[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81963.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dmaB.bssp"
#ERROR : Can't open dsspfile "3czxD.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1e6yA.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3cgiD.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3d3xB.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2bjvA.bssp"
#ERROR : Can't open dsspfile "2bjwA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"

## Summary of PDB Search
:361
    1e-27   8%  1dmaB  [d.166.1] EXOTOXIN A
    6e-20   9%  3czxD  [x.x.x] PUTATIVE N-ACETYLMURAMOYL-L-ALANINE AMIDASE
    5e-17  14%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    9e-17  19%  1e6yA  [d.58.31 - a.89.1] METHYL-COENZYME M REDUCTASE I ALPHA
    8e-15  13%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-09  17%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-09  11%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-08  17%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-08  16%  3cgiD  [x.x.x] PROPANEDIOL UTILIZATION PROTEIN PDUU
    1e-07  20%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  16%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  14%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07  15%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-07  16%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-07  15%  1e2kB  [c.37.1] THYMIDINE KINASE
    6e-07  11%  4dcgA  [x.x.x] VP39
    9e-07  15%  1e2nB  [c.37.1] THYMIDINE KINASE
    1e-06  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-06   8%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-06  15%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06  14%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-06  12%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-06  13%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-06  16%  1e2jB  [c.37.1] THYMIDINE KINASE
    1e-05  15%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-05  11%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-05  16%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    3e-05  13%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-05  18%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-05  14%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-04  13%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-04  23%  2dftC  [x.x.x] SHIKIMATE KINASE
    3e-04  11%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-04  13%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-04  18%  2b8tC  [x.x.x] THYMIDINE KINASE
    3e-04  12%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    3e-04  15%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-04  14%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-04  25%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    5e-04  14%  3d3xB  [x.x.x] TYPE E BOTULINUM TOXIN
    5e-04  16%  2b8tD  [x.x.x] THYMIDINE KINASE
    6e-04   8%  1eamA  [c.66.1] PROTEIN (VP39)
    7e-04  23%  2dftA  [x.x.x] SHIKIMATE KINASE
    7e-04  20%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    8e-04  24%  2cckB  [x.x.x] THYMIDYLATE KINASE
    8e-04  16%  2bjvA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    0.001  21%  2bjwA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    0.001  20%  3cmvA  [x.x.x] PROTEIN RECA
    0.001  14%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
:361

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMYALMDEKQQRIFEEE
1dmaB           ----------------------------------------------------------------------
3czxD           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1e6yA           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3cgiD           ------------------------------------------------------------------YVPG
1e9sL           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
4dcgA           ------------------------------------------------------PFMYFEEIDNELDYEP
1e2nB           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
1dmaB           ----------------------------------------------------------------------
3czxD           ----------------------------------------------------------------------
1eg7A           --IEIAQAAKMKPVMEL-----ARGLGIQEDEVELYGKYKAKISLRLKDKPDGKLILVTAITPTPAGEGK
1e6yA           ------------------------------------------------------------LATGNANAGL
1eg7B           -EIAQAAKMKPVMELARGLGIQEDEVELYGKYKAKIS---LDVYRRLKDKPDGKLILVTAITPTPAGEGK
1e9sK           ----------GQGEFGGAPFKRFL-RGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAELLVNGATGTGK
3do6A           -------------------------------------IAKIDHRFLKSLENHGKLILVTAVTPTPAGEGK
1e9sE           ----------GQGEFGGAPFKRFL-RGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDRHLLVNGATGTGK
3cgiD           KQVTLAHLIPGKDLFKKLGLQDAVSAIGILTISEASIIACDIATKSGAVEIGLDRFTGAVVLTGDVSAVE
1e9sL           ----------GQGEFGGAPFKRFLR-GTRIVSGGKLKRMTREKAKQVTVAGVPMPAEPHLLVNGATGTGK
1e9rB           ----------GQGEFGGAPFKRRGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1e9sB           ----------GQGEFGGAPFKRFLRGTRIVSGGKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1e9sI           ----------GQGEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGVP-MPRDAEPHLLVNGATGTGK
1e9sM           ----------GQGEFGGAPFKRRGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1e2kB           -----------------------------------------------------MPTLLRVYIDGPHGMGK
4dcgA           ESAEVAKKLPYQGQLKLLL---------------------GELFFLSKLQRHGILDGATV---VYIGSAP
1e2nB           -----------------------------------------------------MPTLLRVYIDGPHGMGK
1e9sJ           ----------GQGEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1dekB           ----------------------------------------------------------LIFLSGVKRSGK
