDMTIRGTPGELTYSVTYTPGASTNKHPDWWNEKVKNHMMQHQEDPLPI
2c72B           PFWRKKDYCGTMIIDGEEAPVAYTL---------DDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKL
3d4oA           ----------------------------------------------------------------------
3cp2A           QIN-------------------------------------------------------------------
1chuA           EVSYTGLHGANRMASNSL-LECLVYGWSAAEDITR--------RMHDISTLPPWDESRVENPDERVVIQH
2c73A           RKKDYCG----------TMIIDGEEAPVAYTLDDTKPEGNYAAIMGFIL--AHKARKLARLTKEERLKKL
3d8xA           DVQD---------SKYRQAITSAGSGCMAALDAEKY----------------------------------
3dbhF           EGFKGNAAVILPGMT-------------------------------------------------------
3cmmC           DP----TGEEPRTGMVSDIEPDGTVTMLDD----------------------------------------
2bmuB           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
2bk4A           PFWRKKDYCGTMIIDGEEAPVAYTL---------DDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKL
3cp8A           QING-----------TSGYEEAAAQGLMAGINAVRKILGKELI-------VLGRDQAYIGVLIDDLITKE
3cphH           IPQSQLGRKSDIYVAIVSDAHNVCSKGHYLAIISTITDKPHIELEPAFKLLGPIEEKFMGIAELFEPRED
3datA           ----------------------------------------------------------------------
3dbhB           EGFKAAVILPGMTACICTLELYPPQVNFPMATIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPE
2czgA           ----------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
3b3rA           NH--------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
3dbhE           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
1d4cB           AATRDLEYIQAHPTYSPAGG--------------------------------------------------
2dwcA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
3c24B           LQGPEEHYAIGADICETWSPVTRTHRVTTEQLAILEPGLSEVAPFVETVHAVDECADRYGIDRQAALD--
1e5lA           EVHAAGGKIKTFLSY-------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1d4dA           HVAQVLWDNAVKRGTDIRLNSRVVRILEDGKVTGVLVKGEYTGYYVIKADAVVIAAGGFAKNNERVSKYD
3bi4A           ----------------------------------------------------------------------
2aemA           LMSRSIDDGYEAMFV-------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
2amfD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALRIDVLAALLHREGSVEXXXXX
2cduB           LKVSEVIIADNYRPEFMLSTDEVLMSLVYDPKTRVILGGALSSMHDVSQSANVLSVCIQNKNTIDDLAMV
3cgcA           IPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDV
1d7yA           ------------EIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFA-PLRRLLAVGAKPDRAALADP
3cgbA           IPYKTVKVDS-TNAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAAL--FNKSIHDLEDV
2cduA           LKVSEVIIADNYRPEFMLSTDEVLMSLVYDPKTRVILGGALSSMHDVSQSANVLSVCIQNKNTIDDLAMV
2bc0A           FDAAVTEYTDNQKPEFIEGNFPVTIKIVYDKDSRRILGAQMAAREDVSMGIHMFSLAIQEGVTIEKLALT
1djnA           I---------------------------------------------------------------------
1dxlA           VEYRVGKFPMANSRAKAIDNAEGLVKIIAEKETDKILGVHIMAPNAG-ELIHEAAIALQYDASSEDIARV
2bc1A           FDAAVTEYTDNQKPEFIEGNFPVTIKIVYDKDSRRILGAQMAAREDVSMGIHMFSLAIQEGVTIEKLALT
2bs2A           VESKGTEDVFK--IKNRMKDVMDDNVGIFRDGPHLEKAVKEL--EELYKKSKNVGIKNKRLHANP--ELE
2a87A           ----------------------------------------------------------------------
3cirA           LVNQDGGENWAK-IRDEMGLAMEEGCGIYRTPELMQKTIDKL--AELQERFKRVRITDTSSVFNT--DLL
1dncA           GIENVKTYSTSFTPMYTKRKTKCVMKMVCANKEEKVVGIHMQGLGCD-EMLQGFAVAVKMGATKADFDNT
2a87B           ----------------------------------------------------------------------
1ebdA           IDVIAAFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASD-MIAELGLAIEAGMTAEDIALT
1bhyA           RKITKANFPWAAGRAIANGCDKPFTKLIFDAETGRIIGGGIVGPNGGDM-IGEVYLAIEMGCDAADIGKT
3eanC           GEENIEVYHPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDST
3d1cA           ----------------------------------------------------------------------
2cfyA           GEENIEVYWPLEWTIPSRDNNKCYAKIICTKDNERVVGFHVLG-PNAGEVTQGFAAALKCGLTKKQLDST
3dk9A           GIENVKTYSTSFTPMYHARKTKCVMKMVCANKEEKVVGIHMQG-LGCDEMLQGFAVAVKMGATKADFDNT
2b76M           LVNQDGGENWAKIRDEMG--LAMEEGCGIYRTPELMQKTIDKLAELQE-RFKRVRITDTSSVFNTDLLYT
3ctyB           ----------------------------------------------------------------------
2a8xA           YDVVVAKFPFTANAKAHGGDPSGFVKLVADAKHGELLGGHLVGHDVAEL-LPELTLAQRWDLTASELARN
2b76A           LVNQDGGENWAKIRDEMG--LAMEEGCGIYRTPELMQKTIDKLAELQE-RFKRVRITDTSSVFNT--DLL
1djqA           I---------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3eanA           GEENIEVYHSFFWPLESRDNNKCYAKVICLKDNERVVGFHVLGPNAG-EVTQGFAAALKCGLTKQQLDST
3eanF           GEENIEVYHSFFWPLESRDNNKCYAKVINLKDNERVVGFHVLGPNAGE-VTQGFAAALKCGLTKQQLDST
