[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tthe0:AAS81992.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2biiA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "2a9aB.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "2bihA.bssp"
#ERROR : Can't open dsspfile "2a9aA.bssp"
#ERROR : Can't open dsspfile "2ca3A.bssp"
#ERROR : Can't open dsspfile "2a9bA.bssp"
#ERROR : Can't open dsspfile "2a99A.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"

## Summary of PDB Search
:220
    2e-28  19%  2biiA  [x.x.x] NITRATE REDUCTASE [NADPH]
    3e-25  23%  2a9cA  [x.x.x] SULFITE OXIDASE
    2e-23  23%  2a9dB  [x.x.x] SULFITE OXIDASE
    7e-22  22%  2a9aB  [x.x.x] SULFITE OXIDASE
    3e-20  23%  2a9dA  [x.x.x] SULFITE OXIDASE
    1e-14  17%  2bihA  [x.x.x] NITRATE REDUCTASE [NADPH]
    6e-12  24%  2a9aA  [x.x.x] SULFITE OXIDASE
    2e-10  23%  2ca3A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    2e-10  26%  2a9bA  [x.x.x] SULFITE OXIDASE
    2e-09  24%  2a99A  [x.x.x] SULFITE OXIDASE
    1e-04  27%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
:220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxPEGMDPRVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLARP
2biiA           -------------------KLYDSGFLTSLHFVRNHGPVPYVPDLDWEVSIEGMVETPYKIKLSDIMEQD
2a9cA           ---------------------PPAELLAERFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRP
2a9dB           ------------------AELLAERFLTELFFTRNHLPVPAVEPSSYRLRVDGPGGRTLSLSLAELRSRP
2a9aB           ------------------AELLAERFLTELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRP
2a9dA           ------------------AELLAERFLTELFFTRNHLPVPAVEPSSYRLRVDGP---TLSLSLAELRSRP
2bihA           --------------PPLTKLYDSGFLTVSLHFVRNHGPVPYVPDLDWEVSIEGMVETPYKIKLSDIMEQD
2a9aA           ---------------------PPAELLAERFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRP
2ca3A           -------------------ITPNDAFFVMYH---LAGIPLEIDPDAFRLEIKGKVGTPLSLSLQDLKNDP
2a9bA           ----------------------------ELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRP
2a99A           -------------AEPPAELLAERFLTPELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRP
2c9xA           -------------------ITPNDAFFVRYHLA---GIPLEIDPDAFRLEIKGKVGTPLSLSLQDLKNFP


                         .         .         *         .         .         .         .:140
query           QVELTRDFHCVTRWSRLDVTWKGVRTRDLXXXXXXXXXXXXXXXESYGGYTTNXXXXXXXXXXXXXAHTL
2biiA           IYSTPVTMVCAGNRRKEQSLWTGCMLGDVIGKARPSKRARFVWMEGNGAYGTCIRLSWCMDPERCIAYQQ
2a9cA           KHEVTATLQCAGNRRSEMARWGGARLRDVLLHAGFPEELQGEWHVCFAPYGASIPYGRALSPAADVAYEM
2a9dB           KHEVTATLQCAGNRRSETARWGGARLRDVLLHAGFPEELQGEWHVCFEGYGASYGRALSPAADVLLAYEM
2a9aB           KHEVTATLQCAGNRRSEMARWGGARLRDVLLHAGFPEELQGEWHVCFAPYGASYGRALSPAADVLLAYEM
2a9dA           KHEVTATLQCAGNRRSETARWGGARLRDVLLHAGFPEELQGEWHVCFEGYGASIPYGRALSPAADVAYEM
2bihA           IYSTPVTMVCAGNRRKEQSLWTGCMLGDVIGKARPSKRARFVWMEGAGAYGTCIRLSWCMDPERCIAYQQ
2a9aA           KHEVTATLQCAGNRRSSTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLSIPYGRALSPAADVLLAYEM
2ca3A           ASEVVAVNQCSANGAMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGTPDFVKALSIDHATDGEVMLAYSM
2a9bA           KHEVTATLQCAGNRRSEMSRVRPV----------------------------------------------
2a99A           KHEVTATLQCAGNRR-------------------------------------------------------
2c9xA           ASEVVAVNQCSANGAMGNARWRGVPLKAV-----------------------------------------


                         +         .         .         .         .         *         .:210
query           FGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRI
2biiA           NGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDE
2a9cA           NGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTV----------
2a9dB           NGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTV----------
2a9aB           NGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQE
2a9dA           NGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVD---------
2bihA           NGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDE
2a9aA           NGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCV---------------
2ca3A           NGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAYRI--------------------
2a9bA           ----------------------------------------------------------------------
2a99A           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RFAxxxxxxx
2biiA           RYA-------
2a9cA           ----------
2a9dB           ----------
2a9aB           LP--------
2a9dA           ----------
2bihA           RY--------
2a9aA           ----------
2ca3A           ----------
2a9bA           ----------
2a99A           ----------
2c9xA           ----------