1e9rF           ------------GEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1e9rG           -----------QGEFGGAPFKRFLRGTRIVSGGKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1e9sA           ----------GQGEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGK
1e9sD           ------------GEFGGAPFKRFLRGTRIVSGGKRMTREKAKQVTVAGVP-MPRDAEPHLLVNGATGTGK
1e2jB           -----------------------------------------------------MPTLLRVYIDGPHGMGK
1e9sF           ----------GQGEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGVP-MPRDAEPHLLVNGATGTGK
3czpB           --------------------------------------REALLEAQFELK-QQARFPVIILINGIEGAGK
1ak2A           -------------------------------------------------------PKGRAVLLGPPGAGK
1e2mB           -----------------------------------------------------MPTLLRVYIDGPHGMGK
3dm9B           ------------------------------------SEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGK
1e9sH           ----------GQGEFGGAPFKRFLRGTRIVSGGKRMTREKAKQVTVAGVP-MPRDAEPHLLVNGATGTGK
3czpA           -------------------------------------------------------FPVIILINGIEGAGK
2dftC           -----------------------------------------------------------AVLVGLPGSGK
1akeA           -----------------------------------------------------------IILLGAPGAGK
3c14C           -----------------------------------------------------------LLLLGAGESGK
2b8tC           ----------------------------------------------------------IEFITGPMFAGK
1av6A           -----------------------------------------ELFFLSKLQRHGILDGATV---VYIGSAP
1e9rA           ----------GQGEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGVP-MPRDAEPHLLVNGATGTGK
1e9sG           ----------GQGEFGGAPFKRFLRGTRIVSGGKRMTREKAKQVTVAGV-PMPRDAEPHLLVNGATGTGK
1c9kC           ----------------------------------------------------------MILVTGGARSGK
3d3xB           ----------------------------------------------NSFNYNDPVNDRTILYIKPGGCQE
2b8tD           ----------------------------------------------------------IEFITGPMFAGK
1eamA           -----------------------------------------------------------GATVVYIGSAP
2dftA           -----------------------------------------------------------AVLVGLPGSGK
1dekA           ----------------------------------------------------------LIFLSGVKRSGK
2cckB           ----------------------------------------------------------FITFEGPEGSGK
2bjvA           ----------------------------------------------LEQVSHLAPLDKPVLIIGERGTGK
2bjwA           ----------------------------------------------LEQVSHLAPLDKPVLIIGERGTGK
3cmvA           ---------------------------------------------DIALGAGGLPMGRIVEIYGPESSGK
1e9rD           ------------GEFGGAPFKRFLRIVSGGKLK-RMTREKAKQVTVAGVP-MPRDAEPHLLVNGATGTGK


                         +         .         .         .         .         *         .:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
1dmaB           ---------FLGDG-GDVSFSTRGTQNWTVER--LLQAHRQLEERG-YVFVGYHGTFLEAAQSIVFGGVR
3czxD           ---------------------------------------------AQDRNIVASILRNDYGLTVKTDGTG
1eg7A           TTTSVGLTDALARLGKRVMVCLREPSLGPSFGIK--------GGAAGGGY--AQVVPMEDINLHFTGDIH
1e6yA           SGWYLSMY------------LHKEAWGRLGFF-------------FDLQDQGATNVLSYQGDEGLPDELR
1eg7B           TTTSVGLTDALARLGKRVMVCLREPSLGPSFGIK--------GGAAGGGY--AQVVPMEDINLHFTGDIH
1e9sK           SVLLRELA--YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
3do6A           TTTSIGLSSLNR-IGKKSIVTLREPSNLHFTGDHAVASAHNLLAAVLDSHIKHGNELKIDITRVFWKRTD
1e9sE           SVLLRELAY--TGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
3cgiD           YA-LKQVTRTLGEMMQFTTCSITRTLEHHH----------------------------------------
1e9sL           SVLLRELAYTGLLRG--DRMVIVDPNGDMLSKFGRDKDIILNPYDQRTK---------------------
1e9rB           SVLLRELAYTGLLRGDRMV--IVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
1e9sB           SVLLRELAYTG--LLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALS-
1e9sI           SVLLRELAYTG--LLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
1e9sM           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRD------------------------------------
1e2kB           TTTTQLLVALGSRD---DIVYVPEPMTYWRVL----------------GASETIANIYTTQHRLDQGEIS
4dcgA           GTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSI-----------------
1e2nB           TTTTQLLVALGSRD---DIVYVPEPMTYWRVL----------------GASETIANIYTTQHRLDQGEIS
1e9sJ           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVP
1dekB           DTTADFIMSNYS---AVKYQLAGPIKDALAYAWGVFAANTDYPTRKEFEGIDYDRETNLNLTKLEVITIM
1e9rF           SVLLRELAYTGLLRGDRMV--IVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
1e9rG           SVLLRELA--YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ------
1e9sA           SVLLRELA--YTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
1e9sD           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG--------------------------------------
1e2jB           TTTTQLLVALGS---RDDIVYVPEPMTYWRVLGASETIAN----------------IYTTQHRLDQGEIS
1e9sF           SVLLRELAY--TGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV
3czpB           -GETVKLLNEWDPRLI-EVQSFLRPSDEELERPPQWRFWRRLPPKGRTGIFFGNWYSQLYARV-------
1ak2A           GTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKL----------------------------------
1e2mB           TTTTQLLVALGSRD---DIVYVPEPMTYWRVL----------------GASETIANIYTTQHRLDQGEIS
3dm9B           TTTIAKLANWLKNHGFSVVIAASDTEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAG
1e9sH           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRD------------------------------------
3czpA           GETVKLLNEWDPRVQSFLRPSDEELERPPQWRFWRRLPP-------------------------------
2dftC           STIGRRLAKALGVGLLDTDVAIEQRTGRSIAD--------------------------------------
1akeA           GTQAQFIMEKYGIPQISTGDMLRAAVKSGSELG-------------------------------------
3c14C           S-TIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLV---------------------------