3eanD           GEENIEVYHSFEWTVPSRDNNKCYAKVICLKDNERVVGFHVLGPNAG-EVTQGFAAALKCGLTKQQLDST
2e5vA           NWENVGIIRNEEKLVKAINTYSSSTQNEAIISYLTALA--------------------------------
3dh9A           GADEIEVFHGYYKFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINT
3dghB           GADEIEVFHGTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINT
3ctyA           ----------------------------------------------------------------------
3dghA           GADEIEVFHGYYKFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINT
3cesB           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3ef6A           RGMPGSGAA-----------------LLFRLQERRIQAVVAVDA-PRDFALATRLVEARAAIEPA-----
1e6eC           WPVSFSDWEKLDAEEVSRGQGKPREKLLDPQEMLRLLG--------------------------------
2ciqA           ----------------------------------------------------------------------
2bi7A           TFVGRLGTYRYLDMDVTIAEALKTAEVYLNSLTENQPMPVFT----------------------------
3cpiH           LGEKFMGIAELFEPREDGSKDNIYLSRSYDASSHFESMTDDVKDIYFRVTGHPLV---------------
1bzlA           EVVALSSFTPLMHKVSGSKYKTFVAKIITNHSDGTVLGVHLLGDNAPE-IIQGIGICLKLNAKISDFYNT
3cesD           ----------------------------------------------------------------------
3cetA           KKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLE------------------
2a0iA           LSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEALGYETEVVGKHGMWEMPGVPVEAFSGRSQ-----
1aogA           EVVALSSFTPLMHKVSGSKYKTFVAKIITNHSDGTVLGVHLLGDNAPE-IIQGIGICLKLNAKISDFYNT
1aogB           EVVALSSFTPLMHKVSGSKYKTFVAKIITNHSDGTVLGVHLLGDNAPE-IIQGIGICLKLNAKISDFYNT
3cpjG           FMG----IAELFEPREDGSKDNIYLSRSYDASSHFESMTD------------------------------
1d5tA           ----------------------------------------------------------------------
3cesA           ----------------------------------------------------------------------
2bmaA           ----------------------------------------------------------------------
1e6eA           WPVSFSDWEKLDAEEVSRGQGKPREKLLDPQEMLRLLG--------------------------------
3cetB           ----------------------------------------------------------------------
3cpiG           AELFEPREDGSKDNIYLYDASSHFESMTDDVKDFRVTGHPLVL---------------------------
1cjcA           WPVSFSDWEKLDAEEVSRGQGKPREKLLDPQEMLRLLG--------------------------------
3bg7A           PFEDPEPQVTTLFQPSHPWHTQIHRDAFS-----------------------------------------
1coyA           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2c72A           CELYAKVLGSLEALEPVH---YEEKNWCEEQYSGGCYTTYFPPGILTQYG--------------------
2c76B           CELYAKVLGSLEALEPVHYEEKNW---CEEQYSGGCYTTYFPPGILTQYGRVLRQPV-------------
3dbrD           EHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVLNNYLVFNDVDGLYTYTFEAERKENC
2c75B           CELYAKVLGSLEALEPV---HYEEKNWCEEQYSGGCYTTYFPPGILTQYG--------------------
3coxA           ----------------------------------------------------------------------
2brxA           ----------------------------------------------------------------------
3bg6A           PFEDPEPQVTTLFQPSHPWHTQIHRDAFSYGAVQQSIDSRLIVDWRFFGRTEPKEENKLW----------
2c72B           CELYAKVLGSLEALEPV---HYEEKNWCEEQYSGGCYTTYFPPGILTQYG--------------------
3d4oA           ----------------------------------------------------------------------
3cp2A           ----------------------------------------------------------------------
1chuA           NWHELFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKES
2c73A           CELYAKVLGSLEALEPV---HYEEKNWCEEQYSGGCYTTYFPPGILTQYG--------------------
3d8xA           ----------------------------------------------------------------------
3dbhF           ----------------------------------------------------------------------
3cmmC           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
2bk4A           CELYAKVLGSLEALEPV---HYEEKNWCEEQYSGGCYTTYFPPGILT-----------------------
3cp8A           TKEPRMFTSSAEHRLILRHDNADLRLRKIGYDCNLVSSDDLHRTESIIKRVQHCLEVMKT----------
3cphH           GSKDNIYLSRSYDASSHFESMTDDVKDIY----FRVTGHPLV----------------------------
3datA           ----------------------------------------------------------------------
3dbhB           HIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNA----------------------------
2czgA           ----------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
3dbhE           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2amfA           ----------------------------------------------------------------------
1d4cB           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
3c0bD           ----------------------------------------------------------------------
3c24B           FIGHLNVEIAWFGYSPKVAAL-------------------------------------------------
1e5lA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3c24A           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1d4dA           PKLKGFKAT-------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
2amfD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXYAPPFSPVWDPLLIAAQQAR
2cduB           DMLFQPQFDRPFNYLNILGQAA-
3cgcA           DLSYAPPYNSVWDPIQQAARRA-
1d7yA           ATDLRKLA---------------
3cgbA           DLSYAPPYNSVWDPIQQAARRA-
2cduA           DMLFQPQFDRPFNYLNILGQAA-
2bc0A           DIFFLPHFNKPYNYITMAALGAK
1djnA           -----------------------
1dxlA           CHAH-PTMSEAIKEAAMAT----
2bc1A           DIFFLPHFNKPYNYITMAALGAK
2bs2A           EAYRVPMMLKVALCVAKGALDR-
2a87A           -----------------------
3cirA           YTIELGHGLNVAECMAHSA----
1dncA           VAIH-PTSSEELVTL--------
2a87B           -----------------------
1ebdA           IHAH-PTLGEIAMEAAEVA----
1bhyA           IHPH-PTLGESIGMAAEVA----
3eanC           IGIH-PVCAEIFTTLSVTKRSGG
3d1cA           -----------------------
2cfyA           IGIH-PVCAEVFTTLSVTKRSG-
3dk9A           VAIH-PTSSEELVTL--------
2b76M           IELGHGL--NVAECMAHSAMAR-
3ctyB           -----------------------
2a8xA           VHTH-PTSEALQECFHGLVGH--
2b76A           YTIELGHGLNVAECMAHSAMARK
1djqA           -----------------------
3bh1C           -----------------------
3eanA           IGIH-PVCAEIFTTLSVTKRSGG
3eanF           IGIH-PVCAEIFTTLSVTKRSGG
3eanD           IGIH-PVCAEIFTTLSVTKRSGG
2e5vA           -----------------------
3dh9A           VGIH-PTTAEEFTRLAITKRSG-
3dghB           VGIH-PTTAEEFTRLAITK----
3ctyA           -----------------------
3dghA           VGIH-PTTAEEFTRLAITKRSG-
3cesB           -----------------------
1cl0A           -----------------------
3ef6A           -----------------------
1e6eC           -----------------------
2ciqA           -----------------------
2bi7A           -----------------------
3cpiH           -----------------------
1bzlA           IGVH-PTSAEELCSMRTPSYYY-
3cesD           -----------------------
3cetA           -----------------------
2a0iA           TIREAVGEDASLKSRDVAALDTR
1aogA           IGVH-PTSAEELCSMRTPSYYY-
1aogB           IGVH-PTSAEELCSMRTPSYYYV
3cpjG           -----------------------
1d5tA           -----------------------
3cesA           -----------------------
2bmaA           -----------------------
1e6eA           -----------------------
3cetB           -----------------------
3cpiG           -----------------------
1cjcA           -----------------------
3bg7A           -----------------------
1coyA           -----------------------
2drvA           -----------------------
2cyjA           -----------------------
2c72A           -----------------------
2c76B           -----------------------
3dbrD           PACSQLPQNIQFSP---------
2c75B           -----------------------
3coxA           -----------------------
2brxA           -----------------------
3bg6A           -----------------------
2c72B           -----------------------
3d4oA           -----------------------
3cp2A           -----------------------
1chuA           RGLHFTLDYPELLTHSGPS----
2c73A           -----------------------
3d8xA           -----------------------
3dbhF           -----------------------
3cmmC           -----------------------
2bmuB           -----------------------
2bmuA           -----------------------
2bk4A           -----------------------
3cp8A           -----------------------
3cphH           -----------------------
3datA           -----------------------
3dbhB           -----------------------
2czgA           -----------------------
3cesC           -----------------------
2czgB           -----------------------
3b3rA           -----------------------
2culA           -----------------------
2dwcB           -----------------------
3dbhE           -----------------------
3d4oC           -----------------------
2aefB           -----------------------
3cukA           -----------------------
2amfA           -----------------------
1d4cB           -----------------------
2dwcA           -----------------------
3c0bD           -----------------------
3c24B           -----------------------
1e5lA           -----------------------
2aefA           -----------------------
2amfE           -----------------------
1b37A           -----------------------
2aejB           -----------------------
2dpoA           -----------------------
3c24A           -----------------------
1d4cC           -----------------------
1d4dA           -----------------------
3bi4A           -----------------------
2aemA           -----------------------
3cnsA           -----------------------
2amfD           -----------------------