2b8tC           TAEL-IRRLHRLEYADVKYLVFKPKIDSRTGTSL------------------------------------
1av6A           GTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTL------------------------------
1e9rA           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG--------------------------------------
1e9sG           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDI---------------------------------
1c9kC           SRHAEALIGDAPQVLYIATSQILHHKDGRPAH--------------------------------------
3d3xB           -FYKSFNIMKNIWIIPERNVIGTTPQDF------------------------------------------
2b8tD           TAELIRRLHRLEYADVKYLVFKPKSIRNIQSRTGTSLPSVEVESAPEILN--------------------
1eamA           GTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIK----------------
2dftA           STIGRRLAKALGVGLLDTDVAIEQRTGRSIAD--------------------------------------
1dekA           DTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLT----------------------------
2cckB           T-TVINEVYHRLVKDYDVIMTREPGGVPTGEEIR------------------------------------
2bjvA           -ELIA---------SRLHYLSSRWQGPFISLNCAALN-ENLLDSELFGHERHPGRFERADGGTLFLDEL-
2bjwA           -ELIASRLHYLSSRWQGPFISLNC----------------------------------------------
3cmvA           -TTLTLQVIAAAQREGKTCAF------IDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEIC------
1e9rD           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG--------------------------------------


                         .         .         .         +         .         .         .:280
query           DYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG
1dmaB           AQDLDAIWRGFYIAGDPALAYGYAQIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPL
3czxD           KGNPLRDAVKLIR-GSDVAIEFHTNAAANKTATGIEALSTPKNKRWCQVLGKAVAKKTGWKLRGEDGFKP
1eg7A           AVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDLNERALRNIVIGLG-------------------
1e6yA           G---PNYPNYAMNVGHQGYAGIAQAAHSGRGDAFT-VNP-----LLKVCFADDLLPFNFAEP--------
1eg7B           AVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDLNERALRNIVIGLGGKANGV-------------
1e9sK           VP--------------------------------------------------------------------
3do6A           NDRALRSIVIGLGGSANGFPREDSFIITAASEVAILALSENKDLKER-----------------------
1e9sE           VP--------------------------------------------------------------------
3cgiD           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9rB           VP--------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9sI           VP--------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e2kB           AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLM-------
4dcgA           ----------------------------------------------------------------------
1e2nB           AGDAAVVMTSAQITMGMPYAVTDAVLA-PHIGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQA
1e9sJ           R---------------------------------------------------------------------
1dekB           EQAFCYLNGKSPIKGVFVFDDEGKE--SVNFVAFNKITDVINNIEDQWSV---------RRLMQALGTDL
1e9rF           VP--------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sA           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFL----------------
1e9sD           ----------------------------------------------------------------------
1e2jB           AGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDR-----------------------
1e9sF           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e2mB           AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGS-PPALTLIFDRHPIAALLCYPA-ARYLMGSMTPQ
3dm9B           RS--------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFM
1dmaB           RLDAITGPEEEGGRLETILGW-------------------------------------------------
3czxD           DNAGQHSRLAYAQAGGIVFE--------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1e6yA           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3cgiD           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e2nB           VLAFVALIPPTL----------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dekB           IVNNFDRMYWVKLFALDYLDKFNS-----GYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGAGLPIR--
1e9rF           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e2mB           AVLAFVALIPPTLPGTNIVLGALPEDRLAKRLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQLSGP
3dm9B           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3d3xB           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLAGAPExxxx
1dmaB           -----------
3czxD           -----------
1eg7A           -----------
1e6yA           -----------
1eg7B           -----------
1e9sK           -----------
3do6A           -----------
1e9sE           -----------
3cgiD           -----------
1e9sL           -----------
1e9rB           -----------
1e9sB           -----------
1e9sI           -----------
1e9sM           -----------
1e2kB           -----------
4dcgA           -----------
1e2nB           -----------
1e9sJ           -----------
1dekB           -----------
1e9rF           -----------
1e9rG           -----------
1e9sA           -----------
1e9sD           -----------
1e2jB           -----------
1e9sF           -----------
3czpB           -----------
1ak2A           -----------
1e2mB           QSNAGPR----
3dm9B           -----------
1e9sH           -----------
3czpA           -----------
2dftC           -----------
1akeA           -----------
3c14C           -----------
2b8tC           -----------
1av6A           -----------
1e9rA           -----------
1e9sG           -----------
1c9kC           -----------
3d3xB           -----------
2b8tD           -----------
1eamA           -----------
2dftA           -----------
1dekA           -----------
2cckB           -----------
2bjvA           -----------
2bjwA           -----------
3cmvA           -----------
1e9rD           -----------